Changeset 1129

Timestamp:

Jul 12, 2011, 6:07:34 PM (13 years ago)

Author:

marko@…

Message:

Prevođenje u kdebaseu

Location:

kde-croatia/kde4/summit/hr/summit/messages

Files:

• kdebase/kcm_platform.po (modified) (24 diffs)
• kdebase/kcmcolors.po (modified) (13 diffs)
• kdebase/kcminput.po (modified) (19 diffs)
• kdebase/kcmkio.po (modified) (70 diffs)
• kdebase/kcmkonq.po (modified) (6 diffs)
• kdebase/kcmkwincompositing.po (modified) (16 diffs)
• kdebase/kcmkwinrules.po (modified) (29 diffs)
• kdebase/kcmlocale.po (modified) (40 diffs)
• kdebase/kcmnic.po (modified) (4 diffs)
• kdebase/kcmopengl.po (modified) (9 diffs)
• kdebase/kcmstyle.po (modified) (9 diffs)
• kdebase/kurifilter.po (modified) (15 diffs)
• kdebase/kwin.po (modified) (16 diffs)
• kdebase/kwin_clients.po (modified) (11 diffs)
• kdebase/kwin_effects.po (modified) (7 diffs)
• kdebase/kxkb.po (modified) (10 diffs)
• kdebase/libkdecorations.po (modified) (4 diffs)
• kdebase/libplasmaclock.po (modified) (9 diffs)
• kdebase/plasma-desktop.po (modified) (11 diffs)
• kdebase/plasma_applet_folderview.po (modified) (21 diffs)
• kdebase/plasma_applet_launcher.po (modified) (8 diffs)
• kdebase/plasma_applet_system-monitor.po (modified) (4 diffs)
• kdebase/plasma_engine_weather.po (modified) (9 diffs)
• kdebase/plasmagenericshell.po (modified) (7 diffs)
• kdebase/plasmapkg.po (modified) (12 diffs)
• kdelibs/kdecalendarsystems.po (modified) (24 diffs)

kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcm_platform.po

@@ -9 +9 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-07-08 10:22+0200\n"
-"PO-Revision-Date: 2011-07-11 22:07+0200\n"
+"PO-Revision-Date: 2011-07-12 16:36+0200\n"
 "Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
@@ -17 +17 @@
 "Language: hr\n"
 "X-Generator: Lokalize 1.2\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
 "X-Environment: kde\n"
 "X-Accelerator-Marker: &\n"
@@ -54 +55 @@
 #. +> trunk stable
 #: platform.ui:41
-#, fuzzy
 #| msgctxt "tooltip for option in switching Windows Desktop shells"
 #| msgid "Native Windows Explorer shell"
 msgid "Native Windows Explorer shell"
-msgstr "Izvorna ljuska prozorskog preglednika"
+msgstr "Izvorna ljuska Windows Explorera"
 
 #. i18n: whatsThis for option in switching Windows Desktop shells
@@ -67 +67 @@
 #| msgctxt "whatsThis for option in switching Windows Desktop shells"
 #| msgid "This is the standard Windows Desktop shell. Choose this if you want to return your system to the default desktop."
-msgid "This is the standard Windows Desktop shell. Choose this if you want to return your system to the default desktop."
-msgstr "Ovo je standardna ljuska radne površine Windowsa. Izaberite ovo ukoliko şelite vratiti vaš sustav na zadanu radnu površinu."
+msgid ""
+"This is the standard Windows Desktop shell. Choose this if you want to return "
+"your system to the default desktop."
+msgstr ""
+"Ovo je standardna ljuska radne površine Windowsa. Izaberite ovo ukoliko "
+"şelite vratiti vaš sustav na zadanu radnu površinu."
 
 #. i18n: radio button to choose Windows Desktop shell
@@ -87 +91 @@
 #. +> trunk stable
 #: platform.ui:61
-#, fuzzy
 #| msgctxt "tooltip for option in switching Windows Desktop shells"
 #| msgid "Use the KDE desktop shell, as it is seen on Linux."
 msgid "Use the KDE desktop shell, as it is seen on Linux."
-msgstr "Koristite KDE ljusku radne površine kao što je viđeno na Linuxu."
+msgstr "Koristi KDE-ovu ljusku radne površine kakva je i u GNU/Linuxu."
 
 #. i18n: whatsThis for option in switching Windows Desktop shells
@@ -100 +103 @@
 #| msgctxt "whatsThis for option in switching Windows Desktop shells"
 #| msgid "Choose this option if you would like to use the Plasma desktop shell for your Windows system."
-msgid "Choose this option if you would like to use the Plasma desktop shell for your Windows system."
-msgstr "Izaberite ovu opciju ako şelite koristiti ljusku radne površine Plasma na vašem Windows sustavu."
+msgid ""
+"Choose this option if you would like to use the Plasma desktop shell for your "
+"Windows system."
+msgstr ""
+"Izaberite ovu opciju ako şelite koristiti ljusku radne površine Plasma na "
+"vašem Windows sustavu."
 
 #. i18n: radio button to choose Windows Desktop shell
@@ -120 +127 @@
 #. +> trunk stable
 #: platform.ui:81
-#, fuzzy
 #| msgctxt "tooltip for option in switching Windows Desktop shells"
 #| msgid "Your custom desktop shell"
@@ -133 +139 @@
 #| msgctxt "whatsThis for option in switching Windows Desktop shells"
 #| msgid "Choose this and press the <i>\"Setup...\"</i> button to configure you custom desktop shell. Not recommended for the average user."
-msgid "Choose this and press the <i>\"Setup...\"</i> button to configure you custom desktop shell. Not recommended for the average user."
-msgstr "Odaberite ovo i pritisnite gumb <i>\"Postavke...\"</i> za podešavanje vaše prilagođene ljuske radne površine. Nije preporučljivo prosječnim korisnicima."
+msgid ""
+"Choose this and press the <i>\"Setup...\"</i> button to configure you custom "
+"desktop shell. Not recommended for the average user."
+msgstr ""
+"Odaberite ovo i pritisnite gumb <i>\"Postavke...\"</i> za podešavanje vaše "
+"prilagođene ljuske radne površine. Nije preporučljivo prosječnim korisnicima."
 
 #. i18n: radio button to chose Windows Desktop shell
@@ -146 +156 @@
 #. +> trunk stable
 #: platform.ui:94
-msgid "This shell is reserved for the user's custom shell. Press the \"Setup\" button to setup your favorite shell."
-msgstr "Ova ljuska je rezervirana za korisnički prilagođenu ljusku. Pritisnite gumb \"Postavke...\" da podesite vašu omiljenu ljusku."
+msgid ""
+"This shell is reserved for the user's custom shell. Press the \"Setup\" "
+"button to setup your favorite shell."
+msgstr ""
+"Ova ljuska je rezervirana za korisnički prilagođenu ljusku. Pritisnite gumb "
+"\"Postavke...\" da podesite vašu omiljenu ljusku."
 
 #. i18n: tooltip for button to setup custom Desktop shell
@@ -153 +167 @@
 #. +> trunk stable
 #: platform.ui:109
-#, fuzzy
 #| msgctxt "tooltip for button to setup custom Desktop shell"
 #| msgid "Press to setup your custom desktop shell"
@@ -166 +179 @@
 #| msgctxt "whatsThis for button to setup custom Desktop shells"
 #| msgid "Press this and a configuration dialog will appear to allow you to configure your custom desktop shell."
-msgid "Press this and a configuration dialog will appear to allow you to configure your custom desktop shell."
-msgstr "Pritisnite ovo i pojavit će se konfiguracijski dijalog koji će vam dopustiti da podesite vašu prilagođenu ljusku radne površine."
+msgid ""
+"Press this and a configuration dialog will appear to allow you to configure "
+"your custom desktop shell."
+msgstr ""
+"Pritisnite ovo i pojavit će se konfiguracijski dijalog koji će vam dopustiti "
+"da podesite vašu prilagođenu ljusku radne površine."
 
 #. i18n: ectx: property (text), widget (QPushButton, btnShellSetup)
@@ -185 +202 @@
 #. +> trunk stable
 #: platform.ui:161
-#, fuzzy
 #| msgctxt "tooltip for checkbox"
 #| msgid "This will enable automatic regeneration of Windows' Start menu entries for KDE applications"
-msgid "This will enable automatic regeneration of Windows' Start menu entries for KDE applications"
-msgstr "Ovo će omogućiti automatsku regeneraciju stavki Windows Start izbornika sa KDE aplikacijama "
+msgid ""
+"This will enable automatic regeneration of Windows' Start menu entries for "
+"KDE applications"
+msgstr ""
+"Ovo će omogućiti automatsko obnavljanje stavki u  Start izborniku Windowsa za "
+"aplikacije KDE-a"
 
 #. i18n: whatsThis tooltip
@@ -198 +218 @@
 #| msgctxt "whatsThis tooltip"
 #| msgid "This option defines if Windows' Start menu entries should be regenerated or not. By default start menu entries are regenerated automatically, but you may wish to disable it if you have issues with that."
-msgid "This option defines if Windows' Start menu entries should be regenerated or not. By default start menu entries are regenerated automatically, but you may wish to disable it if you have issues with that."
-msgstr "Ova opcija određuje da li će stavke Windowsovog Start izbornika biti regenerirane ili ne. Zadano je da se stavke izbornika regeneriraju automatski, ali moÅŸda to ÅŸelite isključiti ukoliko s time imate problema.  "
+msgid ""
+"This option defines if Windows' Start menu entries should be regenerated or "
+"not. By default start menu entries are regenerated automatically, but you may "
+"wish to disable it if you have issues with that."
+msgstr ""
+"Ova opcija određuje da li će stavke Windowsovog Start izbornika biti "
+"regenerirane ili ne. Zadano je da se stavke izbornika regeneriraju "
+"automatski, ali moşda to şelite isključiti ukoliko s time imate problema.  "
 
 #. i18n: checkbox caption in System Integration options
@@ -212 +238 @@
 #. +> trunk stable
 #: platform.ui:177
-#, fuzzy
 #| msgctxt "tooltip for checkbox"
 #| msgid "Use native Windows file dialogs instead of KDE ones"
@@ -225 +250 @@
 #| msgctxt "whatsThis tooltip"
 #| msgid "Choose this option to make KDE applications use the standard Windows Open/Save file dialogs, instead of those normally used in KDE."
-msgid "Choose this option to make KDE applications use the standard Windows Open/Save file dialogs, instead of those normally used in KDE."
-msgstr "Izaberite ovu opciju kako bi KDE aplikacije koristile uobičajene Windows Otvori/Spemi datotečne dijaloge umjesto onih normalnih korištenih u KDE-u."
+msgid ""
+"Choose this option to make KDE applications use the standard Windows "
+"Open/Save file dialogs, instead of those normally used in KDE."
+msgstr ""
+"Izaberite ovu opciju kako bi KDE aplikacije koristile uobičajene Windows "
+"Otvori/Spemi datotečne dijaloge umjesto onih normalnih korištenih u KDE-u."
 
 #. i18n: checkbox caption in System Integration options
@@ -239 +268 @@
 #. +> trunk stable
 #: platform.ui:199
-#, fuzzy
 #| msgctxt "tooltip for checkbox"
 #| msgid "Install System Settings into the Windows Control Panel."
 msgid "Install System Settings into the Windows Control Panel."
-msgstr "Instaliraj \"Postavke sustava\" u kontrolni panel Windowsa."
+msgstr "Instaliraj Postavke sustava u kontrolni panel Windowsa."
 
 #. i18n: whatsThis tooltip
@@ -252 +280 @@
 #| msgctxt "whatsThis tooltip"
 #| msgid "This will install the KDE 'System Settings' as an element in the Windows Control Panel.<br><b>Caution: This option tweaks your Windows registry.</b>"
-msgid "This will install the KDE 'System Settings' as an element in the Windows Control Panel.<br><b>Caution: This option tweaks your Windows registry.</b>"
-msgstr "Ovo će instalirati KDE-ove 'Postavke sustava' kao element kontrolnog panela Windowsa.<br><b>Oprez: Ova opcija zadire u vaš Windows registar.</b>"
+msgid ""
+"This will install the KDE 'System Settings' as an element in the Windows "
+"Control Panel.<br><b>Caution: This option tweaks your Windows registry.</b>"
+msgstr ""
+"Ovo će instalirati KDE-ove 'Postavke sustava' kao element kontrolnog panela "
+"Windowsa.<br><b>Oprez: Ova opcija zadire u vaš Windows registar.</b>"
 
 #. i18n: checkbox caption in System Integration options
@@ -266 +298 @@
 #. +> trunk stable
 #: platform.ui:212
-#, fuzzy
 #| msgctxt "tooltip for checkbox"
 #| msgid "Install Oxygen cursors as Windows cursor schemes"
 msgid "Install Oxygen cursors as Windows cursor schemes"
-msgstr "Instaliraj Oxygen pokazivače kao Windows sheme pokazvača."
+msgstr "Instaliraj Oxygen pokazivače kao sheme pokazvača u Windowsu."
 
 #. i18n: whatsThis tooltip
@@ -279 +310 @@
 #| msgctxt "whatsThis tooltip"
 #| msgid "This will install the Oxygen cursors into your system and combine them as a cursor theme.<br><b>Caution: This option tweaks your Windows registry.</b>"
-msgid "This will install the Oxygen cursors into your system and combine them as a cursor theme.<br><b>Caution: This option tweaks your Windows registry.</b>"
-msgstr "Ovo će instalirati Oxygen pokazivače u vaš sustav i objediniti ih kao temu pokazivača.<br><b>Oprez: Ova opcija zadire u vaš Windows registar.</b>"
+msgid ""
+"This will install the Oxygen cursors into your system and combine them as a "
+"cursor theme.<br><b>Caution: This option tweaks your Windows registry.</b>"
+msgstr ""
+"Ovo će instalirati Oxygen pokazivače u vaš sustav i objediniti ih kao temu "
+"pokazivača.<br><b>Oprez: Ova opcija zadire u vaš Windows registar.</b>"
 
 #. i18n: checkbox caption in System Integration options
@@ -293 +328 @@
 #. +> trunk stable
 #: platform.ui:225
-#, fuzzy
 #| msgctxt "tooltip for checkbox"
 #| msgid "This option installs KDE wallpapers into your \"My Pictures\" directory"
 msgid "This option installs KDE wallpapers into your \"My Pictures\" directory"
-msgstr "Ova opcija instalira KDE pozadinske slike u vaš \"My Pictures\" direktorij"
+msgstr ""
+"Ova će opcija instalirati pozadinske slike KDE-a u vaš direktorij \"My "
+"Pictures\""
 
 #. i18n: whatsThis tooltip
@@ -306 +342 @@
 #| msgctxt "whatsThis tooltip"
 #| msgid "This will install KDE wallpapers into the <i>\"My Pictures\"</i> directory so they can be used as your Windows wallpaper. If the checkbox is set to half-checked then it means that there are new wallpapers available to update.<br> The wallpaper aspect ratio will be selected according to your current screen resolution."
-msgid "This will install KDE wallpapers into the <i>\"My Pictures\"</i> directory so they can be used as your Windows wallpaper. If the checkbox is set to half-checked then it means that there are new wallpapers available to update.<br> The wallpaper aspect ratio will be selected according to your current screen resolution."
-msgstr "Ovo će instalirati KDE-ove pozadinske slike u direktorij <i>\"Moje Slike\"</i> kako bi se mogle koristiti kao vaÅ¡e Windows pozadinske slike. Ako je odabirni okvir označen na pola, znači da postoji novih pozadinskih slika dostupnih kod aÅŸuriranja.<br> Omjer Å¡irine i visine pozadinske slike biti će odabran prema vaÅ¡oj trenutnoj rezoluciji zaslona."
+msgid ""
+"This will install KDE wallpapers into the <i>\"My Pictures\"</i> directory so "
+"they can be used as your Windows wallpaper. If the checkbox is set to "
+"half-checked then it means that there are new wallpapers available to update."
+"<br> The wallpaper aspect ratio will be selected according to your current "
+"screen resolution."
+msgstr ""
+"Ovo će instalirati KDE-ove pozadinske slike u direktorij <i>\"Moje Slike\"</i>"
+" kako bi se mogle koristiti kao vaše Windows pozadinske slike. Ako je "
+"odabirni okvir označen na pola, znači da postoji novih pozadinskih slika "
+"dostupnih kod aÅŸuriranja.<br> Omjer Å¡irine i visine pozadinske slike biti će "
+"odabran prema vašoj trenutnoj rezoluciji zaslona."
 
 #. i18n: checkbox caption in System Integration options
@@ -320 +366 @@
 #. +> trunk stable
 #: platform.ui:238
-#, fuzzy
 #| msgctxt "tooltip for checkbox"
 #| msgid "This will make essential KDE processes run at user login"
 msgid "This will make essential KDE processes run at user login"
-msgstr "Ovo će pokrenuti bitne KDE procese prilikom prijave u sustav"
+msgstr "Ovo će pokrenuti bitne procese KDE-a prilikom prijave u sustav"
 
 #. i18n: whatsThis tooltip
@@ -333 +378 @@
 #| msgctxt "whatsThis tooltip"
 #| msgid "Enabling this option will start essential KDE processes at user login. Normally these processes are started when you first start a KDE application, thereby delaying the actual application launch.<br>It is recommended to enable this option to make your applications launch faster for the first time.<br><b>Caution: This option tweaks your Windows registry.</b>"
-msgid "Enabling this option will start essential KDE processes at user login. Normally these processes are started when you first start a KDE application, thereby delaying the actual application launch.<br>It is recommended to enable this option to make your applications launch faster for the first time.<br><b>Caution: This option tweaks your Windows registry.</b>"
-msgstr "Omogućavanjem ove opcije KDE procesi će se pokrenuti prilikom prijave u sutav. Obično se ovi procesi pokeću kada pokrenete prvu KDE aplikaciju unutar korisničke sesije, Å¡to odugovlači samo pokretanje aplikacije.<br>Preporuča se da uključite ovu opciju kako bi učinili pokretanje vaÅ¡ih aplikacija prvi put brÅŸim.<br><b>Oprez: Ova opcija zadire u vaÅ¡ Windows registar.</b>"
+msgid ""
+"Enabling this option will start essential KDE processes at user login. "
+"Normally these processes are started when you first start a KDE application, "
+"thereby delaying the actual application launch.<br>It is recommended to "
+"enable this option to make your applications launch faster for the first time."
+"<br><b>Caution: This option tweaks your Windows registry.</b>"
+msgstr ""
+"Omogućavanjem ove opcije KDE procesi će se pokrenuti prilikom prijave u sutav."
+" Obično se ovi procesi pokeću kada pokrenete prvu KDE aplikaciju unutar "
+"korisničke sesije, što odugovlači samo pokretanje aplikacije.<br>Preporuča se "
+"da uključite ovu opciju kako bi učinili pokretanje vaših aplikacija prvi put "
+"brşim.<br><b>Oprez: Ova opcija zadire u vaš Windows registar.</b>"
 
 #. i18n: checkbox caption in System Integration options
@@ -355 +410 @@
 #. +> trunk stable
 #: shellEdit.cpp:24
-#, fuzzy
 #| msgid "This shell is reserved for the user's custom shell. Press the \"Setup\" button to setup your favorite shell."
-msgid "This shell is reserved for user's custom shell. Press \"Setup\" button to setup your favourite shell."
-msgstr "Ova ljuska je rezervirana za korisnički prilagođenu ljusku. Pritisnite gumb \"Postavke...\" da podesite vašu omiljenu ljusku."
+msgid ""
+"This shell is reserved for user's custom shell. Press \"Setup\" button to "
+"setup your favourite shell."
+msgstr ""
+"Ova je ljuska rezervirana za korisnički prilagođenu ljusku. Pritisnite gumb "
+"\"Postavke\" kako biste podesili vašu omiljenu ljusku."
 
 #. i18n: ectx: property (windowTitle), widget (QDialog, ShellEditDlg)

kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmcolors.po

@@ -11 +11 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-07-08 10:22+0200\n"
-"PO-Revision-Date: 2011-03-18 18:21+0100\n"
+"PO-Revision-Date: 2011-07-12 16:39+0200\n"
 "Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
@@ -18 +18 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Language: hr\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
 "X-Generator: Lokalize 1.2\n"
 "X-Environment: kde\n"
@@ -32 +33 @@
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr "renato@translator-shop.org, DoDoEntertainment@gmail.com, adundovi@gmail.com"
+msgstr ""
+"renato@translator-shop.org, DoDoEntertainment@gmail.com, adundovi@gmail.com"
 
 #. i18n: ectx: attribute (title), widget (QWidget, pageColors)
@@ -97 +99 @@
 "The scheme you have selected appears to be a KDE3 scheme.\n"
 "\n"
-"KDE will attempt to import this scheme, however many color roles have been added since KDE3. Some manual work will likely be required.\n"
+"KDE will attempt to import this scheme, however many color roles have been "
+"added since KDE3. Some manual work will likely be required.\n"
 "\n"
 "This scheme will not be saved automatically."
@@ -103 +106 @@
 "Shema koju ste uvezli čini se kao KDE3 shema.\n"
 "\n"
-"KDE će pokušati uvesti ovu shemu, međutim od KDE3 dodane su nove uloge boja. Vjerojatno će biti potrebno dodatno ručno podešavanje.\n"
+"KDE će pokušati uvesti ovu shemu, međutim od KDE3 dodane su nove uloge boja. "
+"Vjerojatno će biti potrebno dodatno ručno podešavanje.\n"
 "\n"
 "Ova shema neće biti spremljena automatski."
@@ -523 +527 @@
 #. +> trunk stable
 #: colorsettings.ui:605
-#, fuzzy
 #| msgid "Active Titlebar Text"
 msgid "Active Titlebar Secondary"
-msgstr "Tekst aktivne naslovne trake"
+msgstr "Druga aktivna naslovna traka"
 
 #. i18n: ectx: property (text), item, widget (QTableWidget, commonColorTable)
@@ -543 +546 @@
 #. +> trunk stable
 #: colorsettings.ui:620
-#, fuzzy
 #| msgid "Inactive Titlebar Text"
 msgid "Inactive Titlebar Secondary"
-msgstr "Tekst neaktivne naslovne trake"
+msgstr "Druga neaktivna naslovna traka"
 
 #. i18n: ectx: attribute (title), widget (QWidget, pageInactice)
@@ -1113 +1115 @@
 msgid ""
 "Link Text on Link Background\n"
-"(Note: Link Background is derived from Link Text and cannot be separately configured at this time)"
+"(Note: Link Background is derived from Link Text and cannot be separately "
+"configured at this time)"
 msgstr ""
 "Tekst poveznice na pozadini poveznice\n"
-"(Napomena: Pozadina poveznice je izvedena iz teksta poveznice i ne moÅŸe biti odvojeno konfigurirana u ovom trenutku)"
+"(Napomena: Pozadina poveznice je izvedena iz teksta poveznice i ne moÅŸe biti "
+"odvojeno konfigurirana u ovom trenutku)"
 
 #. i18n: ectx: property (toolTip), widget (QLabel, labelBack4)
@@ -1123 +1127 @@
 msgid ""
 "Visited Text on Visited Background\n"
-"(Note: Visited Background is derived from Visited Text and cannot be separately configured at this time)"
+"(Note: Visited Background is derived from Visited Text and cannot be "
+"separately configured at this time)"
 msgstr ""
 "Tekst posjećene poveznice na pozadini posjećene poveznice\n"
-"(Napomena: Posjećena poveznica je izvedena iz posjećenog teksta poveznice i trenutno ne moÅŸe biti odvojeno konfigurirana)"
+"(Napomena: Posjećena poveznica je izvedena iz posjećenog teksta poveznice i "
+"trenutno ne moÅŸe biti odvojeno konfigurirana)"
 
 #. i18n: ectx: property (toolTip), widget (QLabel, labelBack2)
@@ -1133 +1139 @@
 msgid ""
 "Active Text on Active Background\n"
-"(Note: Active Background is derived from Active Text and cannot be separately configured at this time)"
+"(Note: Active Background is derived from Active Text and cannot be separately "
+"configured at this time)"
 msgstr ""
 "Aktivni tekst na aktivnoj pozadini\n"
-"(Napomena: Aktivna pozadina je izvedena iz aktivnog teksta i trenutno ne moÅŸe biti odvojeno konfigurirana)"
+"(Napomena: Aktivna pozadina je izvedena iz aktivnog teksta i trenutno ne moÅŸe "
+"biti odvojeno konfigurirana)"
 
 #. i18n: ectx: property (toolTip), widget (QLabel, labelBack1)
@@ -1157 +1165 @@
 msgid ""
 "Negative Text on Negative Background\n"
-"(Note: Negative Background is derived from Negative Text and cannot be separately configured at this time)"
+"(Note: Negative Background is derived from Negative Text and cannot be "
+"separately configured at this time)"
 msgstr ""
 "Negativno tekst na negativnoj pozadini\n"
-"(Napomena: Negativna pozadina je izvedena iz negativnog teksta i trenutno ne moÅŸe biti odvojeno konfigurirana)"
+"(Napomena: Negativna pozadina je izvedena iz negativnog teksta i trenutno ne "
+"moÅŸe biti odvojeno konfigurirana)"
 
 #. i18n: ectx: property (toolTip), widget (QLabel, labelBack6)
@@ -1167 +1177 @@
 msgid ""
 "Neutral Text on Neutral Background\n"
-"(Note: Neutral Background is derived from Neutral Text and cannot be separately configured at this time)"
+"(Note: Neutral Background is derived from Neutral Text and cannot be "
+"separately configured at this time)"
 msgstr ""
 "Neutralni tekst na neutralnoj pozadini\n"
-"(Napomena: Neutralna pozadina je izvedena iz neutralnog teksta i trenutno ne moÅŸe biti odvojeno konfigurirana)"
+"(Napomena: Neutralna pozadina je izvedena iz neutralnog teksta i trenutno ne "
+"moÅŸe biti odvojeno konfigurirana)"
 
 #. i18n: ectx: property (toolTip), widget (QLabel, labelBack7)
@@ -1177 +1189 @@
 msgid ""
 "Positive Text on Positive Background\n"
-"(Note: Positive Background is derived from Positive Text and cannot be separately configured at this time)"
+"(Note: Positive Background is derived from Positive Text and cannot be "
+"separately configured at this time)"
 msgstr ""
 "Pozitivan tekst na pozitivnoj pozadini\n"
-"(Napomena: Pozitivna pozadina je izvedena iz pozitivnog teksta i trenutno ne moÅŸe biti odvojeno konfigurirana)"
+"(Napomena: Pozitivna pozadina je izvedena iz pozitivnog teksta i trenutno ne "
+"moÅŸe biti odvojeno konfigurirana)"
 
 #. i18n: ectx: property (toolTip), widget (QLabel, labelFore9)

kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcminput.po

@@ -4 +4 @@
 # Andrej Dundovic <adundovi@gmail.com>, 2010.
 # Marko Dimjasevic <marko@dimjasevic.net>, 2011.
+# Marko Dimjašević <marko@dimjasevic.net>, 2011.
 msgid ""
 msgstr ""
@@ -9 +10 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-07-08 10:22+0200\n"
-"PO-Revision-Date: 2011-02-26 10:26+0100\n"
-"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
+"PO-Revision-Date: 2011-07-12 16:40+0200\n"
+"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
 "MIME-Version: 1.0\n"
@@ -16 +17 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Language: hr\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
 "X-Generator: Lokalize 1.2\n"
 "X-Poedit-Bookmarks: 42,-1,-1,-1,-1,-1,-1,-1,-1,-1\n"
@@ -134 +136 @@
 #. +> trunk stable
 #: kmousedlg.ui:72
-msgid "Change the direction of scrolling for the mouse wheel or the 4th and 5th mouse buttons."
-msgstr "Promjena smjera klizanja za kotačić miša ili za četvrtu ili petu tipku miša."
+msgid ""
+"Change the direction of scrolling for the mouse wheel or the 4th and 5th "
+"mouse buttons."
+msgstr ""
+"Promjena smjera klizanja za kotačić miša ili za četvrtu ili petu tipku miša."
 
 #. i18n: ectx: property (text), widget (QCheckBox, cbScrollPolarity)
@@ -195 +200 @@
 #. +> trunk stable
 #: logitechmouse.cpp:226
-msgid "RF channel 1 has been set. Please press Connect button on mouse to re-establish link"
-msgstr "RF kanal 1 je podešen. Pritisnite tipku za povezivanje na vašem mišu da biste ponovo uspostavili vezu."
+msgid ""
+"RF channel 1 has been set. Please press Connect button on mouse to "
+"re-establish link"
+msgstr ""
+"RF kanal 1 je podešen. Pritisnite tipku za povezivanje na vašem mišu da biste "
+"ponovo uspostavili vezu."
 
 #. +> trunk stable
@@ -205 +214 @@
 #. +> trunk stable
 #: logitechmouse.cpp:230
-msgid "RF channel 2 has been set. Please press Connect button on mouse to re-establish link"
-msgstr "RF kanal 2 je podešen. Pritisnite tipku za povezivanje na vašem mišu da biste ponovo uspostavili vezu."
+msgid ""
+"RF channel 2 has been set. Please press Connect button on mouse to "
+"re-establish link"
+msgstr ""
+"RF kanal 2 je podešen. Pritisnite tipku za povezivanje na vašem mišu da biste "
+"ponovo uspostavili vezu."
 
 #. +> trunk stable
@@ -340 +353 @@
 #. +> trunk stable
 #: logitechmouse_base.ui:107
-msgid "You have a Logitech Mouse connected, and libusb was found at compile time, but it was not possible to access this mouse. This is probably caused by a permissions problem - you should consult the manual on how to fix this."
-msgstr "Priključen je miš Logitech Mouse i tijekom sastavljanja upravljačkih programa pronađena je datoteka libusb, ali pristupanje mišu nije bilo moguće. Vjerojatan uzrok je problem s dopuštenjima. Proučite priručnik radi rješavanja ovog problema."
+msgid ""
+"You have a Logitech Mouse connected, and libusb was found at compile time, "
+"but it was not possible to access this mouse. This is probably caused by a "
+"permissions problem - you should consult the manual on how to fix this."
+msgstr ""
+"Priključen je miš Logitech Mouse i tijekom sastavljanja upravljačkih programa "
+"pronađena je datoteka libusb, ali pristupanje mišu nije bilo moguće. "
+"Vjerojatan uzrok je problem s dopuštenjima. Proučite priručnik radi "
+"rješavanja ovog problema."
 
 #. +> trunk stable
 #: mouse.cpp:91
-msgid "<h1>Mouse</h1> This module allows you to choose various options for the way in which your pointing device works. Your pointing device may be a mouse, trackball, or some other hardware that performs a similar function."
-msgstr "<h1>MiÅ¡</h1> Ovaj vam modul omogućuje podeÅ¡avanje raznih opcija načina na koje vaÅ¡ pokazivač funkcionira. Uređaj pokazivača moÅŸe biti miÅ¡, kugla za praćenje ili bilo koji drugi hardver slične namjene."
+msgid ""
+"<h1>Mouse</h1> This module allows you to choose various options for the way "
+"in which your pointing device works. Your pointing device may be a mouse, "
+"trackball, or some other hardware that performs a similar function."
+msgstr ""
+"<h1>Miš</h1> Ovaj vam modul omogućuje podešavanje raznih opcija načina na "
+"koje vaÅ¡ pokazivač funkcionira. Uređaj pokazivača moÅŸe biti miÅ¡, kugla za "
+"praćenje ili bilo koji drugi hardver slične namjene."
 
 #. +> trunk stable
@@ -355 +381 @@
 #. +> trunk stable
 #: mouse.cpp:120
-msgid "If you are left-handed, you may prefer to swap the functions of the left and right buttons on your pointing device by choosing the 'left-handed' option. If your pointing device has more than two buttons, only those that function as the left and right buttons are affected. For example, if you have a three-button mouse, the middle button is unaffected."
-msgstr "Ako ste ljevoruki mogli biste ÅŸeljeti zamijeniti funkcije lijeve i desne tipke miÅ¡a pomoću odabira opcije \"Ljevoruk\". Ako vaÅ¡ miÅ¡ ima viÅ¡e od dvije tipke, ova će opcija utjecati samo na tipke koje funkcioniraju kao lijeva i desna. Na primjer, ako imate miÅ¡a s tri tipke, funkcioniranje srednje tipke neće biti izmijenjeno."
+msgid ""
+"If you are left-handed, you may prefer to swap the functions of the left and "
+"right buttons on your pointing device by choosing the 'left-handed' option. "
+"If your pointing device has more than two buttons, only those that function "
+"as the left and right buttons are affected. For example, if you have a "
+"three-button mouse, the middle button is unaffected."
+msgstr ""
+"Ako ste ljevoruki mogli biste ÅŸeljeti zamijeniti funkcije lijeve i desne "
+"tipke miša pomoću odabira opcije \"Ljevoruk\". Ako vaš miš ima više od dvije "
+"tipke, ova će opcija utjecati samo na tipke koje funkcioniraju kao lijeva i "
+"desna. Na primjer, ako imate miša s tri tipke, funkcioniranje srednje tipke "
+"neće biti izmijenjeno."
 
 #. +> trunk stable
 #: mouse.cpp:130
-msgid "The default behavior in KDE is to select and activate icons with a single click of the left button on your pointing device. This behavior is consistent with what you would expect when you click links in most web browsers. If you would prefer to select with a single click, and activate with a double click, check this option."
-msgstr "Zadano ponašanje unutar KDE-a je odabir i aktiviranje ikona jednim klikom lijeve tipke vašeg miša, što je slično onome u pretraşivačima za internet. Ako şelite odabiranje s jednim, a aktiviranje s dva klika, označite ovu opciju."
+msgid ""
+"The default behavior in KDE is to select and activate icons with a single "
+"click of the left button on your pointing device. This behavior is consistent "
+"with what you would expect when you click links in most web browsers. If you "
+"would prefer to select with a single click, and activate with a double click, "
+"check this option."
+msgstr ""
+"Zadano ponašanje unutar KDE-a je odabir i aktiviranje ikona jednim klikom "
+"lijeve tipke vašeg miša, što je slično onome u pretraşivačima za internet. "
+"Ako şelite odabiranje s jednim, a aktiviranje s dva klika, označite ovu "
+"opciju."
 
 #. +> trunk stable
@@ -370 +415 @@
 #. +> trunk stable
 #: mouse.cpp:144
-msgid "If you check this option, pausing the mouse pointer over an icon on the screen will automatically select that icon. This may be useful when single clicks activate icons, and you want only to select the icon without activating it."
-msgstr "Odabiranjem ove opcije, dulje zadrÅŸavanje pokazivača iznad ikone automatski će odabrati ikonu. To je korisno ako upotrebljavate jedan klik za aktiviranje ikona, ali je ne ÅŸelite pokrenuti, nego samo odabrati."
+msgid ""
+"If you check this option, pausing the mouse pointer over an icon on the "
+"screen will automatically select that icon. This may be useful when single "
+"clicks activate icons, and you want only to select the icon without "
+"activating it."
+msgstr ""
+"Odabiranjem ove opcije, dulje zadrşavanje pokazivača iznad ikone automatski "
+"će odabrati ikonu. To je korisno ako upotrebljavate jedan klik za aktiviranje "
+"ikona, ali je ne ÅŸelite pokrenuti, nego samo odabrati."
 
 #. +> trunk stable
 #: mouse.cpp:150
-msgid "If you have checked the option to automatically select icons, this slider allows you to select how long the mouse pointer must be paused over the icon before it is selected."
-msgstr "Odabiranjem opcije automatskog odabira ikona, ovaj klizač omogućuje podešavanje razdoblja tijekom kojeg pokazivač miša mora biti iznad ikone da bi ona bila odabrana."
+msgid ""
+"If you have checked the option to automatically select icons, this slider "
+"allows you to select how long the mouse pointer must be paused over the icon "
+"before it is selected."
+msgstr ""
+"Odabiranjem opcije automatskog odabira ikona, ovaj klizač omogućuje "
+"podešavanje razdoblja tijekom kojeg pokazivač miša mora biti iznad ikone da "
+"bi ona bila odabrana."
 
 #. +> trunk stable
@@ -395 +453 @@
 #. +> trunk stable
 #: mouse.cpp:195
-msgid "<p>This option allows you to change the relationship between the distance that the mouse pointer moves on the screen and the relative movement of the physical device itself (which may be a mouse, trackball, or some other pointing device.)</p><p> A high value for the acceleration will lead to large movements of the mouse pointer on the screen even when you only make a small movement with the physical device. Selecting very high values may result in the mouse pointer flying across the screen, making it hard to control.</p>"
-msgstr "<p>Ova opcija omogućuje vam izmjenu omjera između udaljenosti koju pokazivač miÅ¡a prijeđe na zaslonu i relativne kretnje samog miÅ¡a ili bilo kojeg uređaja za pokazivanje.</p><p>Velika vrijednost ubrzavanja prouzrokovat će velike pomake pokazivača na zaslonu čak i u slučaju malenih kretnji samog uređaja. Odabir jako velikih vrijednosti moÅŸe izazvati prebrzo kretanje pokazivača kojim je teÅ¡ko upravljati.</p>"
+msgid ""
+"<p>This option allows you to change the relationship between the distance "
+"that the mouse pointer moves on the screen and the relative movement of the "
+"physical device itself (which may be a mouse, trackball, or some other "
+"pointing device.)</p><p> A high value for the acceleration will lead to large "
+"movements of the mouse pointer on the screen even when you only make a small "
+"movement with the physical device. Selecting very high values may result in "
+"the mouse pointer flying across the screen, making it hard to control.</p>"
+msgstr ""
+"<p>Ova opcija omogućuje vam izmjenu omjera između udaljenosti koju pokazivač "
+"miša prijeđe na zaslonu i relativne kretnje samog miša ili bilo kojeg uređaja "
+"za pokazivanje.</p><p>Velika vrijednost ubrzavanja prouzrokovat će velike "
+"pomake pokazivača na zaslonu čak i u slučaju malenih kretnji samog uređaja. "
+"Odabir jako velikih vrijednosti moşe izazvati prebrzo kretanje pokazivača "
+"kojim je teško upravljati.</p>"
 
 #. +> trunk stable
@@ -405 +476 @@
 #. +> trunk stable
 #: mouse.cpp:215
-msgid "<p>The threshold is the smallest distance that the mouse pointer must move on the screen before acceleration has any effect. If the movement is smaller than the threshold, the mouse pointer moves as if the acceleration was set to 1X;</p><p> thus, when you make small movements with the physical device, there is no acceleration at all, giving you a greater degree of control over the mouse pointer. With larger movements of the physical device, you can move the mouse pointer rapidly to different areas on the screen.</p>"
-msgstr "<p>Prag je najmanja udaljenost koju pokazivač miÅ¡a mora prijeći na zaslonu prije no Å¡to ubrzavanje dobije na učinku. Ako je pomak manji od praga, pokazivač miÅ¡a pomicat će se kao da je ubrzavanje postavljeno na 1x.</p><p>Na taj način, u slučaju manjih kretnji samim uređajem, ne postoji nikakvo ubrzavanje i postiÅŸete veću upravljivost nad pokazivačem. Uz velike kretnje samim uređajem pokazivač moÅŸete brzo premjestiti u različite dijelove zaslona.</p>"
+msgid ""
+"<p>The threshold is the smallest distance that the mouse pointer must move on "
+"the screen before acceleration has any effect. If the movement is smaller "
+"than the threshold, the mouse pointer moves as if the acceleration was set to "
+"1X;</p><p> thus, when you make small movements with the physical device, "
+"there is no acceleration at all, giving you a greater degree of control over "
+"the mouse pointer. With larger movements of the physical device, you can move "
+"the mouse pointer rapidly to different areas on the screen.</p>"
+msgstr ""
+"<p>Prag je najmanja udaljenost koju pokazivač miša mora prijeći na zaslonu "
+"prije no što ubrzavanje dobije na učinku. Ako je pomak manji od praga, "
+"pokazivač miša pomicat će se kao da je ubrzavanje postavljeno na 1x.</p><p>Na "
+"taj način, u slučaju manjih kretnji samim uređajem, ne postoji nikakvo "
+"ubrzavanje i postiÅŸete veću upravljivost nad pokazivačem. Uz velike kretnje "
+"samim uređajem pokazivač moÅŸete brzo premjestiti u različite dijelove zaslona."
+"</p>"
 
 #. +> trunk stable
@@ -420 +505 @@
 #. +> trunk stable
 #: mouse.cpp:235
-msgid "The double click interval is the maximal time (in milliseconds) between two mouse clicks which turns them into a double click. If the second click happens later than this time interval after the first click, they are recognized as two separate clicks."
-msgstr "Razdoblje za dvostruki klik je najdulje vrijeme koje moÅŸe proteći između dva klika, a da se oni protumače kao dvostruki klik. Ako drugi put kliknete nakon navedenog razdoblja, tad se klikovi prepoznaju kao dva zasebna klikanja."
+msgid ""
+"The double click interval is the maximal time (in milliseconds) between two "
+"mouse clicks which turns them into a double click. If the second click "
+"happens later than this time interval after the first click, they are "
+"recognized as two separate clicks."
+msgstr ""
+"Razdoblje za dvostruki klik je najdulje vrijeme koje moÅŸe proteći između dva "
+"klika, a da se oni protumače kao dvostruki klik. Ako drugi put kliknete nakon "
+"navedenog razdoblja, tad se klikovi prepoznaju kao dva zasebna klikanja."
 
 #. +> trunk stable
@@ -430 +522 @@
 #. +> trunk stable
 #: mouse.cpp:250
-msgid "If you click with the mouse (e.g. in a multi-line editor) and begin to move the mouse within the drag start time, a drag operation will be initiated."
-msgstr "Ako kliknete mišem i započnete ga prevlačiti unutar navedenog razdoblja, tad će započeti prevlačenje (npr. s premještanjem odabranog teksta u uređivaču teksta)."
+msgid ""
+"If you click with the mouse (e.g. in a multi-line editor) and begin to move "
+"the mouse within the drag start time, a drag operation will be initiated."
+msgstr ""
+"Ako kliknete mišem i započnete ga prevlačiti unutar navedenog razdoblja, tad "
+"će započeti prevlačenje (npr. s premještanjem odabranog teksta u uređivaču "
+"teksta)."
 
 #. +> trunk stable
@@ -440 +537 @@
 #. +> trunk stable
 #: mouse.cpp:263
-msgid "If you click with the mouse and begin to move the mouse at least the drag start distance, a drag operation will be initiated."
-msgstr "Ako kliknete i pomaknete miša najmanje za navedeni broj točkica, započet će se s prevlačenjem."
+msgid ""
+"If you click with the mouse and begin to move the mouse at least the drag "
+"start distance, a drag operation will be initiated."
+msgstr ""
+"Ako kliknete i pomaknete miša najmanje za navedeni broj točkica, započet će "
+"se s prevlačenjem."
 
 #. +> trunk stable
@@ -450 +551 @@
 #. +> trunk stable
 #: mouse.cpp:276
-msgid "If you use the wheel of a mouse, this value determines the number of lines to scroll for each wheel movement. Note that if this number exceeds the number of visible lines, it will be ignored and the wheel movement will be handled as a page up/down movement."
-msgstr "Ako upotrebljavate kotačić miša ova vrijednost određuje broj redaka koji će biti pomaknuti za svaki pomak kotačića. Napomena: Ako je ovaj broj veći od broja vidljivih redaka, zadani broj će biti zanemaren, a pomak kotačića izvodit će kretanje stranicu naprijed i natrag."
+msgid ""
+"If you use the wheel of a mouse, this value determines the number of lines to "
+"scroll for each wheel movement. Note that if this number exceeds the number "
+"of visible lines, it will be ignored and the wheel movement will be handled "
+"as a page up/down movement."
+msgstr ""
+"Ako upotrebljavate kotačić miša ova vrijednost određuje broj redaka koji će "
+"biti pomaknuti za svaki pomak kotačića. Napomena: Ako je ovaj broj veći od "
+"broja vidljivih redaka, zadani broj će biti zanemaren, a pomak kotačića "
+"izvodit će kretanje stranicu naprijed i natrag."
 
 #. +> trunk stable
@@ -583 +692 @@
 #: xcursor/themepage.cpp:312
 #, kde-format
-msgid "Unable to download the cursor theme archive; please check that the address %1 is correct."
-msgstr "Nije moguće pronaći arhivu teme pokazivača. Provjerite je li adresa %1 ispravna."
+msgid ""
+"Unable to download the cursor theme archive; please check that the address %1 "
+"is correct."
+msgstr ""
+"Nije moguće pronaći arhivu teme pokazivača. Provjerite je li adresa %1 "
+"ispravna."
 
 #. +> trunk stable
@@ -594 +707 @@
 #. +> trunk stable
 #: xcursor/themepage.cpp:336
-msgid "<qt>You cannot delete the theme you are currently using.<br />You have to switch to another theme first.</qt>"
-msgstr "<qt>Ne moÅŸete izbrisati temu koju trenutno koristite.<br /> Prvo morate promijeniti na neku drugu temu.</qt>"
+msgid ""
+"<qt>You cannot delete the theme you are currently using.<br />You have to "
+"switch to another theme first.</qt>"
+msgstr ""
+"<qt>Ne moÅŸete izbrisati temu koju trenutno koristite.<br /> Prvo morate "
+"promijeniti na neku drugu temu.</qt>"
 
 #. +> trunk stable
 #: xcursor/themepage.cpp:342
 #, kde-format
-msgid "<qt>Are you sure you want to remove the <i>%1</i> cursor theme?<br />This will delete all the files installed by this theme.</qt>"
-msgstr "<qt>Jeste li sigurni da ÅŸelite ukloniti temu pokazivača <i>%1</i>?<br />Na ovaj ćete način izbrisati sve datoteke koje je ova tema instalirala.</qt>"
+msgid ""
+"<qt>Are you sure you want to remove the <i>%1</i> cursor theme?<br />This "
+"will delete all the files installed by this theme.</qt>"
+msgstr ""
+"<qt>Jeste li sigurni da şelite ukloniti temu pokazivača <i>%1</i>?<br />Na "
+"ovaj ćete način izbrisati sve datoteke koje je ova tema instalirala.</qt>"
 
 #. +> trunk stable
@@ -611 +732 @@
 #: xcursor/themepage.cpp:405
 #, kde-format
-msgid "A theme named %1 already exists in your icon theme folder. Do you want replace it with this one?"
-msgstr "Tema naziva %1 već postoji u vaÅ¡oj mapi tema ikona. Åœelite li ju zamijeniti ovom temom?"
+msgid ""
+"A theme named %1 already exists in your icon theme folder. Do you want "
+"replace it with this one?"
+msgstr ""
+"Tema naziva %1 već postoji u vaÅ¡oj mapi tema ikona. Åœelite li ju zamijeniti "
+"ovom temom?"
 
 #. +> trunk stable
@@ -623 +748 @@
 #: xcursor/themepage.ui:17
 msgid "Select the cursor theme you want to use (hover preview to test cursor):"
-msgstr "Odaberite temu pokazivača koju şelite upotrebljavati (za pregled namjestite pokazivač):"
+msgstr ""
+"Odaberite temu pokazivača koju şelite upotrebljavati (za pregled namjestite "
+"pokazivač):"
 
 #. i18n: ectx: property (toolTip), widget (KPushButton, installKnsButton)
 #. +> trunk stable
 #: xcursor/themepage.ui:56
-#, fuzzy
 msgid "Get new color schemes from the Internet"
-msgstr "Skini nove sheme boja s Interneta"
+msgstr "Dohvati nove sheme boja s Interneta"
 
 #. i18n: ectx: property (text), widget (KPushButton, installKnsButton)
 #. +> trunk stable
 #: xcursor/themepage.ui:59
-#, fuzzy
 msgid "Get New Theme..."
-msgstr "Dohvati novu temu
"
+msgstr "Dohvati novu temu..."
 
 #. i18n: ectx: property (text), widget (KPushButton, installButton)
 #. +> trunk stable
 #: xcursor/themepage.ui:66
-#, fuzzy
 msgid "Install From File..."
-msgstr "Iz datoteke 
"
+msgstr "Instaliraj iz datoteke..."
 
 #. i18n: ectx: property (text), widget (KPushButton, removeButton)

kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmkio.po

@@ -5 +5 @@
 # Marko Dimjasevic <marko@dimjasevic.net>, 2010, 2011.
 # Andrej Dundovic <adundovi@gmail.com>, 2010.
+# Marko Dimjašević <marko@dimjasevic.net>, 2011.
 msgid ""
 msgstr ""
@@ -10 +11 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-07-08 10:22+0200\n"
-"PO-Revision-Date: 2011-03-04 18:46+0100\n"
-"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
+"PO-Revision-Date: 2011-07-12 16:53+0200\n"
+"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
 "MIME-Version: 1.0\n"
@@ -17 +18 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Language: hr\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
 "X-Generator: Lokalize 1.2\n"
 "X-Environment: kde\n"
@@ -25 +27 @@
 #. +> trunk stable
 #: bookmarks.cpp:108
-msgid "<h1>My Bookmarks</h1><p>This module lets you configure the bookmarks home page.</p><p>The bookmarks home page is accessible at <a href=\"bookmarks:/\">bookmarks:/</a>.</p>"
-msgstr "<h1>Moje oznake</h1> <p>Ovaj modul Vam omogućuje konfiguraciju naslovne strane oznaka</p> <p>Naslovna strana oznaka je dostubna na <a href=\"bookmarks:/\">bookmarks:/</a>.</p>"
+msgid ""
+"<h1>My Bookmarks</h1><p>This module lets you configure the bookmarks home "
+"page.</p><p>The bookmarks home page is accessible at <a href=\"bookmarks:/\">"
+"bookmarks:/</a>.</p>"
+msgstr ""
+"<h1>Moje oznake</h1> <p>Ovaj modul Vam omogućuje konfiguraciju naslovne "
+"strane oznaka</p> <p>Naslovna strana oznaka je dostubna na <a "
+"href=\"bookmarks:/\">bookmarks:/</a>.</p>"
 
 #. i18n: ectx: property (title), widget (QGroupBox, groupBox)
@@ -38 +46 @@
 #: bookmarks.ui:23
 msgid ""
-"If this option is unchecked, bookmarks at the root of the hierarchy (not in a folder) are not displayed.\n"
+"If this option is unchecked, bookmarks at the root of the hierarchy (not in a "
+"folder) are not displayed.\n"
 "If checked, they are gathered in a \"root\" folder."
 msgstr ""
-"Ako je ova opcija isključena, oznake na vrhu hijerarhije (koje nisu ni u jednom direktoriju) neće biti prikazane.\n"
+"Ako je ova opcija isključena, oznake na vrhu hijerarhije (koje nisu ni u "
+"jednom direktoriju) neće biti prikazane.\n"
 "Ako je uključena, one će biti prikazane u direktoriju \"korijen\" (\"root\")."
 
@@ -54 +64 @@
 #: bookmarks.ui:37
 msgid ""
-"Sub-folders are shown within their parent by default. If you activate this option, sub-folders are displayed on their own.\n"
-"It looks less nice but it may help if you have a very big folder you want to spread in two columns."
-msgstr ""
-"Poddirektoriji su uobičajeno prikazani unutar svojih roditelja. Ako aktivirate ovu opciju, podfolderi će biti prikazani samostalno.\n"
-"MoÅŸda će izgledati loÅ¡ije, ali moÅŸe Vam pomoći ako imate jako veliki direktorij koji ÅŸelite podijeliti u dva stupca."
+"Sub-folders are shown within their parent by default. If you activate this "
+"option, sub-folders are displayed on their own.\n"
+"It looks less nice but it may help if you have a very big folder you want to "
+"spread in two columns."
+msgstr ""
+"Poddirektoriji su uobičajeno prikazani unutar svojih roditelja. Ako "
+"aktivirate ovu opciju, podfolderi će biti prikazani samostalno.\n"
+"MoÅŸda će izgledati loÅ¡ije, ali moÅŸe Vam pomoći ako imate jako veliki "
+"direktorij koji ÅŸelite podijeliti u dva stupca."
 
 #. i18n: ectx: property (text), widget (QCheckBox, cbFlattenTree)
@@ -69 +83 @@
 #. +> trunk stable
 #: bookmarks.ui:47
-msgid "Show a box with KDE places (Home, Network, ...). Useful if you use konqueror as a file manager."
-msgstr "PrikaÅŸi kućicu sa KDE mjestima (Osobna mapa, MreÅŸa,
). Korisno ako koristite konqueror kao upravitelj datoteka."
+msgid ""
+"Show a box with KDE places (Home, Network, ...). Useful if you use konqueror "
+"as a file manager."
+msgstr ""
+"PrikaÅŸi kućicu sa KDE mjestima (Osobna mapa, MreÅŸa,
). Korisno ako koristite "
+"konqueror kao upravitelj datoteka."
 
 #. i18n: ectx: property (text), widget (QCheckBox, cbShowPlaces)
@@ -87 +105 @@
 #. +> trunk stable
 #: bookmarks.ui:71
-msgid "Folders are automatically distributed in several columns. The optimal number of columns depends on the width of the konqueror window and the number of bookmarks you have."
-msgstr "Direktoriji se automatski raspoređuju u više stupaca. Optimalni broj stupaca ovisi o širini prozora Konquerora i broju oznaka koje imate."
+msgid ""
+"Folders are automatically distributed in several columns. The optimal number "
+"of columns depends on the width of the konqueror window and the number of "
+"bookmarks you have."
+msgstr ""
+"Direktoriji se automatski raspoređuju u više stupaca. Optimalni broj stupaca "
+"ovisi o Å¡irini prozora Konquerora i broju oznaka koje imate."
 
 #. i18n: ectx: property (text), widget (QLabel, label)
@@ -100 +123 @@
 #: bookmarks.ui:109
 msgid "Disable it on slow system to disable background images."
-msgstr "Onemogućite ovo na sporim sustavima da biste onesposobili pozadinske slike."
+msgstr ""
+"Onemogućite ovo na sporim sustavima da biste onesposobili pozadinske slike."
 
 #. i18n: ectx: property (text), widget (QCheckBox, cbShowBackgrounds)
@@ -146 +170 @@
 #. +> trunk stable
 #: cache.cpp:111
-msgid "<h1>Cache</h1><p>This module lets you configure your cache settings.</p><p>The cache is an internal memory in Konqueror where recently read web pages are stored. If you want to retrieve a web page again that you have recently read, it will not be downloaded from the Internet, but rather retrieved from the cache, which is a lot faster.</p>"
-msgstr "<h1>Predmemorija</h1> <p>Ovaj modul Vam omogućuje konfiguraciju postavki predmemorije</p> <p>Predmemorija je interna memorija u Konqueroru gdje su spremljene nedavno otvorene web stranice. Ako ÅŸelite ponovo kasnije otvoriti web stranicu koju ste nedavno otvarali, ona viÅ¡e neće biti skidana s Interneta, nego će biti izvučena iz prememorije, Å¡to je puno brÅŸe.</p>"
+msgid ""
+"<h1>Cache</h1><p>This module lets you configure your cache settings.</p><p>"
+"The cache is an internal memory in Konqueror where recently read web pages "
+"are stored. If you want to retrieve a web page again that you have recently "
+"read, it will not be downloaded from the Internet, but rather retrieved from "
+"the cache, which is a lot faster.</p>"
+msgstr ""
+"<h1>Predmemorija</h1> <p>Ovaj modul Vam omogućuje konfiguraciju postavki "
+"predmemorije</p> <p>Predmemorija je interna memorija u Konqueroru gdje su "
+"spremljene nedavno otvorene web stranice. Ako ÅŸelite ponovo kasnije otvoriti "
+"web stranicu koju ste nedavno otvarali, ona više neće biti skidana s "
+"Interneta, nego će biti izvučena iz prememorije, Å¡to je puno brÅŸe.</p>"
 
 #. i18n: ectx: property (whatsThis), widget (QCheckBox, cbUseCache)
 #. +> trunk stable
 #: cache.ui:17
-msgid "Check this box if you want the web pages you visit to be stored on your hard disk for quicker access. The stored pages will only be updated as needed instead of on every visit to that site. This is especially useful if you have a slow connection to the Internet."
-msgstr "Označite ovu kućicu ako ÅŸelite da web stranice koje gledate budu pohranjene na vaÅ¡em tvrdom disku za brÅŸi pristup istima. Tako će pristup njima biti neÅ¡to brÅŸi jer će se s mreÅŸe učitavati samo one koje nemate na disku, Å¡to je vrlo zgodno ako imate sporiju vezu prema internetu."
+msgid ""
+"Check this box if you want the web pages you visit to be stored on your hard "
+"disk for quicker access. The stored pages will only be updated as needed "
+"instead of on every visit to that site. This is especially useful if you have "
+"a slow connection to the Internet."
+msgstr ""
+"Označite ovu kućicu ako ÅŸelite da web stranice koje gledate budu pohranjene "
+"na vaÅ¡em tvrdom disku za brÅŸi pristup istima. Tako će pristup njima biti "
+"neÅ¡to brÅŸi jer će se s mreÅŸe učitavati samo one koje nemate na disku, Å¡to je "
+"vrlo zgodno ako imate sporiju vezu prema internetu."
 
 #. i18n: ectx: property (text), widget (QCheckBox, cbUseCache)
@@ -171 +213 @@
 #. +> trunk stable
 #: cache.ui:52
-msgid "Verify whether the cached web page is valid before attempting to fetch the web page again."
-msgstr "Provjeri je li spremljena web stranica ispravna prije nego je pokušaš dohvatiti ponovno."
+msgid ""
+"Verify whether the cached web page is valid before attempting to fetch the "
+"web page again."
+msgstr ""
+"Provjeri je li spremljena web stranica ispravna prije nego je pokušaš "
+"dohvatiti ponovno."
 
 #. i18n: ectx: property (text), widget (QRadioButton, rbVerifyCache)
@@ -183 +229 @@
 #. +> trunk stable
 #: cache.ui:62
-msgid "Always use documents from the cache when available. You can still use the reload button to synchronize the cache with the remote host."
-msgstr "Ova opcija omogućuje da dokumenti uvijek budu učitani iz priručne memorije ukoliko omogućeno.Uvijek moÅŸete upotrijebiti gumb za ponovno učitavanje stranice sa udaljenog računala."
+msgid ""
+"Always use documents from the cache when available. You can still use the "
+"reload button to synchronize the cache with the remote host."
+msgstr ""
+"Ova opcija omogućuje da dokumenti uvijek budu učitani iz priručne memorije "
+"ukoliko omogućeno.Uvijek moÅŸete upotrijebiti gumb za ponovno učitavanje "
+"stranice sa udaljenog računala."
 
 #. i18n: ectx: property (text), widget (QRadioButton, rbCacheIfPossible)
@@ -195 +246 @@
 #. +> trunk stable
 #: cache.ui:72
-msgid "Do not fetch web pages that are not already stored in the cache. Offline mode prevents you from viewing pages that you have not previously visited."
-msgstr "Ne dohvaćaj web stranice koje već nisu pohranjene u međuspremniku. NeumreÅŸeni način rada sprečava sprečava vas u gledanjustranica koje niste prethodno posjetili."
+msgid ""
+"Do not fetch web pages that are not already stored in the cache. Offline mode "
+"prevents you from viewing pages that you have not previously visited."
+msgstr ""
+"Ne dohvaćaj web stranice koje već nisu pohranjene u međuspremniku. NeumreÅŸeni "
+"način rada sprečava sprečava vas u gledanjustranica koje niste prethodno "
+"posjetili."
 
 #. i18n: ectx: property (text), widget (QRadioButton, rbOfflineMode)
@@ -234 +290 @@
 msgid ""
 "<qt>\n"
-"Enter the name of the environment variable, e.g. <b>HTTP_PROXY</b>, used to store the address of the HTTP proxy server.<p>\n"
-"Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt automatic discovery of this variable.</p>\n"
-"</qt>"
-msgstr ""
-"<qt>\n"
-"Unesite ime varijable okoline, npr. <b>HTTP_PROXY</b>, koja će se koristiti za spremanje adrese HTTP posredničkog posluÅŸitelja. <p>\n"
-"Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da biste pokrenuli automatsko otkrivanje te varijable.\n"
+"Enter the name of the environment variable, e.g. <b>HTTP_PROXY</b>, used to "
+"store the address of the HTTP proxy server.<p>\n"
+"Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt "
+"automatic discovery of this variable.</p>\n"
+"</qt>"
+msgstr ""
+"<qt>\n"
+"Unesite ime varijable okoline, npr. <b>HTTP_PROXY</b>, koja će se koristiti "
+"za spremanje adrese HTTP posredničkog posluşitelja. <p>\n"
+"Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da "
+"biste pokrenuli automatsko otkrivanje te varijable.\n"
 "</qt>"
 
@@ -261 +321 @@
 msgid ""
 "<qt>\n"
-"Enter the name of the environment variable, e.g. <b>HTTPS_PROXY</b>, used to store the address of the HTTPS proxy server.<p>\n"
-"Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt an automatic discovery of this variable.</p>\n"
-"</qt>"
-msgstr ""
-"<qt>\n"
-"Unesite ime varijable okoline, npr. <b>HTTP_PROXY</b>, koja će se koristiti za spremanje adrese HTTP posredničkog posluÅŸitelja. <p>\n"
-"Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da biste pokrenuli automatsko otkrivanje te varijable.\n"
+"Enter the name of the environment variable, e.g. <b>HTTPS_PROXY</b>, used to "
+"store the address of the HTTPS proxy server.<p>\n"
+"Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt "
+"an automatic discovery of this variable.</p>\n"
+"</qt>"
+msgstr ""
+"<qt>\n"
+"Unesite ime varijable okoline, npr. <b>HTTP_PROXY</b>, koja će se koristiti "
+"za spremanje adrese HTTP posredničkog posluşitelja. <p>\n"
+"Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da "
+"biste pokrenuli automatsko otkrivanje te varijable.\n"
 "</qt>"
 
@@ -288 +352 @@
 msgid ""
 "<qt>\n"
-"Enter the name of the environment variable, e.g. <b>FTP_PROXY</b>, used to store the address of the FTP proxy server.<p>\n"
-"Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt an automatic discovery of this variable.</p>\n"
-"</qt>"
-msgstr ""
-"<qt>\n"
-"Unesite ime varijable okoline, npr. <b>FTP_PROXY</b>, koja će se koristiti za spremanje adrese FTP posredničkog posluÅŸitelja. <p>\n"
-"Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da biste pokrenuli automatsko otkrivanje te varijable.\n"
+"Enter the name of the environment variable, e.g. <b>FTP_PROXY</b>, used to "
+"store the address of the FTP proxy server.<p>\n"
+"Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt "
+"an automatic discovery of this variable.</p>\n"
+"</qt>"
+msgstr ""
+"<qt>\n"
+"Unesite ime varijable okoline, npr. <b>FTP_PROXY</b>, koja će se koristiti za "
+"spremanje adrese FTP posredničkog posluşitelja. <p>\n"
+"Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da "
+"biste pokrenuli automatsko otkrivanje te varijable.\n"
 "</qt>"
 
@@ -309 +377 @@
 msgid ""
 "<qt>\n"
-"Enter the environment variable, e.g. <b>NO_PROXY</b>, used to store the addresses of sites for which the proxy server should not be used.<p>\n"
-"Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt an automatic discovery of this variable.\n"
-"</qt>"
-msgstr ""
-"<qt>\n"
-"Unesite ime varijable okoline, npr. <b>NO_PROXY</b>, koja će se koristiti za spremanje adrese web stranica za koje neće biti koriÅ¡ten posrednički posluÅŸitelj. <p>\n"
-"Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da biste pokrenuli automatsko otkrivanje te varijable.\n"
+"Enter the environment variable, e.g. <b>NO_PROXY</b>, used to store the "
+"addresses of sites for which the proxy server should not be used.<p>\n"
+"Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt "
+"an automatic discovery of this variable.\n"
+"</qt>"
+msgstr ""
+"<qt>\n"
+"Unesite ime varijable okoline, npr. <b>NO_PROXY</b>, koja će se koristiti za "
+"spremanje adrese web stranica za koje neće biti korišten posrednički "
+"posluÅŸitelj. <p>\n"
+"Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da "
+"biste pokrenuli automatsko otkrivanje te varijable.\n"
 "</qt>"
 
@@ -333 +406 @@
 #. +> trunk stable
 #: envvarproxy.ui:181
-msgid "<qt>Verify whether or not the environment variable names you supplied are valid. If an environment variable is not found, the associated labels will be <b>highlighted</b> to indicate that they are invalid.</qt>"
-msgstr "<qt>Kliknite na ovaj gumb za brzu provjeru jesu li okolišne varijable koje ste napisali ispravne. Ako to nije slučaj, odnosno ako neka varijabla nije nađena onda će ona biti osvjetljena, kako bi znali gdje je greška.</qt>"
+msgid ""
+"<qt>Verify whether or not the environment variable names you supplied are "
+"valid. If an environment variable is not found, the associated labels will be "
+"<b>highlighted</b> to indicate that they are invalid.</qt>"
+msgstr ""
+"<qt>Kliknite na ovaj gumb za brzu provjeru jesu li okolišne varijable koje "
+"ste napisali ispravne. Ako to nije slučaj, odnosno ako neka varijabla nije "
+"nađena onda će ona biti osvjetljena, kako bi znali gdje je greška.</qt>"
 
 #. i18n: ectx: property (text), widget (QPushButton, pbVerify)
@@ -345 +424 @@
 #. +> trunk stable
 #: envvarproxy.ui:191
-msgid "<qt>Attempt automatic discovery of the environment variables used for setting system wide proxy information.<p> This feature works by searching for commonly used variable names such as HTTP_PROXY, FTP_PROXY and NO_PROXY.</qt>"
-msgstr "<qt>Pokušaj automatskog otkrivanja varijabli okoline koje se koriste za postavljanje sustavskih informacija o posrednicima. <p>Ova mogućnost radi za pretragu često korištenih varijabli poput HTTP_PROXY, FTP_PROXY i NO_PROXY.</qt>"
+msgid ""
+"<qt>Attempt automatic discovery of the environment variables used for setting "
+"system wide proxy information.<p> This feature works by searching for "
+"commonly used variable names such as HTTP_PROXY, FTP_PROXY and NO_PROXY.</qt>"
+msgstr ""
+"<qt>Pokušaj automatskog otkrivanja varijabli okoline koje se koriste za "
+"postavljanje sustavskih informacija o posrednicima. <p>Ova mogućnost radi za "
+"pretragu često korištenih varijabli poput HTTP_PROXY, FTP_PROXY i NO_PROXY.<"
+"/qt>"
 
 #. i18n: ectx: property (text), widget (QPushButton, pbDetect)
@@ -375 +461 @@
 #. +> trunk stable
 #: kcookiesmain.cpp:88
-msgid "<p><h1>Cookies</h1> Cookies contain information that Konqueror (or other KDE applications using the HTTP protocol) stores on your computer, initiated by a remote Internet server. This means that a web server can store information about you and your browsing activities on your machine for later use. You might consider this an invasion of privacy.</p><p> However, cookies are useful in certain situations. For example, they are often used by Internet shops, so you can 'put things into a shopping basket'. Some sites require you have a browser that supports cookies.</p><p> Because most people want a compromise between privacy and the benefits cookies offer, KDE offers you the ability to customize the way it handles cookies. So you might want to set KDE's default policy to ask you whenever a server wants to set a cookie, allowing you to decide. For your favorite shopping web sites that you trust, you might want to set the policy to accept, then you can access the web sites without being prompted every time KDE receives a cookie.</p>"
-msgstr "<p> <h1>Kolačići</h1>  Kolačići sadrÅŸe informacije koje Konqueror (ili druga KDE aplikacija koja koristi HTTP protokol) spremi na VaÅ¡e računalo, a poslane su od udaljenog Internet posluÅŸitelja. To znači da web posluÅŸitelj moÅŸe spremiti informacije o Vama i vaÅ¡im aktivnostima na Internetu na VaÅ¡e računalo za kasniju upotrebu. Ovo moÅŸete smatrati naruÅ¡avanjem privatnosti.</p> <p>Međutim, kolačići su korisni u nekim situacijama. Na primjer, često se koriste u Internet dućanima, gdje moÅŸete 'staviti stvari u koÅ¡aricu'. Neke web stranice zahtijevaju pregledavanje preglednikom koji podrÅŸava kolačiće.</p> <p>Budući da većina ljudi ÅŸeli kompromis između privatnosti i prednosti koje kolačići nude, KDE Vam nudi mogućnost da odredite naćin upravljanja kolačićima. Tako moÅŸda ÅŸelite postaviti KDE-ovu uobičajenu politiku da Vas se pita svaki put kad posluÅŸitelj ÅŸeli postaviti kolačić, Å¡to Vam omogućuje odlučivanje. Za VaÅ¡e omiljene Internet dućane kojima vjerujete, moÅŸda ÅŸelite postaviti politiku da se prihvaćaju svi kolačići, pa ćete tada moći pristupati tim web stranicama bez da Vas se svaki put pita kada KDE primi kolačić-</p>"
+msgid ""
+"<p><h1>Cookies</h1> Cookies contain information that Konqueror (or other KDE "
+"applications using the HTTP protocol) stores on your computer, initiated by a "
+"remote Internet server. This means that a web server can store information "
+"about you and your browsing activities on your machine for later use. You "
+"might consider this an invasion of privacy.</p><p> However, cookies are "
+"useful in certain situations. For example, they are often used by Internet "
+"shops, so you can 'put things into a shopping basket'. Some sites require you "
+"have a browser that supports cookies.</p><p> Because most people want a "
+"compromise between privacy and the benefits cookies offer, KDE offers you the "
+"ability to customize the way it handles cookies. So you might want to set "
+"KDE's default policy to ask you whenever a server wants to set a cookie, "
+"allowing you to decide. For your favorite shopping web sites that you trust, "
+"you might want to set the policy to accept, then you can access the web sites "
+"without being prompted every time KDE receives a cookie.</p>"
+msgstr ""
+"<p> <h1>Kolačići</h1>  Kolačići sadrÅŸe informacije koje Konqueror (ili druga "
+"KDE aplikacija koja koristi HTTP protokol) spremi na Vaše računalo, a poslane "
+"su od udaljenog Internet posluşitelja. To znači da web posluşitelj moşe "
+"spremiti informacije o Vama i vašim aktivnostima na Internetu na Vaše "
+"računalo za kasniju upotrebu. Ovo moşete smatrati narušavanjem privatnosti.<"
+"/p> <p>Međutim, kolačići su korisni u nekim situacijama. Na primjer, često se "
+"koriste u Internet dućanima, gdje moÅŸete 'staviti stvari u koÅ¡aricu'. Neke "
+"web stranice zahtijevaju pregledavanje preglednikom koji podrÅŸava kolačiće.<"
+"/p> <p>Budući da većina ljudi ÅŸeli kompromis između privatnosti i prednosti "
+"koje kolačići nude, KDE Vam nudi mogućnost da odredite naćin upravljanja "
+"kolačićima. Tako moÅŸda ÅŸelite postaviti KDE-ovu uobičajenu politiku da Vas se "
+"pita svaki put kad posluÅŸitelj ÅŸeli postaviti kolačić, Å¡to Vam omogućuje "
+"odlučivanje. Za VaÅ¡e omiljene Internet dućane kojima vjerujete, moÅŸda ÅŸelite "
+"postaviti politiku da se prihvaćaju svi kolačići, pa ćete tada moći "
+"pristupati tim web stranicama bez da Vas se svaki put pita kada KDE primi "
+"kolačić-</p>"
 
 #. +> trunk stable
@@ -405 +521 @@
 #. +> trunk stable
 #: kcookiesmanagement.cpp:242
-msgid "Unable to retrieve information about the cookies stored on your computer."
-msgstr "Dohvaćanje informacija o cookie-ima spremljenim na vašem računalu nije uspjelo."
+msgid ""
+"Unable to retrieve information about the cookies stored on your computer."
+msgstr ""
+"Dohvaćanje informacija o cookie-ima spremljenim na vašem računalu nije "
+"uspjelo."
 
 #. +> trunk stable
@@ -515 +634 @@
 #. +> trunk stable
 #: kcookiespolicies.cpp:178
-#, fuzzy
 #| msgid "New Cookie Policy"
 msgctxt "@title:window"
@@ -523 +641 @@
 #. +> trunk stable
 #: kcookiespolicies.cpp:217
-#, fuzzy
 #| msgid "Change Cookie Policy"
 msgctxt "@title:window"
 msgid "Change Cookie Policy"
-msgstr "Promjeni pravila za kolačiće"
+msgstr "Promijeni pravila za kolačiće"
 
 #. +> trunk stable
 #: kcookiespolicies.cpp:242
 #, kde-format
-msgid "<qt>A policy already exists for<center><b>%1</b></center>Do you want to replace it?</qt>"
-msgstr "<qt>Politika već postoji za <center><b>%1</b></center> Åœelite li ju zamijeniti?</qt>"
+msgid ""
+"<qt>A policy already exists for<center><b>%1</b></center>Do you want to "
+"replace it?</qt>"
+msgstr ""
+"<qt>Politika već postoji za <center><b>%1</b></center> Åœelite li ju "
+"zamijeniti?</qt>"
 
 #. +> trunk stable
 #: kcookiespolicies.cpp:246
-#, fuzzy
 #| msgid "Duplicate Policy"
 msgctxt "@title:window"
 msgid "Duplicate Policy"
-msgstr "Podvostruči pravilo"
+msgstr "Duplikat pravila"
 
 #. +> trunk stable
@@ -559 +679 @@
 #. +> trunk stable
 #: kcookiespolicies.cpp:464
-msgid "<p><h1>Cookies</h1> Cookies contain information that Konqueror (or any other KDE application using the HTTP protocol) stores on your computer from a remote Internet server. This means that a web server can store information about you and your browsing activities on your machine for later use. You might consider this an invasion of privacy.</p><p>However, cookies are useful in certain situations. For example, they are often used by Internet shops, so you can 'put things into a shopping basket'. Some sites require you have a browser that supports cookies.</p><p>Because most people want a compromise between privacy and the benefits cookies offer, KDE offers you the ability to customize the way it handles cookies. You might, for example want to set KDE's default policy to ask you whenever a server wants to set a cookie or simply reject or accept everything. For example, you might choose to accept all cookies from your favorite shopping web site. For this all you have to do is either browse to that particular site and when you are presented with the cookie dialog box, click on <i> This domain </i> under the 'apply to' tab and choose accept or simply specify the name of the site in the <i> Domain Specific Policy </i> tab and set it to accept. This enables you to receive cookies from trusted web sites without being asked every time KDE receives a cookie.</p>"
-msgstr "<p> <h1>Kolačići</h1>  Kolačići sadrÅŸe informacije koje Konqueror (ili druga KDE aplikacija koja koristi HTTP protokol) spremi na VaÅ¡e računalo, a poslane su od udaljenog Internet posluÅŸitelja. To znači da web posluÅŸitelj moÅŸe spremiti informacije o Vama i vaÅ¡im aktivnostima na Internetu na VaÅ¡e računalo za kasniju upotrebu. Ovo moÅŸete smatrati naruÅ¡avanjem privatnosti.</p> <p>Međutim, kolačići su korisni u nekim situacijama. Na primjer, često se koriste u Internet dućanima, gdje moÅŸete 'staviti stvari u koÅ¡aricu'. Neke web stranice zahtijevaju pregledavanje preglednikom koji podrÅŸava kolačiće.</p> <p>Budući da većina ljudi ÅŸeli kompromis između privatnosti i prednosti koje kolačići nude, KDE Vam nudi mogućnost da odredite naćin upravljanja kolačićima. MoÅŸete, na primjer postaviti KDE-ovu uobičajenu politiku da Vas se pita svaki put kad KDE primi kolačić ili da se jednostavno svi kolačići prihvate ili odbiju. Na primjer, moÅŸete odrediti da se uvijek prihvate svi kolačići sa vaÅ¡eg omiljenog Internet dućana. Da biste to postavili, sve Å¡to moate učiniti jest ili otići na ÅŸeljenu stranicu i kad Vas se pita za kolačić, kliknite na <i>Ovu domenu</i> u kartici 'primijeni na' i odaberite 'prihvati' ili jednostavno definirajte ime web stranice u kartici <i>Politika određene domene</i> i postavite da se prihvaća. To će omogućiti prihvaćanje kolačića iz povjerenih web stranica bez da Vas se pita svaki put kad KDE primi kolačić.</p>"
+msgid ""
+"<p><h1>Cookies</h1> Cookies contain information that Konqueror (or any other "
+"KDE application using the HTTP protocol) stores on your computer from a "
+"remote Internet server. This means that a web server can store information "
+"about you and your browsing activities on your machine for later use. You "
+"might consider this an invasion of privacy.</p><p>However, cookies are useful "
+"in certain situations. For example, they are often used by Internet shops, so "
+"you can 'put things into a shopping basket'. Some sites require you have a "
+"browser that supports cookies.</p><p>Because most people want a compromise "
+"between privacy and the benefits cookies offer, KDE offers you the ability to "
+"customize the way it handles cookies. You might, for example want to set "
+"KDE's default policy to ask you whenever a server wants to set a cookie or "
+"simply reject or accept everything. For example, you might choose to accept "
+"all cookies from your favorite shopping web site. For this all you have to do "
+"is either browse to that particular site and when you are presented with the "
+"cookie dialog box, click on <i> This domain </i> under the 'apply to' tab and "
+"choose accept or simply specify the name of the site in the <i> Domain "
+"Specific Policy </i> tab and set it to accept. This enables you to receive "
+"cookies from trusted web sites without being asked every time KDE receives a "
+"cookie.</p>"
+msgstr ""
+"<p> <h1>Kolačići</h1>  Kolačići sadrÅŸe informacije koje Konqueror (ili druga "
+"KDE aplikacija koja koristi HTTP protokol) spremi na Vaše računalo, a poslane "
+"su od udaljenog Internet posluşitelja. To znači da web posluşitelj moşe "
+"spremiti informacije o Vama i vašim aktivnostima na Internetu na Vaše "
+"računalo za kasniju upotrebu. Ovo moşete smatrati narušavanjem privatnosti.<"
+"/p> <p>Međutim, kolačići su korisni u nekim situacijama. Na primjer, često se "
+"koriste u Internet dućanima, gdje moÅŸete 'staviti stvari u koÅ¡aricu'. Neke "
+"web stranice zahtijevaju pregledavanje preglednikom koji podrÅŸava kolačiće.<"
+"/p> <p>Budući da većina ljudi ÅŸeli kompromis između privatnosti i prednosti "
+"koje kolačići nude, KDE Vam nudi mogućnost da odredite naćin upravljanja "
+"kolačićima. MoÅŸete, na primjer postaviti KDE-ovu uobičajenu politiku da Vas "
+"se pita svaki put kad KDE primi kolačić ili da se jednostavno svi kolačići "
+"prihvate ili odbiju. Na primjer, moÅŸete odrediti da se uvijek prihvate svi "
+"kolačići sa vašeg omiljenog Internet dućana. Da biste to postavili, sve što "
+"moate učiniti jest ili otići na ÅŸeljenu stranicu i kad Vas se pita za "
+"kolačić, kliknite na <i>Ovu domenu</i> u kartici 'primijeni na' i odaberite "
+"'prihvati' ili jednostavno definirajte ime web stranice u kartici <i>Politika "
+"određene domene</i> i postavite da se prihvaća. To će omogućiti prihvaćanje "
+"kolačića iz povjerenih web stranica bez da Vas se pita svaki put kad KDE "
+"primi kolačić.</p>"
 
 #. i18n: ectx: property (whatsThis), widget (QCheckBox, cbEnableCookies)
@@ -567 +726 @@
 msgid ""
 "<qt>\n"
-"<p>Enable cookie support. Normally you will want to have cookie support enabled and customize it to suit your privacy needs.</p><p>\n"
-"Please note that disabling cookie support might make many web sites unbrowsable.</p>\n"
-"</qt>"
-msgstr ""
-"<qt>\n"
-"<p>Uključi podrÅ¡ku za kolačiće. Obično se ÅŸeli imati podrÅ¡ku za kolačiće koja se moÅŸe namjestiti potrebama korisnika.</p><p>\n"
-"Imajte na umu da isključivanje podrške za kolačiće čini mnoge web stranice neupotrebljivim.</p>\n"
+"<p>Enable cookie support. Normally you will want to have cookie support "
+"enabled and customize it to suit your privacy needs.</p><p>\n"
+"Please note that disabling cookie support might make many web sites "
+"unbrowsable.</p>\n"
+"</qt>"
+msgstr ""
+"<qt>\n"
+"<p>Uključi podrÅ¡ku za kolačiće. Obično se ÅŸeli imati podrÅ¡ku za kolačiće koja "
+"se moÅŸe namjestiti potrebama korisnika.</p><p>\n"
+"Imajte na umu da isključivanje podrške za kolačiće čini mnoge web stranice "
+"neupotrebljivim.</p>\n"
 " </qt>"
 
@@ -587 +750 @@
 msgid ""
 "<qt>\n"
-"Reject the so called third-party cookies. These are cookies that originate from a site other than the one you are currently browsing. For example, if you visit <b>www.foobar.com</b> while this option is on, only cookies that originate from www.foobar.com will be processed per your settings. Cookies from any other site will be rejected. This reduces the chances of site operators compiling a profile about your daily browsing habits.\n"
-"</qt>"
-msgstr ""
-"<qt>\n"
-"Odbijanje tzv. \"third-party\" kolačića. Ovi kolačići stiÅŸu sa drugih stranica od onih koje trenutno pregledavate. Na primjer, ako posjetite <b>www.klik.hr</b>, a ova opcija je uključena, samo kolačići koji stiÅŸu sa tih stranica bit će obrađeni prema vaÅ¡im postavkama. Kolačići s bilo koje druge adrese bit će odbijeni. Ova opcija smanjuje mogućnost vlasnika stranica da izrade profil vaÅ¡ih dnevnih navika pregledavanja web stranica.\n"
+"Reject the so called third-party cookies. These are cookies that originate "
+"from a site other than the one you are currently browsing. For example, if "
+"you visit <b>www.foobar.com</b> while this option is on, only cookies that "
+"originate from www.foobar.com will be processed per your settings. Cookies "
+"from any other site will be rejected. This reduces the chances of site "
+"operators compiling a profile about your daily browsing habits.\n"
+"</qt>"
+msgstr ""
+"<qt>\n"
+"Odbijanje tzv. \"third-party\" kolačića. Ovi kolačići stiÅŸu sa drugih "
+"stranica od onih koje trenutno pregledavate. Na primjer, ako posjetite <b>www."
+"klik.hr</b>, a ova opcija je uključena, samo kolačići koji stiÅŸu sa tih "
+"stranica bit će obrađeni prema vašim postavkama. Kolačići s bilo koje druge "
+"adrese bit će odbijeni. Ova opcija smanjuje mogućnost vlasnika stranica da "
+"izrade profil vaših dnevnih navika pregledavanja web stranica.\n"
 "</qt>"
 
@@ -605 +778 @@
 msgid ""
 "<qt>\n"
-"<p>Automatically accept temporary cookies meant to expire at the end of the current session. Such cookies will not be stored in your computer's hard drive or storage device. Instead, they are deleted when you close all applications (e.g. your browser) that use them.</p><p>\n"
-"<u>NOTE:</u> Checking this option along with the next one will override your default as well as site specific cookie policies. However, doing so also increases your privacy since all cookies will be removed when the current session ends.</p>\n"
-"</qt>"
-msgstr ""
-"<qt>\n"
-"<p>Automatski prihvati privremene kolačiće koji su određeni da isteknu na kraju trenutne sjednice. Takvi kolačići neće biti spremljeni na disk Vašeg računala. Umjesto toga, oni će biti izbrisani kad pozatvorite sve aplikacije (npr. Vaš web preglednik) koje ih koriste.</p> <p>\n"
-"<u>NAPOMENA:</u>Uključivanje ove opcije zajedno sa sljedećom će nadvladati vašu uobičajenu kao i politiku specifičnih web stranica. Međutim, to će također i povećati razinu privatnosti jer će svi kolačići biti izbrisani kad trenutna sjednica završi.</p> \n"
+"<p>Automatically accept temporary cookies meant to expire at the end of the "
+"current session. Such cookies will not be stored in your computer's hard "
+"drive or storage device. Instead, they are deleted when you close all "
+"applications (e.g. your browser) that use them.</p><p>\n"
+"<u>NOTE:</u> Checking this option along with the next one will override your "
+"default as well as site specific cookie policies. However, doing so also "
+"increases your privacy since all cookies will be removed when the current "
+"session ends.</p>\n"
+"</qt>"
+msgstr ""
+"<qt>\n"
+"<p>Automatski prihvati privremene kolačiće koji su određeni da isteknu na "
+"kraju trenutne sjednice. Takvi kolačići neće biti spremljeni na disk Vašeg "
+"računala. Umjesto toga, oni će biti izbrisani kad pozatvorite sve aplikacije "
+"(npr. Vaš web preglednik) koje ih koriste.</p> <p>\n"
+"<u>NAPOMENA:</u>Uključivanje ove opcije zajedno sa sljedećom će nadvladati "
+"vašu uobičajenu kao i politiku specifičnih web stranica. Međutim, to će "
+"također i povećati razinu privatnosti jer će svi kolačići biti izbrisani kad "
+"trenutna sjednica završi.</p> \n"
 "</qt>"
 
@@ -625 +810 @@
 msgid ""
 "<qt>\n"
-"<p>Treat all cookies as session cookies. Session cookies are small pieces of data that are temporarily stored in your computer's memory until you quit or close all applications (e.g. your browser) that use them. Unlike regular cookies, session cookies are never stored on your hard drive or other storage medium.</p><p>\n"
-"<u>NOTE:</u> Checking this option along with the previous one will override your default as well as site specific cookie policies. However, doing so also increases your privacy since all cookies will be removed when the current session ends.</p>\n"
-"</qt>"
-msgstr ""
-"<qt>\n"
-"<p>Tretiraj sve kolačiće kao kolačiće sjednice. Kolačići sjednice su mali komadići podataka koji su privremeno spremljeni na vašem računalu dok god ne zatvorite sve aplikacije koje ih koriste (npr. web preglednik). Za razliku od običnih kolačića, kolačići sesije se nikad ne spremaju na vaš tvrdi disk ili bilo koji drugi medij.</p><p>\n"
-"<u>NAPOMENA:</u> Zajedno s prethodnom opcijom, ova opcija zanemaruje vašu uobičajenu politiku manipuliranja kolačićima, kao i sve politike specifične za određene stranice. Međutim, to također povećava nivo vaše privatnosti, obzirom da će svi kolačići biti izbrisani kada prekinete trenutnu sesiju.</p></qt>"
+"<p>Treat all cookies as session cookies. Session cookies are small pieces of "
+"data that are temporarily stored in your computer's memory until you quit or "
+"close all applications (e.g. your browser) that use them. Unlike regular "
+"cookies, session cookies are never stored on your hard drive or other storage "
+"medium.</p><p>\n"
+"<u>NOTE:</u> Checking this option along with the previous one will override "
+"your default as well as site specific cookie policies. However, doing so also "
+"increases your privacy since all cookies will be removed when the current "
+"session ends.</p>\n"
+"</qt>"
+msgstr ""
+"<qt>\n"
+"<p>Tretiraj sve kolačiće kao kolačiće sjednice. Kolačići sjednice su mali "
+"komadići podataka koji su privremeno spremljeni na vašem računalu dok god ne "
+"zatvorite sve aplikacije koje ih koriste (npr. web preglednik). Za razliku od "
+"običnih kolačića, kolačići sesije se nikad ne spremaju na vaš tvrdi disk ili "
+"bilo koji drugi medij.</p><p>\n"
+"<u>NAPOMENA:</u> Zajedno s prethodnom opcijom, ova opcija zanemaruje vašu "
+"uobičajenu politiku manipuliranja kolačićima, kao i sve politike specifične "
+"za određene stranice. Međutim, to također povećava nivo vaše privatnosti, "
+"obzirom da će svi kolačići biti izbrisani kada prekinete trenutnu sesiju.</p>"
+"</qt>"
 
 #. i18n: ectx: property (text), widget (QCheckBox, cbIgnoreCookieExpirationDate)
@@ -646 +846 @@
 "Determines how cookies received from a remote machine will be handled: \n"
 "<ul>\n"
-"<li><b>Ask</b> will cause KDE to ask for your confirmation whenever a server wants to set a cookie.</li>\n"
-"<li><b>Accept</b> will cause cookies to be accepted without prompting you.</li>\n"
-"<li><b>Reject</b> will cause the cookiejar to refuse all cookies it receives.</li>\n"
+"<li><b>Ask</b> will cause KDE to ask for your confirmation whenever a server "
+"wants to set a cookie.</li>\n"
+"<li><b>Accept</b> will cause cookies to be accepted without prompting you.<"
+"/li>\n"
+"<li><b>Reject</b> will cause the cookiejar to refuse all cookies it receives."
+"</li>\n"
 "</ul><p>\n"
-"<u>NOTE:</u> Domain specific policies, which can be set below, always take precedence over the default policy.</p>\n"
+"<u>NOTE:</u> Domain specific policies, which can be set below, always take "
+"precedence over the default policy.</p>\n"
 "</qt>"
 msgstr ""
@@ -656 +860 @@
 "Određuje kako će se postupati s kolačićima koji su primljeni:\n"
 "<ul>\n"
-"<li><b>Pitaj</b> opcija će učiniti da Vas KDE svaki put pita što učiniti s kolačićem kada ga se primi</li> \n"
-"<li><b>Prihvati</b> opcija će učiniti da se svi kolačići prihvate bez pitanja</li> \n"
-"<li><b>Odbih</b> opcija će učiniti da se svi kolačići odbiju bez pitanja</li> \n"
+"<li><b>Pitaj</b> opcija će učiniti da Vas KDE svaki put pita što učiniti s "
+"kolačićem kada ga se primi</li> \n"
+"<li><b>Prihvati</b> opcija će učiniti da se svi kolačići prihvate bez "
+"pitanja</li> \n"
+"<li><b>Odbih</b> opcija će učiniti da se svi kolačići odbiju bez pitanja</li> "
+"\n"
 "</ul> <p>\n"
-"<u>NAPOMENA:</u> Politike specifičnih domena, koje mogu biti postavljene dolje, uvijek imaju prednost pred uobičajenim postavkama.</p>\n"
+"<u>NAPOMENA:</u> Politike specifičnih domena, koje mogu biti postavljene "
+"dolje, uvijek imaju prednost pred uobičajenim postavkama.</p>\n"
 "</qt>"
 
@@ -692 +900 @@
 msgid ""
 "<qt>\n"
-"To add a new policy, simply click on the <b>Add...</b> button and supply the necessary information. To change an existing policy, use the <b>Change...</b> button and choose the new policy from the policy dialog box. Clicking on the <b>Delete</b> button will remove the currently selected policy causing the default policy setting to be used for that domain, whereas <b>Delete All</b> will remove all the site specific policies.\n"
-"</qt>"
-msgstr ""
-"<qt>\n"
-"Za dodavanje nove politike, jednostavno kliknite na gumb <b>Dodaj
</b> i dajte potrebne informacije. Da biste promijenili trenutnu politiku, jednostavno koristite gumb <b>Promijeni</b> i odaberite novu politiku iz dialoga sa politikama. Ako kliknete na gumb <b>IzbriÅ¡i</b>, onda ćete izbrisati trenutno postavljenu politiku pa će za tu domenu biti koriÅ¡tena uobičajena politika, dok će <b>IzbriÅ¡i sve</b> gumb izbrisati sve specifične politike.\n"
+"To add a new policy, simply click on the <b>Add...</b> button and supply the "
+"necessary information. To change an existing policy, use the <b>Change...</b> "
+"button and choose the new policy from the policy dialog box. Clicking on the "
+"<b>Delete</b> button will remove the currently selected policy causing the "
+"default policy setting to be used for that domain, whereas <b>Delete All</b> "
+"will remove all the site specific policies.\n"
+"</qt>"
+msgstr ""
+"<qt>\n"
+"Za dodavanje nove politike, jednostavno kliknite na gumb <b>Dodaj
</b> i "
+"dajte potrebne informacije. Da biste promijenili trenutnu politiku, "
+"jednostavno koristite gumb <b>Promijeni</b> i odaberite novu politiku iz "
+"dialoga sa politikama. Ako kliknete na gumb <b>Izbriši</b>, onda ćete "
+"izbrisati trenutno postavljenu politiku pa će za tu domenu biti korištena "
+"uobičajena politika, dok će <b>Izbriši sve</b> gumb izbrisati sve specifične "
+"politike.\n"
 "</qt>"
 
@@ -725 +944 @@
 msgid ""
 "<qt>\n"
-"List of sites for which you have set a specific cookie policy. Specific policies override the default policy setting for these sites.\n"
-"</qt>"
-msgstr ""
-"<qt>\n"
-"Popis stranica za koje ste postavili određenu politiku upravljanja kolačićima. Ove postavke vrijedit će umjesto podrazumijevanih za ove stranice.\n"
+"List of sites for which you have set a specific cookie policy. Specific "
+"policies override the default policy setting for these sites.\n"
+"</qt>"
+msgstr ""
+"<qt>\n"
+"Popis stranica za koje ste postavili određenu politiku upravljanja kolačićima."
+" Ove postavke vrijedit će umjesto podrazumijevanih za ove stranice.\n"
 "</qt>"
 
@@ -746 +967 @@
 #. +> trunk stable
 #: kenvvarproxydlg.cpp:49
-#, fuzzy
 #| msgid "Variable Proxy Configuration"
 msgctxt "@title:window"
 msgid "Variable Proxy Configuration"
-msgstr "Postavke promjenjivog posrednika (proxy)"
+msgstr "Postavke promjenjivog posrednika"
 
 #. +> trunk stable
@@ -759 +979 @@
 #. +> trunk stable
 #: kenvvarproxydlg.cpp:133 kenvvarproxydlg.cpp:295
-msgid "<qt>Make sure you entered the actual environment variable name rather than its value. For example, if the environment variable is <br /><b>HTTP_PROXY=http://localhost:3128</b><br /> you need to enter <b>HTTP_PROXY</b> here instead of the actual value http://localhost:3128.</qt>"
-msgstr "<qt>Osigurajte da ste unijeli ime varijable okoline, a ne njenu vrijednost. Na primjer, ako je varijabla okoline <br /> <b>HTTP_PROXY=http://localhost:3128</b><br />  morate unijeti <b>HTTP_PROXY</b>, a ne vrijednost http://localhost:3128.</qt>"
+msgid ""
+"<qt>Make sure you entered the actual environment variable name rather than "
+"its value. For example, if the environment variable is <br /><b>"
+"HTTP_PROXY=http://localhost:3128</b><br /> you need to enter <b>HTTP_PROXY</b>"
+" here instead of the actual value http://localhost:3128.</qt>"
+msgstr ""
+"<qt>Osigurajte da ste unijeli ime varijable okoline, a ne njenu vrijednost. "
+"Na primjer, ako je varijabla okoline <br /> <b>"
+"HTTP_PROXY=http://localhost:3128</b><br />  morate unijeti <b>HTTP_PROXY</b>, "
+"a ne vrijednost http://localhost:3128.</qt>"
 
 #. +> trunk stable
 #: kenvvarproxydlg.cpp:141 kenvvarproxydlg.cpp:303 kproxydlg.cpp:311
-#, fuzzy
 #| msgid "Invalid Proxy Setup"
 msgctxt "@title:window"
@@ -777 +1004 @@
 #. +> trunk stable
 #: kenvvarproxydlg.cpp:146
-#, fuzzy
 #| msgid "Proxy Setup"
 msgctxt "@title:window"
 msgid "Proxy Setup"
-msgstr "Podešavanje proxy-a"
+msgstr "Postavljanje posrednika"
 
 #. +> trunk stable
 #: kenvvarproxydlg.cpp:222
-msgid "Did not detect any environment variables commonly used to set system wide proxy information."
-msgstr "Nije bilo moguće pronaći nijednu od varijabli okoline koje se obično koriste za podešavanje proxy-a!"
+msgid ""
+"Did not detect any environment variables commonly used to set system wide "
+"proxy information."
+msgstr ""
+"Nije bilo moguće pronaći nijednu od varijabli okoline koje se obično koriste "
+"za podešavanje proxy-a!"
 
 #. +> trunk stable
 #: kenvvarproxydlg.cpp:226
-msgid "<qt>To learn about the variable names the automatic detection process searches for, press OK, click on the quick help button on the window title bar of the previous dialog and then click on the \"<b>Auto Detect</b>\" button.</qt>"
-msgstr "<qt>Ako ÅŸelite saznati viÅ¡e o varijablama okruÅŸja koje ispituje automatsko pronalaÅŸenje, kliknite OK, u traci naslova prethodnog prozora kliknite gumb za brzu pomoć, te zatim kliknite gumb \"<b>Automatsko pronalaÅŸenje</b>\".</qt>"
+msgid ""
+"<qt>To learn about the variable names the automatic detection process "
+"searches for, press OK, click on the quick help button on the window title "
+"bar of the previous dialog and then click on the \"<b>Auto Detect</b>\" "
+"button.</qt>"
+msgstr ""
+"<qt>Ako şelite saznati više o varijablama okruşja koje ispituje automatsko "
+"pronalaÅŸenje, kliknite OK, u traci naslova prethodnog prozora kliknite gumb "
+"za brzu pomoć, te zatim kliknite gumb \"<b>Automatsko pronalaÅŸenje</b>\".</qt>"
 
 #. +> trunk stable
 #: kenvvarproxydlg.cpp:234
-#, fuzzy
 #| msgid "Automatic Proxy Variable Detection"
 msgctxt "@title:window"
 msgid "Automatic Proxy Variable Detection"
-msgstr "Automatska detekcija Proxy varijabli"
+msgstr "Automatska detekcija posredničkih varijabli"
 
 #. i18n: ectx: label, entry (DisablePassiveMode), group (DesktopIcons)
@@ -810 +1046 @@
 #. +> trunk stable
 #: kio_ftprc.kcfg:11
-msgid "When FTP connections are passive the client connects to the server, instead of the other way round, so firewalls do not block the connection; old FTP servers may not support Passive FTP though."
-msgstr "Kada su FTP veze pasivne, klijent se povezuje na posluÅŸitelj, umjesto obrnuto, tako da vatrozidi ne blokiraju vezu; stariji FTP posluÅŸitelji moÅŸda ne podrÅŸavaju pasivni FTP."
+msgid ""
+"When FTP connections are passive the client connects to the server, instead "
+"of the other way round, so firewalls do not block the connection; old FTP "
+"servers may not support Passive FTP though."
+msgstr ""
+"Kada su FTP veze pasivne, klijent se povezuje na posluÅŸitelj, umjesto "
+"obrnuto, tako da vatrozidi ne blokiraju vezu; stariji FTP posluÅŸitelji moÅŸda "
+"ne podrÅŸavaju pasivni FTP."
 
 #. i18n: ectx: label, entry (MarkPartial), group (DesktopIcons)
@@ -822 +1064 @@
 #. +> trunk stable
 #: kio_ftprc.kcfg:17
-msgid "While a file is being uploaded its extension is \".part\". When fully uploaded it is renamed to its real name."
-msgstr "Dok se datoteka uploada njezina ekstenzija je \".part\". Kad upload završi, datoteka se preimenuje u njeno pravo ime."
+msgid ""
+"While a file is being uploaded its extension is \".part\". When fully "
+"uploaded it is renamed to its real name."
+msgstr ""
+"Dok se datoteka uploada njezina ekstenzija je \".part\". Kad upload završi, "
+"datoteka se preimenuje u njeno pravo ime."
 
 #. +> trunk stable
 #: kmanualproxydlg.cpp:48
-#, fuzzy
 #| msgid "Manual Proxy Configuration"
 msgctxt "@title:window"
 msgid "Manual Proxy Configuration"
-msgstr "Ručno podešavanje proxy-a"
+msgstr "Ručno podešavanje posrednika"
 
 #. +> trunk stable
 #: kmanualproxydlg.cpp:273
-#, fuzzy
 #| msgid "Invalid Proxy Setting"
 msgctxt "@title:window"
@@ -843 +1087 @@
 #. +> trunk stable
 #: kmanualproxydlg.cpp:274
-msgid "One or more of the specified proxy settings are invalid. The incorrect entries are highlighted."
-msgstr "Jedna ili više definiranih postavki posrednika su nevaljane. Netočne vrijednosti su označene."
+msgid ""
+"One or more of the specified proxy settings are invalid. The incorrect "
+"entries are highlighted."
+msgstr ""
+"Jedna ili više definiranih postavki posrednika su nevaljane. Netočne "
+"vrijednosti su označene."
 
 #. +> trunk stable
@@ -859 +1107 @@
 #. +> trunk stable
 #: kmanualproxydlg.cpp:346
-#, fuzzy
 #| msgid "Duplicate Entry"
 msgctxt "@title:window"
 msgid "Duplicate Entry"
-msgstr "Dupli unost"
+msgstr "Duplikat unosa"
 
 #. +> trunk stable
 #: kmanualproxydlg.cpp:356
-#, fuzzy
 #| msgid "New Exception"
 msgctxt "@title:window"
 msgid "New Exception"
-msgstr "Novi izuzetak"
+msgstr "Nova iznimka"
 
 #. +> trunk stable
 #: kmanualproxydlg.cpp:363
-#, fuzzy
 #| msgid "Change Exception"
 msgctxt "@title:window"
 msgid "Change Exception"
-msgstr "Promjeni izuzetak"
+msgstr "Promijeni iznimku"
 
 #. +> trunk stable
 #: kmanualproxydlg.cpp:440
-#, fuzzy
 #| msgid "Invalid Entry"
 msgctxt "@title:window"
@@ -896 +1140 @@
 #. +> trunk stable
 #: kmanualproxydlg.cpp:445
-msgid "<qt>Make sure none of the addresses or URLs you specified contain invalid or wildcard characters such as spaces, asterisks (*), or question marks(?).<br /><br /><u>Examples of VALID entries:</u><br /><code>http://mycompany.com, 192.168.10.1, mycompany.com, localhost, http://localhost</code><br /><br /><u>Examples of INVALID entries:</u><br /><code>http://my company.com, http:/mycompany,com file:/localhost</code></qt>"
-msgstr "<qt>Osigurajte da ni jedna od definiranih adresa ili URL-ova ne sadrÅŸi nevaljane znakove poput razmaka, zvjezdice (*) ili upitnika (?).<br /> <br /> <u>Primjeri VALJANIH unosa:</u><br /> <code>http://mycompany.com, 192.168.10.1, mycompany.com, localhost, http://localhost</code><br /><br /><u>Primjeri NEVALJANIH unosa:</u><br /> <code>http://my company.com, http:/mycompany,com file:/localhost</code></qt>"
+msgid ""
+"<qt>Make sure none of the addresses or URLs you specified contain invalid or "
+"wildcard characters such as spaces, asterisks (*), or question marks(?).<br />"
+"<br /><u>Examples of VALID entries:</u><br /><code>http://mycompany.com, 192."
+"168.10.1, mycompany.com, localhost, http://localhost</code><br /><br /><u>"
+"Examples of INVALID entries:</u><br /><code>http://my company.com, "
+"http:/mycompany,com file:/localhost</code></qt>"
+msgstr ""
+"<qt>Osigurajte da ni jedna od definiranih adresa ili URL-ova ne sadrÅŸi "
+"nevaljane znakove poput razmaka, zvjezdice (*) ili upitnika (?).<br /> <br /> "
+"<u>Primjeri VALJANIH unosa:</u><br /> <code>http://mycompany.com, 192.168.10."
+"1, mycompany.com, localhost, http://localhost</code><br /><br /><u>Primjeri "
+"NEVALJANIH unosa:</u><br /> <code>http://my company.com, http:/mycompany,com "
+"file:/localhost</code></qt>"
 
 #. +> trunk stable
 #: kmanualproxydlg.cpp:466
 msgid "Enter the URL or address that should use the above proxy settings:"
-msgstr "Unesite adresu ili URL za koji treba koristiti gornje postavke posrednika:"
+msgstr ""
+"Unesite adresu ili URL za koji treba koristiti gornje postavke posrednika:"
 
 #. +> trunk stable
 #: kmanualproxydlg.cpp:469
-msgid "Enter the address or URL that should be excluded from using the above proxy settings:"
-msgstr "Unesite adresu ili URL za koji ne treba koristiti gornje postavke posrednika:"
+msgid ""
+"Enter the address or URL that should be excluded from using the above proxy "
+"settings:"
+msgstr ""
+"Unesite adresu ili URL za koji ne treba koristiti gornje postavke posrednika:"
 
 #. +> trunk stable
 #: kmanualproxydlg.cpp:472
-msgid "<qt>Enter a valid address or URL.<br /><br /><b><u>NOTE:</u></b> Wildcard matching such as <code>*.kde.org</code> is not supported. If you want to match any host in the <code>.kde.org</code> domain, e.g. <code>printing.kde.org</code>, then simply enter <code>.kde.org</code>.</qt>"
-msgstr "<qt>Unesite valjanu adresu ili URL.<br/> <br /> <b><u>NAPOMENA:</u></b>Korištenje višeznačnika poput <code>*.kde.org</code> nije podrşano. Ako şelite podudarnost s bilo kojim posluşiteljem u domeni <code>.kde.org</code>, npr. <code>printing.kde.org</code>, tada jednostavno unesite <code>.kde.org</code>.</qt>"
+msgid ""
+"<qt>Enter a valid address or URL.<br /><br /><b><u>NOTE:</u></b> Wildcard "
+"matching such as <code>*.kde.org</code> is not supported. If you want to "
+"match any host in the <code>.kde.org</code> domain, e.g. <code>printing.kde."
+"org</code>, then simply enter <code>.kde.org</code>.</qt>"
+msgstr ""
+"<qt>Unesite valjanu adresu ili URL.<br/> <br /> <b><u>NAPOMENA:</u></b>"
+"Korištenje višeznačnika poput <code>*.kde.org</code> nije podrşano. Ako "
+"ÅŸelite podudarnost s bilo kojim posluÅŸiteljem u domeni <code>.kde.org</code>, "
+"npr. <code>printing.kde.org</code>, tada jednostavno unesite <code>.kde.org<"
+"/code>.</qt>"
 
 #. +> trunk stable
 #: kproxydlg.cpp:160
-msgid "The address of the automatic proxy configuration script is invalid. Please correct this problem before proceeding. Otherwise, your changes will be ignored."
-msgstr "<qt>Adresa automatskog podešavanja posrednika nije ispravna! Molim vas ispravite grešku prije daljnjeg rada. U suprotnom će sve izmjene biti zanemarene!</qt>"
+msgid ""
+"The address of the automatic proxy configuration script is invalid. Please "
+"correct this problem before proceeding. Otherwise, your changes will be "
+"ignored."
+msgstr ""
+"<qt>Adresa automatskog podešavanja posrednika nije ispravna! Molim vas "
+"ispravite grešku prije daljnjeg rada. U suprotnom će sve izmjene biti "
+"zanemarene!</qt>"
 
 #. +> trunk stable
 #: kproxydlg.cpp:287
-msgid "<h1>Proxy</h1><p>A proxy server is an intermediate program that sits between your machine and the Internet and provides services such as web page caching and/or filtering.</p><p>Caching proxy servers give you faster access to sites you have already visited by locally storing or caching the content of those pages; filtering proxy servers, on the other hand, provide the ability to block out requests for ads, spam, or anything else you want to block.</p><p><u>Note:</u> Some proxy servers provide both services.</p>"
-msgstr "<h1>Posrednik</h1><p>PosluÅŸitelj-posrednik je posredovni program koji stoji između vaÅ¡eg računala i Interneta, te pruÅŸa usluge poput predmemoriranja web stranica ili filtriranja.</p><p>PosluÅŸitelji-posrednici za predmemoriranje Vam omogućuju brÅŸi pristup stranicama koje ste već posjetili tako da lokalno spreme ili predmemoriraju sadrÅŸaj tih stranica; s druge strane, filtrirajući posluÅŸitelji-posrednici Vam pruÅŸaju mogućnost blokiranja reklama ili bilo čega Å¡to Vas nervira.</p> <p><u>Napomena:</u>Neki posluÅŸitelji-posrednici pruÅŸaju obje usluge.</p>"
+msgid ""
+"<h1>Proxy</h1><p>A proxy server is an intermediate program that sits between "
+"your machine and the Internet and provides services such as web page caching "
+"and/or filtering.</p><p>Caching proxy servers give you faster access to sites "
+"you have already visited by locally storing or caching the content of those "
+"pages; filtering proxy servers, on the other hand, provide the ability to "
+"block out requests for ads, spam, or anything else you want to block.</p><p><"
+"u>Note:</u> Some proxy servers provide both services.</p>"
+msgstr ""
+"<h1>Posrednik</h1><p>PosluÅŸitelj-posrednik je posredovni program koji stoji "
+"između vaÅ¡eg računala i Interneta, te pruÅŸa usluge poput predmemoriranja web "
+"stranica ili filtriranja.</p><p>PosluÅŸitelji-posrednici za predmemoriranje "
+"Vam omogućuju brÅŸi pristup stranicama koje ste već posjetili tako da lokalno "
+"spreme ili predmemoriraju sadrÅŸaj tih stranica; s druge strane, filtrirajući "
+"posluÅŸitelji-posrednici Vam pruÅŸaju mogućnost blokiranja reklama ili bilo "
+"čega što Vas nervira.</p> <p><u>Napomena:</u>Neki posluşitelji-posrednici "
+"pruÅŸaju obje usluge.</p>"
 
 #. +> trunk stable
 #: kproxydlg.cpp:306
-msgid "<qt>The proxy settings you specified are invalid.<br /><br />Please click on the <b>Setup...</b> button and correct the problem before proceeding; otherwise your changes will be ignored.</qt>"
-msgstr "<qt>Posrednici nisu ispravno podeÅ¡eni! Molim kliknite na <b>PodeÅ¡avanje
</b> kako bi ste ispravili greÅ¡ke prije nastavka rada; u suprotnom će sve ostale promjene zanemarene!</qt>"
+msgid ""
+"<qt>The proxy settings you specified are invalid.<br /><br />Please click on "
+"the <b>Setup...</b> button and correct the problem before proceeding; "
+"otherwise your changes will be ignored.</qt>"
+msgstr ""
+"<qt>Posrednici nisu ispravno podešeni! Molim kliknite na <b>Podešavanje
</b> "
+"kako bi ste ispravili greške prije nastavka rada; u suprotnom će sve ostale "
+"promjene zanemarene!</qt>"
 
 #. i18n: ectx: property (whatsThis), widget (QWidget, KProxyDialogUI)
@@ -936 +1232 @@
 "Setup proxy configuration.\n"
 "<p>\n"
-"A proxy server is an intermediate machine that sits between your computer and the Internet and provides services such as web page caching and filtering. Caching proxy servers give you faster access to web sites you have already visited by locally storing or caching those pages; filtering proxy servers usually provide the ability to block out requests for ads, spam, or anything else you want to block.\n"
+"A proxy server is an intermediate machine that sits between your computer and "
+"the Internet and provides services such as web page caching and filtering. "
+"Caching proxy servers give you faster access to web sites you have already "
+"visited by locally storing or caching those pages; filtering proxy servers "
+"usually provide the ability to block out requests for ads, spam, or anything "
+"else you want to block.\n"
 "<p>\n"
-"If you are uncertain whether or not you need to use a proxy server to connect to the Internet, consult your Internet service provider's setup guide or your system administrator.\n"
+"If you are uncertain whether or not you need to use a proxy server to connect "
+"to the Internet, consult your Internet service provider's setup guide or your "
+"system administrator.\n"
 "</qt>"
 msgstr ""
@@ -944 +1247 @@
 "Podešavanje posluşitelja-posrednika.\n"
 "<p>\n"
-"PosluÅŸitelj-posrednik je posredovno računalo koje stoji između VaÅ¡eg računala i Interneta, te pruÅŸa usluge poput predmemoriranja web stranica ili filtriranja. PosluÅŸitelji-posrednici za predmemoriranje Vam omogućuju brÅŸi pristup već posjećenim web stranicama tako da ih lokalno spremi ili predmemorira; filtrirajući posluÅŸitelji-posrednici obično omogućuju blokiranje reklama ili bilo čega Å¡to Vas nervira.\n"
+"PosluÅŸitelj-posrednik je posredovno računalo koje stoji između VaÅ¡eg računala "
+"i Interneta, te pruÅŸa usluge poput predmemoriranja web stranica ili "
+"filtriranja. PosluÅŸitelji-posrednici za predmemoriranje Vam omogućuju brÅŸi "
+"pristup već posjećenim web stranicama tako da ih lokalno spremi ili "
+"predmemorira; filtrirajući posluÅŸitelji-posrednici obično omogućuju "
+"blokiranje reklama ili bilo čega što Vas nervira.\n"
 "<p>\n"
-"Ako niste sigurni treba li vam posluşitelj-posrednik za pristup Internetu, provjerite upute vašeg pruşatelja Internet usluga ili potraşite savjet vašeg upravitelja sustava.\n"
+"Ako niste sigurni treba li vam posluÅŸitelj-posrednik za pristup Internetu, "
+"provjerite upute vašeg pruşatelja Internet usluga ili potraşite savjet vašeg "
+"upravitelja sustava.\n"
 "</qt>"
 
@@ -967 +1277 @@
 "<qt>\n"
 "Automatically detect and configure the proxy settings.<p>\n"
-"Automatic detection is performed using the <b>Web Proxy Auto-Discovery Protocol (WPAD)</b>.<p>\n"
-"<b>NOTE:</b> This option might not work properly or not work at all in some UNIX/Linux distributions. If you encounter a problem when using this option, please check the FAQ section at http://konqueror.kde.org.\n"
+"Automatic detection is performed using the <b>Web Proxy Auto-Discovery "
+"Protocol (WPAD)</b>.<p>\n"
+"<b>NOTE:</b> This option might not work properly or not work at all in some "
+"UNIX/Linux distributions. If you encounter a problem when using this option, "
+"please check the FAQ section at http://konqueror.kde.org.\n"
 "</qt>"
 msgstr ""
 "<qt>\n"
 "Automatski otkrij i postavi postavke posrednika. <p>\n"
-"Automatsko otkrivanje se izvodi pomoću <b>Protokola za automatsko otkrivanje web posrednika (WPAD – Web Proxy Auto-Discovery Protocol)</b>. <p>\n"
-"<b>NAPOMENA:</b>Ova opcija moÅŸda neće pravilno ili u potpunosti raditi na nekim UNIX/Linux distribucijama. Ako naiđete na problem prilikom koriÅ¡tenja ove opcije, molim provjerite FAQ dio na http://konqueror.kde.org\n"
+"Automatsko otkrivanje se izvodi pomoću <b>Protokola za automatsko otkrivanje "
+"web posrednika (WPAD – Web Proxy Auto-Discovery Protocol)</b>. <p>\n"
+"<b>NAPOMENA:</b>Ova opcija moÅŸda neće pravilno ili u potpunosti raditi na "
+"nekim UNIX/Linux distribucijama. Ako naiđete na problem prilikom korištenja "
+"ove opcije, molim provjerite FAQ dio na http://konqueror.kde.org\n"
 "</qt>"
 
@@ -987 +1303 @@
 #: kproxydlg.ui:75
 msgid "Use the specified proxy script URL to configure the proxy settings."
-msgstr "Koristi navedenu skriptu za podešavanje postavki posluşitelja-posrednika."
+msgstr ""
+"Koristi navedenu skriptu za podešavanje postavki posluşitelja-posrednika."
 
 #. i18n: ectx: property (text), widget (QRadioButton, rbAutoScript)
@@ -1007 +1324 @@
 "<qt>\n"
 "Use environment variables to configure the proxy settings.<p>\n"
-"Environment variables such as <b>HTTP_PROXY</b> and <b>NO_PROXY</b> are usually used in multi-user UNIX installations, where both graphical and non-graphical applications need to share the same proxy configuration information.\n"
+"Environment variables such as <b>HTTP_PROXY</b> and <b>NO_PROXY</b> are "
+"usually used in multi-user UNIX installations, where both graphical and "
+"non-graphical applications need to share the same proxy configuration "
+"information.\n"
 "</qt>"
 msgstr ""
 "<qt>\n"
 "Koristi varijable okoline za podešavanje postavki posrednika.<p>\n"
-"Varijable okoline poput <b>HTTP_PROXY</b> i <b>NO_PROXY</b> su često korištene u višekorisničkim instalacijama UNIX-a, gdje grafičke i negrafičke aplikacije trebaju dijeliti iste postavke posrednika.\n"
+"Varijable okoline poput <b>HTTP_PROXY</b> i <b>NO_PROXY</b> su često "
+"korištene u višekorisničkim instalacijama UNIX-a, gdje grafičke i negrafičke "
+"aplikacije trebaju dijeliti iste postavke posrednika.\n"
 "</qt>"
 
@@ -1080 +1402 @@
 #: kproxydlg.ui:220
 msgid "Use information specified here to login into proxy servers as needed."
-msgstr "Koristi informacije definirane ovdje za prijavu na posluÅŸitelje-posrednike po potrebi."
+msgstr ""
+"Koristi informacije definirane ovdje za prijavu na posluÅŸitelje-posrednike po "
+"potrebi."
 
 #. i18n: ectx: property (text), widget (QRadioButton, rbPresetLogin)
@@ -1119 +1443 @@
 "<qt>\n"
 "Use persistent proxy connection.<p>\n"
-"Although a persistent proxy connection is faster, note that it only works correctly with proxies that are fully HTTP 1.1 compliant. Do <b>not</b> use this option in combination with non-HTTP 1.1 compliant proxy servers such as JunkBuster and WWWOfle.\n"
-"</qt>"
-msgstr "KoriÅ¡tenje stalnih (persistent) Proxy konekcija je brÅŸe, ali radi sam sa ProxyposluÅŸiteljima koji su u potpunosti usklađeni sa HTTP 1.1 protokolom. <b>Nemojte</b> koristiti ovu opciju sa programima kao Å¡to su JunkBuster ili WWWOfle."
+"Although a persistent proxy connection is faster, note that it only works "
+"correctly with proxies that are fully HTTP 1.1 compliant. Do <b>not</b> use "
+"this option in combination with non-HTTP 1.1 compliant proxy servers such as "
+"JunkBuster and WWWOfle.\n"
+"</qt>"
+msgstr ""
+"Korištenje stalnih (persistent) Proxy konekcija je brşe, ali radi sam sa "
+"ProxyposluÅŸiteljima koji su u potpunosti usklađeni sa HTTP 1.1 protokolom. <b>"
+"Nemojte</b> koristiti ovu opciju sa programima kao Å¡to su JunkBuster ili "
+"WWWOfle."
 
 #. i18n: ectx: property (text), widget (QCheckBox, cbPersConn)
@@ -1131 +1462 @@
 #. +> trunk stable
 #: ksaveioconfig.cpp:224 ksaveioconfig.cpp:240
-#, fuzzy
 #| msgid "Update Failed"
 msgctxt "@title:window"
 msgid "Update Failed"
-msgstr "Neuspjelo osvjeÅŸavanje"
+msgstr "Neuspjelo aÅŸuriranje"
 
 #. +> trunk stable
 #: ksaveioconfig.cpp:225
-msgid "You have to restart the running applications for these changes to take effect."
+msgid ""
+"You have to restart the running applications for these changes to take effect."
 msgstr "Morate restartati pokrenute programe da bi ove izmjene bile vidljive."
 
@@ -1174 +1505 @@
 #. +> trunk stable
 #: manualproxy.ui:100
-msgid "Enter the port number of the FTP proxy server. Default 8080. Another common value is 3128."
-msgstr "Unesite broj priljučka (port-a) vašeg HTTP posrednika. Obično se koristi 8080."
+msgid ""
+"Enter the port number of the FTP proxy server. Default 8080. Another common "
+"value is 3128."
+msgstr ""
+"Unesite broj priljučka (port-a) vašeg HTTP posrednika. Obično se koristi 8080."
 
 #. i18n: ectx: property (whatsThis), widget (KIntSpinBox, sbHttps)
@@ -1181 +1515 @@
 #. +> trunk stable
 #: manualproxy.ui:110 manualproxy.ui:126
-msgid "Enter the port number of the HTTP proxy server. Default is 8080. Another common value is 3128."
-msgstr "Unesite broj priljučka (port-a) vašeg HTTP posrednika (proxy). Obično se koristi 8080."
+msgid ""
+"Enter the port number of the HTTP proxy server. Default is 8080. Another "
+"common value is 3128."
+msgstr ""
+"Unesite broj priljučka (port-a) vašeg HTTP posrednika (proxy). Obično se "
+"koristi 8080."
 
 #. i18n: ectx: property (text), widget (QCheckBox, cbSameProxy)
@@ -1201 +1539 @@
 msgid ""
 "<qt>\n"
-"Reverse the use of the exception list. Checking this box will result in the proxy servers being used only when the requested URL matches one of the addresses listed here.<p>This feature is useful if all you want or need is to use a proxy server  for a few specific sites.<p>If you have more complex requirements you might want to use a configuration script.\n"
-"</qt>"
-msgstr ""
-"<qt>\n"
-"KoriÅ¡tenje popisa iznimaka unatrag. Ako uključite ovu opciju, onda će se posrednici koristiti samo kad će se zahtijevani URL-ovi podudarati s ovdje popisanim adresama. <p>Ova mogućnost je korisna ako samo ÅŸelite koristiti posrednika za nekoliko specifičnih stranica. <p>Ako imate kompliciranije potrebe, moÅŸda ćete htjeti koristiti konfiguracijsku skriptu.\n"
+"Reverse the use of the exception list. Checking this box will result in the "
+"proxy servers being used only when the requested URL matches one of the "
+"addresses listed here.<p>This feature is useful if all you want or need is to "
+"use a proxy server  for a few specific sites.<p>If you have more complex "
+"requirements you might want to use a configuration script.\n"
+"</qt>"
+msgstr ""
+"<qt>\n"
+"Korištenje popisa iznimaka unatrag. Ako uključite ovu opciju, onda će se "
+"posrednici koristiti samo kad će se zahtijevani URL-ovi podudarati s ovdje "
+"popisanim adresama. <p>Ova mogućnost je korisna ako samo ÅŸelite koristiti "
+"posrednika za nekoliko specifičnih stranica. <p>Ako imate kompliciranije "
+"potrebe, moÅŸda ćete htjeti koristiti konfiguracijsku skriptu.\n"
 "</qt>"
 
@@ -1218 +1564 @@
 #: manualproxy.ui:188
 msgid "Remove all proxy exception addresses from the list."
-msgstr "Ukloni sve adrese koje se ne dohvaćaju preko proxy posluÅŸitelja sa popisa."
+msgstr ""
+"Ukloni sve adrese koje se ne dohvaćaju preko proxy posluÅŸitelja sa popisa."
 
 #. i18n: ectx: property (text), widget (QPushButton, pbDeleteAll)
@@ -1230 +1577 @@
 #: manualproxy.ui:201
 msgid "Remove the selected proxy exception address from the list."
-msgstr "Ukloni odabrane adrese koje se ne dohvaćaju preko proxy posluÅŸitelja sa popisa."
+msgstr ""
+"Ukloni odabrane adrese koje se ne dohvaćaju preko proxy posluÅŸitelja sa "
+"popisa."
 
 #. i18n: ectx: property (text), widget (QPushButton, pbDelete)
@@ -1248 +1597 @@
 #: manualproxy.ui:224
 msgid "Change the selected proxy exception address."
-msgstr "Kliknite na ovaj gumb ako ÅŸelite izmjeniti odabrane adrese koje će biti iznimke."
+msgstr ""
+"Kliknite na ovaj gumb ako ÅŸelite izmjeniti odabrane adrese koje će biti "
+"iznimke."
 
 #. i18n: ectx: property (text), widget (QPushButton, pbChange)
@@ -1264 +1615 @@
 #: netpref.cpp:33
 #, kde-format
-msgid "Here you can set timeout values. You might want to tweak them if your connection is very slow. The maximum allowed value is 1 second."
-msgid_plural "Here you can set timeout values. You might want to tweak them if your connection is very slow. The maximum allowed value is %1 seconds."
-msgstr[0] "Ovdje moÅŸete podesiti vrijeme valjanosti, koje moÅŸda trebate podesiti ako vam je veza spora. Najveća dozvoljena vrijednost je %1 sekunda."
-msgstr[1] "Ovdje moÅŸete podesiti vrijeme valjanosti, koje moÅŸda trebate podesiti ako vam je veza spora. Najveća dozvoljena vrijednost je %1 sekunde."
-msgstr[2] "Ovdje moÅŸete podesiti vrijeme valjanosti, koje moÅŸda trebate podesiti ako vam je veza spora. Najveća dozvoljena vrijednost je %1 sekundi."
+msgid ""
+"Here you can set timeout values. You might want to tweak them if your "
+"connection is very slow. The maximum allowed value is 1 second."
+msgid_plural ""
+"Here you can set timeout values. You might want to tweak them if your "
+"connection is very slow. The maximum allowed value is %1 seconds."
+msgstr[0] ""
+"Ovdje moÅŸete podesiti vrijeme valjanosti, koje moÅŸda trebate podesiti ako vam "
+"je veza spora. Najveća dozvoljena vrijednost je %1 sekunda."
+msgstr[1] ""
+"Ovdje moÅŸete podesiti vrijeme valjanosti, koje moÅŸda trebate podesiti ako vam "
+"je veza spora. Najveća dozvoljena vrijednost je %1 sekunde."
+msgstr[2] ""
+"Ovdje moÅŸete podesiti vrijeme valjanosti, koje moÅŸda trebate podesiti ako vam "
+"je veza spora. Najveća dozvoljena vrijednost je %1 sekundi."
 
 #. +> trunk stable
@@ -1310 +1671 @@
 #. +> trunk stable
 #: netpref.cpp:69
-msgid "Enables FTP's \"passive\" mode. This is required to allow FTP to work from behind firewalls."
-msgstr "Omogući FTP passive mode. Ovo je potrebno da bi koristili FTP iza vatrozida (firewalla)."
+msgid ""
+"Enables FTP's \"passive\" mode. This is required to allow FTP to work from "
+"behind firewalls."
+msgstr ""
+"Omogući FTP passive mode. Ovo je potrebno da bi koristili FTP iza vatrozida "
+"(firewalla)."
 
 #. +> trunk stable
@@ -1320 +1685 @@
 #. +> trunk stable
 #: netpref.cpp:76
-msgid "<p>Marks partially uploaded FTP files.</p><p>When this option is enabled, partially uploaded files will have a \".part\" extension. This extension will be removed once the transfer is complete.</p>"
-msgstr "<p>Označi djelomično uploadane FTP datoteke</p> <p>Ako je ova opcija omogućena, djelomično uploadane datoteke će imati ekstenziju \".part\". Ekstenzija će biti maknuta kad prijenos završi.</p>"
+msgid ""
+"<p>Marks partially uploaded FTP files.</p><p>When this option is enabled, "
+"partially uploaded files will have a \".part\" extension. This extension will "
+"be removed once the transfer is complete.</p>"
+msgstr ""
+"<p>Označi djelomično uploadane FTP datoteke</p> <p>Ako je ova opcija "
+"omogućena, djelomično uploadane datoteke će imati ekstenziju \".part\". "
+"Ekstenzija će biti maknuta kad prijenos završi.</p>"
 
 #. +> trunk stable
 #: netpref.cpp:144
-msgid "<h1>Network Preferences</h1>Here you can define the behavior of KDE programs when using Internet and network connections. If you experience timeouts or use a modem to connect to the Internet, you might want to adjust these settings."
-msgstr "<h1>Postavke mreşe</h1> Ovdje moşete definirati ponašanje KDE programa dok korite Internet i mreşne veze. Ako koristite modem za spajanje na Internet ili Vam mreşa ne radi kako şelite, ovdje moşete promijeniti te postavke."
+msgid ""
+"<h1>Network Preferences</h1>Here you can define the behavior of KDE programs "
+"when using Internet and network connections. If you experience timeouts or "
+"use a modem to connect to the Internet, you might want to adjust these "
+"settings."
+msgstr ""
+"<h1>Postavke mreşe</h1> Ovdje moşete definirati ponašanje KDE programa dok "
+"korite Internet i mreÅŸne veze. Ako koristite modem za spajanje na Internet "
+"ili Vam mreÅŸa ne radi kako ÅŸelite, ovdje moÅŸete promijeniti te postavke."
 
 #. i18n: ectx: property (whatsThis), widget (QLabel, lbDomain)
@@ -1334 +1712 @@
 msgid ""
 "<qt>\n"
-"Enter the host or domain to which this policy applies, e.g. <b>www.kde.org</b> or <b>.kde.org</b>.\n"
-"</qt>"
-msgstr ""
-"<qt>\n"
-"Unesite domaćina ili domenu na koju se ovo pravilo odnosi, npr. <b>www.kde.org</b> ili <b>.kde.org</b>\n"
+"Enter the host or domain to which this policy applies, e.g. <b>www.kde.org</b>"
+" or <b>.kde.org</b>.\n"
+"</qt>"
+msgstr ""
+"<qt>\n"
+"Unesite domaćina ili domenu na koju se ovo pravilo odnosi, npr. <b>www.kde."
+"org</b> ili <b>.kde.org</b>\n"
 "</qt>"
 
@@ -1366 +1746 @@
 "<li><b>Prihvati</b> – Ove stranice smiju slati kolačiće</li>\n"
 "<li><b>Odbij</b> – Ove stranice ne smiju slati kolačiće</li>\n"
-"<li><b>Pitaj</b> – TraÅŸi se potvrda kad god ove stranice pokuÅ¡aju poslati kolačić</li>\n"
+"<li><b>Pitaj</b> – TraÅŸi se potvrda kad god ove stranice pokuÅ¡aju poslati "
+"kolačić</li>\n"
 "</ul>\n"
 "</qt>"
@@ -1411 +1792 @@
 #. +> trunk stable
 #: smbrodlg.cpp:177
-msgid "<p><h1>Windows Shares</h1>Konqueror is able to access shared Microsoft Windows file systems, if properly configured. If there is a specific computer from which you want to browse, fill in the <em>Browse server</em> field. This is mandatory if you are not running Samba locally. The <em>Broadcast address</em> and <em>WINS address</em> fields will also be available, if you use the native code, or the location of the 'smb.conf' file from which the options are read, when using Samba. In any case, the broadcast address (interfaces in smb.conf) must be set up if it is guessed incorrectly or you have multiple cards. A WINS server usually improves performance, and reduces the network load a lot.</p><p>The bindings are used to assign a default user for a given server, possibly with the corresponding password, or for accessing specific shares. If you choose to, new bindings will be created for logins and shares accessed during browsing. You can edit all of them from here. Passwords will be stored locally, and scrambled so as to render them unreadable to the human eye. For security reasons, you may not want to do that, as entries with passwords are clearly indicated as such.</p>"
-msgstr "<p> <h1>Windows dijeljenja</h1> Konqueror moÅŸe pristupati dijeljenim datotečnim sustavima operacijskog sustava Microsoft Windows, ako je pravilno postavljen. Ako postoji specifično računalo koje ÅŸelite pregledati, popunite polje <em>Pregledaj posluÅŸitelja</em>. To je obavezno ako nemate lokalno pokrenutu Sambu. Polja <em>Adresa emitiranja</em> i <em>WINS adresa</em> će također biti dostupna, ako koristite čisti kod, ili lokacija'smb.conf' datoteke iz koje će biti pročitane opcije, ako koristite Sambu. U oba slučaja, adresa emitiranja (sučelja u smb.conf) mora biti postavljena ako je pogreÅ¡no pogođena ili ako imate viÅ¡e mreÅŸnih kartica. WINS posluÅŸitelj obično poboljÅ¡a brzinu i uvelike smanji opterećenje mreÅŸe.</p> <p>Veze se koriste za dodjeljivanje uobičajenog korisnika zadanom posluÅŸitelju, moguće s odgovarajućom lozinkom, ili za pristup specifičnim lokacijama. Ako tako odaberete, nove veze će se stvoriti za prijave i dijeljenja kojima se pristupa prilikom pregledavanja. Sve ih moÅŸete urediti odavde. Lozinke će biti spremljene lokalno, ali ispremijeÅ¡ane kako bi bile nečitljive ljudima (iz sigurnosnih razloga).</p>"
+msgid ""
+"<p><h1>Windows Shares</h1>Konqueror is able to access shared Microsoft "
+"Windows file systems, if properly configured. If there is a specific computer "
+"from which you want to browse, fill in the <em>Browse server</em> field. This "
+"is mandatory if you are not running Samba locally. The <em>Broadcast address<"
+"/em> and <em>WINS address</em> fields will also be available, if you use the "
+"native code, or the location of the 'smb.conf' file from which the options "
+"are read, when using Samba. In any case, the broadcast address (interfaces in "
+"smb.conf) must be set up if it is guessed incorrectly or you have multiple "
+"cards. A WINS server usually improves performance, and reduces the network "
+"load a lot.</p><p>The bindings are used to assign a default user for a given "
+"server, possibly with the corresponding password, or for accessing specific "
+"shares. If you choose to, new bindings will be created for logins and shares "
+"accessed during browsing. You can edit all of them from here. Passwords will "
+"be stored locally, and scrambled so as to render them unreadable to the human "
+"eye. For security reasons, you may not want to do that, as entries with "
+"passwords are clearly indicated as such.</p>"
+msgstr ""
+"<p> <h1>Windows dijeljenja</h1> Konqueror moÅŸe pristupati dijeljenim "
+"datotečnim sustavima operacijskog sustava Microsoft Windows, ako je pravilno "
+"postavljen. Ako postoji specifično računalo koje şelite pregledati, popunite "
+"polje <em>Pregledaj posluÅŸitelja</em>. To je obavezno ako nemate lokalno "
+"pokrenutu Sambu. Polja <em>Adresa emitiranja</em> i <em>WINS adresa</em> će "
+"također biti dostupna, ako koristite čisti kod, ili lokacija'smb.conf' "
+"datoteke iz koje će biti pročitane opcije, ako koristite Sambu. U oba "
+"slučaja, adresa emitiranja (sučelja u smb.conf) mora biti postavljena ako je "
+"pogreÅ¡no pogođena ili ako imate viÅ¡e mreÅŸnih kartica. WINS posluÅŸitelj obično "
+"poboljÅ¡a brzinu i uvelike smanji opterećenje mreÅŸe.</p> <p>Veze se koriste za "
+"dodjeljivanje uobičajenog korisnika zadanom posluÅŸitelju, moguće s "
+"odgovarajućom lozinkom, ili za pristup specifičnim lokacijama. Ako tako "
+"odaberete, nove veze će se stvoriti za prijave i dijeljenja kojima se "
+"pristupa prilikom pregledavanja. Sve ih moÅŸete urediti odavde. Lozinke će "
+"biti spremljene lokalno, ali ispremiješane kako bi bile nečitljive ljudima "
+"(iz sigurnosnih razloga).</p>"
 
 #. +> trunk stable
 #: useragentdlg.cpp:80
-#, fuzzy
 #| msgid "Add Identification"
 msgctxt "@title:window"
@@ -1424 +1836 @@
 #. +> trunk stable
 #: useragentdlg.cpp:149
-#, fuzzy
 #| msgid "Modify Identification"
 msgctxt "@title:window"
 msgid "Modify Identification"
-msgstr "Izmjeni identifikaciju"
+msgstr "Izmijeni identifikaciju"
 
 #. +> trunk stable
 #: useragentdlg.cpp:201
 #, kde-format
-msgid "<qt><center>Found an existing identification for<br/><b>%1</b><br/>Do you want to replace it?</center></qt>"
-msgstr "<qt> <center>Pronađena postojeća identifikacija za<br/> <b>%1</b><br/> Åœelite li je zamijeniti?</center> </qt>"
+msgid ""
+"<qt><center>Found an existing identification for<br/><b>%1</b><br/>Do you "
+"want to replace it?</center></qt>"
+msgstr ""
+"<qt> <center>Pronađena postojeća identifikacija za<br/> <b>%1</b><br/> Åœelite "
+"li je zamijeniti?</center> </qt>"
 
 #. +> trunk stable
 #: useragentdlg.cpp:206
-#, fuzzy
 #| msgid "Duplicate Identification"
 msgctxt "@title:window"
 msgid "Duplicate Identification"
-msgstr "Dvostruka identifikacija"
+msgstr "Duplikat identifikacije"
 
 #. +> trunk stable
 #: useragentdlg.cpp:386
-msgid "<p><h1>Browser Identification</h1> The browser-identification module allows you to have full control over how Konqueror will identify itself to web sites you browse.</p><p>This ability to fake identification is necessary because some web sites do not display properly when they detect that they are not talking to current versions of either Netscape Navigator or Internet Explorer, even if the browser actually supports all the necessary features to render those pages properly. For such sites, you can use this feature to try to browse them. Please understand that this might not always work, since such sites might be using non-standard web protocols and or specifications.</p><p><u>NOTE:</u> To obtain specific help on a particular section of the dialog box, simply click on the quick help button on the window title bar, then click on the section for which you are seeking help.</p>"
-msgstr "<p> <h1>Indentifikacija preglednikay</h1>  Modul za identifikaciju preglednika Vam omogućuje punu kontrolu nad tim kako će se Konqueror identificirati web stranicama koje pregledavate.</p> <p>Ova mogućnost laÅŸne identifikacije je potrebna jer se neke web stranice ne ÅŸele pravilno iscrtati ako otkriju da ih se ne pregledava sa najzadnjim verzijama Mozilla Firefoxa ili Internet Explorera, makar taj preglednik imao sve mogućnosti potrebne za pravilno iscrtavanje tih stranica. Za takve stranice, moÅŸete iskoristiti ovu mogućnost dok ih pregledavate. Molimo za razumijevanje da taj trik moÅŸda neće uvijek upaliti, jer takve stranice moÅŸda koriste nestandardne web protokole i/ili specifikacije.</p> <p><u>NAPOMENA:</u>Da biste dobili specifičnu pomoć za određeni dio dialoga, jednostavno kliknite na gumb za brzu pomoć u naslovnoj traci prozora, a zatim kliknite na dio za koji traÅŸite pomoć.</p>"
+msgid ""
+"<p><h1>Browser Identification</h1> The browser-identification module allows "
+"you to have full control over how Konqueror will identify itself to web sites "
+"you browse.</p><p>This ability to fake identification is necessary because "
+"some web sites do not display properly when they detect that they are not "
+"talking to current versions of either Netscape Navigator or Internet "
+"Explorer, even if the browser actually supports all the necessary features to "
+"render those pages properly. For such sites, you can use this feature to try "
+"to browse them. Please understand that this might not always work, since such "
+"sites might be using non-standard web protocols and or specifications.</p><p>"
+"<u>NOTE:</u> To obtain specific help on a particular section of the dialog "
+"box, simply click on the quick help button on the window title bar, then "
+"click on the section for which you are seeking help.</p>"
+msgstr ""
+"<p> <h1>Indentifikacija preglednikay</h1>  Modul za identifikaciju "
+"preglednika Vam omogućuje punu kontrolu nad tim kako će se Konqueror "
+"identificirati web stranicama koje pregledavate.</p> <p>Ova mogućnost laÅŸne "
+"identifikacije je potrebna jer se neke web stranice ne ÅŸele pravilno iscrtati "
+"ako otkriju da ih se ne pregledava sa najzadnjim verzijama Mozilla Firefoxa "
+"ili Internet Explorera, makar taj preglednik imao sve mogućnosti potrebne za "
+"pravilno iscrtavanje tih stranica. Za takve stranice, moÅŸete iskoristiti ovu "
+"mogućnost dok ih pregledavate. Molimo za razumijevanje da taj trik moÅŸda neće "
+"uvijek upaliti, jer takve stranice moÅŸda koriste nestandardne web protokole "
+"i/ili specifikacije.</p> <p><u>NAPOMENA:</u>Da biste dobili specifičnu pomoć "
+"za određeni dio dialoga, jednostavno kliknite na gumb za brzu pomoć u "
+"naslovnoj traci prozora, a zatim kliknite na dio za koji traÅŸite pomoć.</p>"
 
 #. i18n: ectx: property (whatsThis), widget (QWidget, UserAgentUI)
@@ -1454 +1892 @@
 msgid ""
 "<qt>\n"
-"Here you can modify the default browser-identification text or set a site <code>(eg. www.kde.org)</code> or a domain <code>(eg. kde.org)</code> specific identification text.<p>\n"
-"To add a new site-specific identification text, click the <code>New</code> button and supply the necessary information. To change an existing site-specific entry, click on the <code>Change</code> button. The <code>Delete</code> button will remove the selected site-specific identification text, causing the default setting to be used for that site or domain.\n"
-"</qt>"
-msgstr ""
-"<qt>\n"
-"Ovdje moÅŸete promijeniti uobičajeni tekst identifikacije preglednika ili postaviti specifični tekst identifikacije za određene stranice ili domene (npr. <code>www.kde.org</code> ili <code>.kde.org</code>). <p>\n"
-"Da biste dodali novi tekst identifikacije za specifičnu stranicu, kliknite na gumb <code>Novo</code> i dajte potrebne informacije. Da biste promijenili unos za specifičnu stranicu, kliknite na gumb <code>Promijeni</code>. Gumb <code>Izbriši</code> će izbrisati identifikacijske tekstove za odabrane specifične stranice. Za te stranice bit će korištene uobičajene postavke.\n"
+"Here you can modify the default browser-identification text or set a site <"
+"code>(eg. www.kde.org)</code> or a domain <code>(eg. kde.org)</code> specific "
+"identification text.<p>\n"
+"To add a new site-specific identification text, click the <code>New</code> "
+"button and supply the necessary information. To change an existing "
+"site-specific entry, click on the <code>Change</code> button. The <code>"
+"Delete</code> button will remove the selected site-specific identification "
+"text, causing the default setting to be used for that site or domain.\n"
+"</qt>"
+msgstr ""
+"<qt>\n"
+"Ovdje moşete promijeniti uobičajeni tekst identifikacije preglednika ili "
+"postaviti specifični tekst identifikacije za određene stranice ili domene "
+"(npr. <code>www.kde.org</code> ili <code>.kde.org</code>). <p>\n"
+"Da biste dodali novi tekst identifikacije za specifičnu stranicu, kliknite na "
+"gumb <code>Novo</code> i dajte potrebne informacije. Da biste promijenili "
+"unos za specifičnu stranicu, kliknite na gumb <code>Promijeni</code>. Gumb <"
+"code>Izbriši</code> će izbrisati identifikacijske tekstove za odabrane "
+"specifične stranice. Za te stranice bit će korištene uobičajene postavke.\n"
 "</qt>"
 
@@ -1469 +1919 @@
 "<qt>\n"
 "Send the browser identification to web sites.<p>\n"
-"<u>NOTE:</u> Many sites rely on this information to display pages properly, hence, it is highly recommended that you do not totally disable this feature but rather customize it.<p>\n"
-"By default, only minimal identification information is sent to remote sites. The identification text that will be sent is shown below.\n"
+"<u>NOTE:</u> Many sites rely on this information to display pages properly, "
+"hence, it is highly recommended that you do not totally disable this feature "
+"but rather customize it.<p>\n"
+"By default, only minimal identification information is sent to remote sites. "
+"The identification text that will be sent is shown below.\n"
 "</qt>"
 msgstr ""
 "<qt>\n"
 "Å alji identifikaciju preglednika web stranicama.<p>\n"
-"<u>NAPOMENA:</u> Mnoge stranice oslanjaju se na ovaj podatak kako bi ispravno prikazale sadrÅŸaj. Stoga je preporučljivo da ne isključujete ovu mogućnost potpuno, već da je samo prilagodite.<p>\n"
-"Uobičajeno se šalju samo najnuşniji podaci. Tekst koji se šalje prikazan je dolje.\n"
+"<u>NAPOMENA:</u> Mnoge stranice oslanjaju se na ovaj podatak kako bi ispravno "
+"prikazale sadrÅŸaj. Stoga je preporučljivo da ne isključujete ovu mogućnost "
+"potpuno, već da je samo prilagodite.<p>\n"
+"Uobičajeno se šalju samo najnuşniji podaci. Tekst koji se šalje prikazan je "
+"dolje.\n"
 "</qt>"
 
@@ -1488 +1944 @@
 #. +> trunk stable
 #: useragentdlg.ui:43
-msgid "The browser identification text sent to the sites you visit. Use the provided options to customize it."
-msgstr "Identifikacijski tekst preglednika koji se Å¡alje web stranicama koje posjetite. MoÅŸete ga prilagoditi ponuđenim opcijama."
+msgid ""
+"The browser identification text sent to the sites you visit. Use the provided "
+"options to customize it."
+msgstr ""
+"Identifikacijski tekst preglednika koji se Å¡alje web stranicama koje "
+"posjetite. MoÅŸete ga prilagoditi ponuđenim opcijama."
 
 #. i18n: ectx: property (title), widget (QGroupBox, defaultIdGroupBox)
@@ -1500 +1960 @@
 #. +> trunk stable
 #: useragentdlg.ui:58
-msgid "The browser identification text sent to the sites you visit. You can customize it using the options provided below."
-msgstr "Ovo je uobičajena identifikacija koja se Å¡alje posluÅŸiteljima tokom pretraÅŸivanja stranica na internetu. Odabiranjem u kućicama ispod moÅŸete ju prilagoditi svojim ÅŸeljama."
+msgid ""
+"The browser identification text sent to the sites you visit. You can "
+"customize it using the options provided below."
+msgstr ""
+"Ovo je uobičajena identifikacija koja se šalje posluşiteljima tokom "
+"pretraÅŸivanja stranica na internetu. Odabiranjem u kućicama ispod moÅŸete ju "
+"prilagoditi svojim ÅŸeljama."
 
 #. i18n: ectx: property (whatsThis), widget (QCheckBox, osNameCheckBox)
 #. +> trunk stable
 #: useragentdlg.ui:71
-msgid "Includes your operating system's name in the browser identification text."
-msgstr "Ovdje odabirete dodavanje <code>inačice vašeg operacijskog sustava</code> u uobičajenu identifikacijsku poruku."
+msgid ""
+"Includes your operating system's name in the browser identification text."
+msgstr ""
+"Ovdje odabirete dodavanje <code>inačice vašeg operacijskog sustava</code> u "
+"uobičajenu identifikacijsku poruku."
 
 #. i18n: ectx: property (text), widget (QCheckBox, osNameCheckBox)
@@ -1518 +1986 @@
 #. +> trunk stable
 #: useragentdlg.ui:102
-msgid "Includes your operating system's version number in the browser identification text."
-msgstr "Ovdje odabirete dodavanje <code>inačice vašeg operacijskog sustava</code> u uobičajenu identifikacijsku poruku."
+msgid ""
+"Includes your operating system's version number in the browser identification "
+"text."
+msgstr ""
+"Ovdje odabirete dodavanje <code>inačice vašeg operacijskog sustava</code> u "
+"uobičajenu identifikacijsku poruku."
 
 #. i18n: ectx: property (text), widget (QCheckBox, osVersionCheckBox)
@@ -1542 +2014 @@
 #. +> trunk stable
 #: useragentdlg.ui:127
-msgid "Includes your language settings in the browser identification text to obtain localized versions of the page."
-msgstr "Uključuje vaše jezične postavke u identifikacijskom tekstu preglednika kako bi se dohvatila lokalizirana verzija stranice."
+msgid ""
+"Includes your language settings in the browser identification text to obtain "
+"localized versions of the page."
+msgstr ""
+"Uključuje vaše jezične postavke u identifikacijskom tekstu preglednika kako "
+"bi se dohvatila lokalizirana verzija stranice."
 
 #. i18n: ectx: property (text), widget (QCheckBox, languageCheckBox)
@@ -1611 +2087 @@
 msgid ""
 "<qt>\n"
-"Enter the site or domain name where a fake browser identification should be used.<p>\n"
-"<u>NOTE:</u> Wildcard syntax such as \\\"*,?\\\" is NOT allowed: instead, use the top level address of a site to make generic matches; for example, if you want all KDE sites to receive a fake browser identification, you would enter <code>kde.org</code> - the fake identity would then be sent to any KDE site that ends with <code>kde.org</code>.</p>\n"
-"</qt>"
-msgstr ""
-"<qt>\n"
-"Unesite web stranicu ili domenu gdje bi treba biti korištena laşna identifikacija pretraşivača. <p>\n"
-"<u>NAPOMENA:</u>ViÅ¡eznačna sintaksa poput \\\"*, ?\\\" NIJE dozvoljena: umjesto toga, koristite gornji nivo adrese web stranice da biste dobili općenite podudarnosti; na primjer, ako ÅŸelite da sve KDE stranice dobe laÅŸnu identifikaciju preglednika, unijeli biste <code>.kde.org</code> – laÅŸni identitet će tada biti poslan svim stranicama čija adresa zavrÅ¡ava na <code>kde.org</code>.\n"
+"Enter the site or domain name where a fake browser identification should be "
+"used.<p>\n"
+"<u>NOTE:</u> Wildcard syntax such as \\\"*,?\\\" is NOT allowed: instead, use "
+"the top level address of a site to make generic matches; for example, if you "
+"want all KDE sites to receive a fake browser identification, you would enter "
+"<code>kde.org</code> - the fake identity would then be sent to any KDE site "
+"that ends with <code>kde.org</code>.</p>\n"
+"</qt>"
+msgstr ""
+"<qt>\n"
+"Unesite web stranicu ili domenu gdje bi treba biti korištena laşna "
+"identifikacija pretraşivača. <p>\n"
+"<u>NAPOMENA:</u>Višeznačna sintaksa poput \\\"*, ?\\\" NIJE dozvoljena: "
+"umjesto toga, koristite gornji nivo adrese web stranice da biste dobili "
+"općenite podudarnosti; na primjer, ako ÅŸelite da sve KDE stranice dobe laÅŸnu "
+"identifikaciju preglednika, unijeli biste <code>.kde.org</code> – laÅŸni "
+"identitet će tada biti poslan svim stranicama čija adresa završava na <code>"
+"kde.org</code>.\n"
 "</qt>"
 
@@ -1632 +2119 @@
 msgid ""
 "<qt>\n"
-"Select the browser identification to use whenever contacting the site you specified above.\n"
-"</qt>"
-msgstr ""
-"<qt>\n"
-"Odaberite identifikaciju preglednika koju ćete koristiti kad pristupate stranicama navedenim gore.\n"
+"Select the browser identification to use whenever contacting the site you "
+"specified above.\n"
+"</qt>"
+msgstr ""
+"<qt>\n"
+"Odaberite identifikaciju preglednika koju ćete koristiti kad pristupate "
+"stranicama navedenim gore.\n"
 "</qt>"
 
@@ -1651 +2140 @@
 msgid ""
 "<qt>\n"
-"The actual browser identification text that will be sent to the remote machine.\n"
-"</qt>"
-msgstr ""
-"<qt>\n"
-"Stvarni tekst identifikacije preglednika koji će biti poslan udaljenom računalu.\n"
+"The actual browser identification text that will be sent to the remote "
+"machine.\n"
+"</qt>"
+msgstr ""
+"<qt>\n"
+"Stvarni tekst identifikacije preglednika koji će biti poslan udaljenom "
+"računalu.\n"
 "</qt>"
 

kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmkonq.po

@@ -5 +5 @@
 # Andrej Dundovic <adundovi@gmail.com>, 2009.
 # Marko Dimjasevic <marko@dimjasevic.net>, 2011.
+# Marko Dimjašević <marko@dimjasevic.net>, 2011.
 msgid ""
 msgstr ""
@@ -10 +11 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-07-08 10:22+0200\n"
-"PO-Revision-Date: 2011-03-04 19:03+0100\n"
-"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
+"PO-Revision-Date: 2011-07-12 16:54+0200\n"
+"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
 "MIME-Version: 1.0\n"
@@ -17 +18 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Language: hr\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
 "X-Generator: Lokalize 1.2\n"
 "X-Environment: kde\n"
@@ -25 +27 @@
 #. +> trunk stable
 #: behaviour.cpp:45
-msgid "<h1>Konqueror Behavior</h1> You can configure how Konqueror behaves as a file manager here."
-msgstr "<h1>Ponašanje Konquerora</h1>Ovdje moşete podesiti ponašanje Konquerora kao upravitelja datoteka. "
+msgid ""
+"<h1>Konqueror Behavior</h1> You can configure how Konqueror behaves as a file "
+"manager here."
+msgstr ""
+"<h1>Ponašanje Konquerora</h1>Ovdje moşete podesiti ponašanje Konquerora kao "
+"upravitelja datoteka. "
 
 #. +> trunk stable
@@ -40 +46 @@
 #. +> trunk stable
 #: behaviour.cpp:59
-msgid "If this option is checked, Konqueror will open a new window when you open a folder, rather than showing that folder's contents in the current window."
-msgstr "Ako je ovo odabrano, Konqueror će otvoriti direktorij koji otvorite i pokazati ga u novom prozoru, umjesto da pokaÅŸe sadrÅŸaj direktorija u trenutnom prozoru."
+msgid ""
+"If this option is checked, Konqueror will open a new window when you open a "
+"folder, rather than showing that folder's contents in the current window."
+msgstr ""
+"Ako je ovo odabrano, Konqueror će otvoriti direktorij koji otvorite i "
+"pokazati ga u novom prozoru, umjesto da pokaÅŸe sadrÅŸaj direktorija u "
+"trenutnom prozoru."
 
 #. +> trunk stable
@@ -52 +63 @@
 #, fuzzy
 #| msgid "Check this if you want 'Delete' menu commands to be displayed on the desktop and in the file manager's context menus. You can always delete files by holding the Shift key while calling 'Move to Trash'."
-msgid "Check this if you want 'Delete' menu commands to be displayed on the desktop and in the file manager's menus and context menus. You can always delete files by holding the Shift key while calling 'Move to Trash'."
-msgstr "Uključite ovo ako ÅŸelite da naredbe brisanja budu prikazane na radnoj povrÅ¡ini i u kontekstnim izbornicima upravitelja daotekama. Uvijek moÅŸete izbrisati datoteke tako da drÅŸite tipku Shift dok pozivate naredbu 'Baci u smeće'."
+msgid ""
+"Check this if you want 'Delete' menu commands to be displayed on the desktop "
+"and in the file manager's menus and context menus. You can always delete "
+"files by holding the Shift key while calling 'Move to Trash'."
+msgstr ""
+"Uključite ovo ako şelite da naredbe brisanja budu prikazane na radnoj "
+"površini i u kontekstnim izbornicima upravitelja daotekama. Uvijek moşete "
+"izbrisati datoteke tako da drÅŸite tipku Shift dok pozivate naredbu 'Baci u "
+"smeće'."
 
 #. +> trunk stable
 #: kcustommenueditor.cpp:96
-#, fuzzy
 #| msgid "Menu Editor"
 msgctxt "@title:window"

kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmkwincompositing.po

@@ -10 +10 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-07-08 10:22+0200\n"
-"PO-Revision-Date: 2011-05-04 21:53+0200\n"
+"PO-Revision-Date: 2011-07-12 16:57+0200\n"
 "Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
@@ -17 +17 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Language: hr\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
 "X-Generator: Lokalize 1.2\n"
 "X-Environment: kde\n"
@@ -101 +102 @@
 #: main.cpp:213
 msgid ""
-"Failed to activate desktop effects using the given configuration options. Settings will be reverted to their previous values.\n"
-"\n"
-"Check your X configuration. You may also consider changing advanced options, especially changing the compositing type."
-msgstr ""
-"Ne mogu aktivirati efekte radne površine sa zadanim konfiguracijskim opcijama. Postavke će biti vraćene na stare vrijednosti.\n"
-"\n"
-"Provjerite vaÅ¡u X konfiguraciju. Također moÅŸete razmotriti izmjenu naprednih opcija, posebno promjenu tipa 3D efekata."
+"Failed to activate desktop effects using the given configuration options. "
+"Settings will be reverted to their previous values.\n"
+"\n"
+"Check your X configuration. You may also consider changing advanced options, "
+"especially changing the compositing type."
+msgstr ""
+"Ne mogu aktivirati efekte radne površine sa zadanim konfiguracijskim opcijama."
+" Postavke će biti vraćene na stare vrijednosti.\n"
+"\n"
+"Provjerite vaÅ¡u X konfiguraciju. Također moÅŸete razmotriti izmjenu naprednih "
+"opcija, posebno promjenu tipa 3D efekata."
 
 #. +> trunk stable
@@ -151 +156 @@
 #. +> trunk stable
 #: main.cpp:417
-msgid "Desktop effects are not available on this system due to the following technical issues:"
-msgstr "3D efekti nisu dostupni na ovom sustavu zbog sljedećih tehničkih predmeta:"
+msgid ""
+"Desktop effects are not available on this system due to the following "
+"technical issues:"
+msgstr ""
+"3D efekti nisu dostupni na ovom sustavu zbog sljedećih tehničkih predmeta:"
 
 #. +> trunk stable
 #: main.cpp:630
 msgid ""
-"Your settings have been saved but as KDE is currently running in failsafe mode desktop effects cannot be enabled at this time.\n"
+"Your settings have been saved but as KDE is currently running in failsafe "
+"mode desktop effects cannot be enabled at this time.\n"
 "\n"
 "Please exit failsafe mode to enable desktop effects."
 msgstr ""
-"Vaše postavke biti će spremljene ali kako KDE trenutno radi u sigurnosnom načinu, efekti radne površine ne mogu biti omogućeni u ovom trenutku.\n"
+"Vaše postavke biti će spremljene ali kako KDE trenutno radi u sigurnosnom "
+"načinu, efekti radne površine ne mogu biti omogućeni u ovom trenutku.\n"
 "\n"
 "Molim vas da izađite iz sigurnosnog načina rada kako bi ste omogućili efekte."
@@ -184 +194 @@
 #. +> trunk stable
 #: main.ui:82
-#, fuzzy
 msgid "Pressing this button can crash the desktop."
-msgstr "Pritnisnite gumb za brisanje osjetila."
+msgstr "Pritiskanje ovog gumba moşe uzrokovati rušenje radne površine."
 
 #. i18n: ectx: property (text), widget (QCheckBox, rearmSafetyCheck)
@@ -192 +201 @@
 #: main.ui:105
 msgid "I have saved my data."
-msgstr ""
+msgstr "Spremio sam svoje podatke."
 
 #. i18n: ectx: property (text), widget (QPushButton, rearmGlSupportButton)
 #. +> trunk stable
 #: main.ui:128
-#, fuzzy
 msgid "Re-enable OpenGL detection"
-msgstr "Omogući otkrivanje mrtvog istorazinca"
+msgstr "Ponovno omogući otkrivanje OpenGL-a"
 
 #. i18n: ectx: property (title), widget (QGroupBox, groupBox_2)
@@ -218 +226 @@
 #: main.ui:199
 msgid "Desktop effects can be toggled anytime using this shortcut:"
-msgstr "Efekti radne povrÅ¡ine moÅŸete bilo kada uključiti i isključiti koristeći ovaj prečac:"
+msgstr ""
+"Efekti radne povrÅ¡ine moÅŸete bilo kada uključiti i isključiti koristeći ovaj "
+"prečac:"
 
 #. i18n: ectx: property (title), widget (QGroupBox, groupBox)
@@ -301 +311 @@
 #. +> trunk stable
 #: main.ui:418
-msgid "You can find more effects, as well as effect-specific settings, in the \"All Effects\" tab above."
-msgstr "MoÅŸete pronaći joÅ¡ efekata, kao i postavke vezane uz efekte u \"Svi efekti\" kartici iznad."
+msgid ""
+"You can find more effects, as well as effect-specific settings, in the \"All "
+"Effects\" tab above."
+msgstr ""
+"MoÅŸete pronaći joÅ¡ efekata, kao i postavke vezane uz efekte u \"Svi efekti\" "
+"kartici iznad."
 
 #. i18n: ectx: attribute (title), widget (QWidget, tab_2)
@@ -313 +327 @@
 #. +> trunk stable
 #: main.ui:472
-msgid "Hint: To find out or configure how to activate an effect, look at the effect's settings."
-msgstr "Savjet: Za pronaći gdje ili kako konfigurirati, odnosno aktivirati efekt, pogledajte na postavke efekta."
+msgid ""
+"Hint: To find out or configure how to activate an effect, look at the "
+"effect's settings."
+msgstr ""
+"Savjet: Za pronaći gdje ili kako konfigurirati, odnosno aktivirati efekt, "
+"pogledajte na postavke efekta."
 
 #. i18n: ectx: attribute (title), widget (QWidget, tab_4)
@@ -361 +379 @@
 #. +> trunk stable
 #: main.ui:615
-msgctxt "A window thumbnail requires to have the corresponding window mapped. To have thumbnails at all time, windows are not unmapped. This can break window minimization as it is modelled as unmapping of windows."
+msgctxt ""
+"A window thumbnail requires to have the corresponding window mapped. To have "
+"thumbnails at all time, windows are not unmapped. This can break window "
+"minimization as it is modelled as unmapping of windows."
 msgid "Always (Breaks minimization)"
 msgstr "Uvijek (uništava minimizaciju)"
@@ -368 +389 @@
 #. +> trunk stable
 #: main.ui:620
-msgctxt "Windows are not unmapped if the window is somewhere visible on any of the virtual desktops."
+msgctxt ""
+"Windows are not unmapped if the window is somewhere visible on any of the "
+"virtual desktops."
 msgid "Only for Shown Windows"
 msgstr "Samo za prikazane prozore"
@@ -375 +398 @@
 #. +> trunk stable
 #: main.ui:625
-msgctxt "Windows are unmapped as they are requested. This can lead to not having updated thumbnials for windows on other desktops."
+msgctxt ""
+"Windows are unmapped as they are requested. This can lead to not having "
+"updated thumbnials for windows on other desktops."
 msgid "Never"
 msgstr "Nikada"
@@ -389 +414 @@
 #: main.ui:666
 msgid ""
-"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n"
-"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n"
+"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3."
+"org/TR/REC-html40/strict.dtd\">\n"
+"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">"
+"\n"
 "p, li { white-space: pre-wrap; }\n"
-"</style></head><body style=\" font-family:'Segoe'; font-size:8pt; font-weight:400; font-style:normal;\">\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Crisp:</span></p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">XRenderSetPictureFilter(\"fast\")</span> -  Pretty fast on all GPUs but looks bricky</p>\n"
-"<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Smooth:</span></p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">XRenderSetPictureFilter(\"good\") </span>- linear blending.</p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Fast enough on newer nvidia GPUs and maybe others but also can be <span style=\" text-decoration: underline;\">very</span> slow, you will have to try it.</p></body></html>"
-msgstr ""
-"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n"
-"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n"
+"</style></head><body style=\" font-family:'Segoe'; font-size:8pt; "
+"font-weight:400; font-style:normal;\">\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
+"font-weight:600;\">Crisp:</span></p>\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
+"font-style:italic;\">XRenderSetPictureFilter(\"fast\")</span> -  Pretty fast "
+"on all GPUs but looks bricky</p>\n"
+"<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; "
+"margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>"
+"\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
+"font-weight:600;\">Smooth:</span></p>\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
+"font-style:italic;\">XRenderSetPictureFilter(\"good\") </span>- linear "
+"blending.</p>\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Fast enough on newer "
+"nvidia GPUs and maybe others but also can be <span style=\" text-decoration: "
+"underline;\">very</span> slow, you will have to try it.</p></body></html>"
+msgstr ""
+"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3."
+"org/TR/REC-html40/strict.dtd\">\n"
+"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">"
+"\n"
 "p, li { white-space: pre-wrap; }\n"
-"</style></head><body style=\" font-family:'Segoe'; font-size:8pt; font-weight:400; font-style:normal;\">\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Krto:</span></p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">XRenderSetPictureFilter(\"fast\")</span> –  Poprilično brzo na svim GPU-ovima, no izgleda kockasto</p>\n"
-"<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Uglađeno:</span></p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">XRenderSetPictureFilter(\"good\") </span>- linearno stapanje.</p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Dovoljno brzo na novijim nvidijinim GPU-ovima i moÅŸda i na ostali, no također moÅŸe biti <span style=\" text-decoration: underline;\">vrlo</span> sporo; morat ćete isprobati.</p></body></html>"
+"</style></head><body style=\" font-family:'Segoe'; font-size:8pt; "
+"font-weight:400; font-style:normal;\">\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
+"font-weight:600;\">Krto:</span></p>\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
+"font-style:italic;\">XRenderSetPictureFilter(\"fast\")</span> –  Poprilično "
+"brzo na svim GPU-ovima, no izgleda kockasto</p>\n"
+"<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; "
+"margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>"
+"\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
+"font-weight:600;\">Uglađeno:</span></p>\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
+"font-style:italic;\">XRenderSetPictureFilter(\"good\") </span>- linearno "
+"stapanje.</p>\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Dovoljno brzo na "
+"novijim nvidijinim GPU-ovima i moÅŸda i na ostali, no također moÅŸe biti <span "
+"style=\" text-decoration: underline;\">vrlo</span> sporo; morat ćete "
+"isprobati.</p></body></html>"
 
 #. i18n: ectx: property (text), item, widget (QComboBox, xrScaleFilter)
@@ -428 +490 @@
 #: main.ui:699
 msgid ""
-"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n"
-"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n"
+"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3."
+"org/TR/REC-html40/strict.dtd\">\n"
+"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">"
+"\n"
 "p, li { white-space: pre-wrap; }\n"
-"</style></head><body style=\" font-family:'Segoe'; font-size:8pt; font-weight:400; font-style:normal;\">\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Crisp:</span></p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">GL_NEAREST</span> -  (very) fast on all GPUs but looks bricky</p>\n"
-"<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Smooth:</span></p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">GL_LINEAR</span> - fast on most GPUs but a little blurry</p>\n"
-"<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Accurate:</span></p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Lanczos filter, requires shader support (glsl or arb).</p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Might be slow on weaker GPUs and even cause various troubles with broken drivers (from overbrightening to segfaults.)</p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Fall back to \"Smooth\" if you have problems.</p></body></html>"
-msgstr ""
-"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n"
-"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n"
+"</style></head><body style=\" font-family:'Segoe'; font-size:8pt; "
+"font-weight:400; font-style:normal;\">\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
+"font-weight:600;\">Crisp:</span></p>\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
+"font-style:italic;\">GL_NEAREST</span> -  (very) fast on all GPUs but looks "
+"bricky</p>\n"
+"<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; "
+"margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>"
+"\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
+"font-weight:600;\">Smooth:</span></p>\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
+"font-style:italic;\">GL_LINEAR</span> - fast on most GPUs but a little "
+"blurry</p>\n"
+"<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; "
+"margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>"
+"\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
+"font-weight:600;\">Accurate:</span></p>\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Lanczos filter, "
+"requires shader support (glsl or arb).</p>\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Might be slow on "
+"weaker GPUs and even cause various troubles with broken drivers (from "
+"overbrightening to segfaults.)</p>\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Fall back to "
+"\"Smooth\" if you have problems.</p></body></html>"
+msgstr ""
+"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3."
+"org/TR/REC-html40/strict.dtd\">\n"
+"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">"
+"\n"
 "p, li { white-space: pre-wrap; }\n"
-"</style></head><body style=\" font-family:'Segoe'; font-size:8pt; font-weight:400; font-style:normal;\">\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Kruto:</span></p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">GL_NEAREST</span> –  (poprilično) brzo na svim GPU-ovima, no izgleda kockasto</p>\n"
-"<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Uglađeno:</span></p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">GL_LINEAR</span> – brzo na većini GPU-ova, no malo je zamagljeno</p>\n"
-"<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Precizno:</span></p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Filtar Lanczos, treba podršku za sjenčanje (glsl ili arb).</p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Moşe biti sporo na slabijim GPU-ovima ili čak uzrokovati razne probleme s nevaljalim upravljačkim programima (od prejakog osvjetljenja do \"segfaultova\".)</p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Vratite na \"Uglađeno\" ako imate problema.</p></body></html>"
+"</style></head><body style=\" font-family:'Segoe'; font-size:8pt; "
+"font-weight:400; font-style:normal;\">\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
+"font-weight:600;\">Kruto:</span></p>\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
+"font-style:italic;\">GL_NEAREST</span> –  (poprilično) brzo na svim "
+"GPU-ovima, no izgleda kockasto</p>\n"
+"<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; "
+"margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>"
+"\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
+"font-weight:600;\">Uglađeno:</span></p>\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
+"font-style:italic;\">GL_LINEAR</span> – brzo na većini GPU-ova, no malo je "
+"zamagljeno</p>\n"
+"<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; "
+"margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>"
+"\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
+"font-weight:600;\">Precizno:</span></p>\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Filtar Lanczos, "
+"treba podršku za sjenčanje (glsl ili arb).</p>\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">MoÅŸe biti sporo na "
+"slabijim GPU-ovima ili čak uzrokovati razne probleme s nevaljalim "
+"upravljačkim programima (od prejakog osvjetljenja do \"segfaultova\".)</p>\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Vratite na "
+"\"Uglađeno\" ako imate problema.</p></body></html>"
 
 #. i18n: ectx: property (text), item, widget (QComboBox, glScaleFilter)
@@ -474 +588 @@
 #: main.ui:726
 msgid "Suspend desktop effects for fullscreen windows"
-msgstr "Obustavi efekte radne površine za prozore rastegnute preko cijelog zaslona"
+msgstr ""
+"Obustavi efekte radne površine za prozore rastegnute preko cijelog zaslona"
 
 #. i18n: ectx: property (title), widget (QGroupBox, glGroup)
@@ -498 +613 @@
 #: main.ui:798
 msgid ""
-"If enabled all rendering will be performed with Shaders written in the OpenGL Shading Language.\n"
+"If enabled all rendering will be performed with Shaders written in the OpenGL "
+"Shading Language.\n"
 "On legacy hardware disabling Shaders can improve the performance."
 msgstr ""
-"Ako je omogućeno, svo iscrtavanje će se izvršiti uz Sjenčanje napisano u OpenGL-ovom jeziku za sjenčanje.\n"
+"Ako je omogućeno, svo iscrtavanje će se izvršiti uz Sjenčanje napisano u "
+"OpenGL-ovom jeziku za sjenčanje.\n"
 " Na starom hardveru onemogućavanje Sjenčanja moÅŸe poboljÅ¡ati performanse."
 

kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmkwinrules.po

@@ -7 +7 @@
 # Andrej Dundović <adundovi@gmail.com>, 2009.
 # Andrej Dundovic <adundovi@gmail.com>, 2010.
+# Marko Dimjašević <marko@dimjasevic.net>, 2011.
 msgid ""
 msgstr ""
@@ -12 +13 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-07-08 10:22+0200\n"
-"PO-Revision-Date: 2011-03-04 19:01+0100\n"
-"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
+"PO-Revision-Date: 2011-07-12 17:36+0200\n"
+"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
 "MIME-Version: 1.0\n"
@@ -19 +20 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Language: hr\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
 "X-Generator: Lokalize 1.2\n"
 "X-Environment: kde\n"
@@ -28 +30 @@
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
-msgstr "Renato Pavičić, Åœarko Pintar"
+msgstr "Renato Pavičić, Åœarko Pintar, Marko DimjaÅ¡ević"
 
 #. +> trunk stable
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr "renato@translator-shop.org, zarko.pintar@gmail.com"
+msgstr ""
+"renato@translator-shop.org, zarko.pintar@gmail.com, marko@dimjasevic.net"
 
 #. i18n: ectx: property (text), item, widget (QListWidget, types)
@@ -155 +158 @@
 #. +> trunk stable
 #: detectwidget.ui:175
-#, fuzzy
 msgid "Match Strategy"
-msgstr "Taktika i strategija"
+msgstr "Strategija podudaranja"
 
 #. i18n: ectx: property (whatsThis), widget (QRadioButton, use_class)
 #. +> trunk stable
 #: detectwidget.ui:184
-msgid "For selecting all windows belonging to a specific application, selecting only window class should usually work."
-msgstr "Za odabir svih prozora koji pripadaju određenoj aplikaciji, dovoljno je odabrati samo klasu porozora."
+msgid ""
+"For selecting all windows belonging to a specific application, selecting only "
+"window class should usually work."
+msgstr ""
+"Za odabir svih prozora koji pripadaju određenoj aplikaciji, dovoljno je "
+"odabrati samo klasu porozora."
 
 #. i18n: ectx: property (text), widget (QRadioButton, use_class)
@@ -174 +180 @@
 #. +> trunk stable
 #: detectwidget.ui:197
-msgid "For selecting a specific window in an application, both window class and window role should be selected. Window class will determine the application, and window role the specific window in the application; many applications do not provide useful window roles though."
-msgstr "Za odabir određenog prozora unutar aplikacije, i klasa prozora i uloga se trebaju označiti. Klasa prozora će odrediti aplikaciju, a uloga prozora određeni prozor unutar aplikacije; iako mnoge aplikacije ne pruÅŸaju korisne informacije kroz prozorske uloge. "
+msgid ""
+"For selecting a specific window in an application, both window class and "
+"window role should be selected. Window class will determine the application, "
+"and window role the specific window in the application; many applications do "
+"not provide useful window roles though."
+msgstr ""
+"Za odabir određenog prozora unutar aplikacije, i klasa prozora i uloga se "
+"trebaju označiti. Klasa prozora će odrediti aplikaciju, a uloga prozora "
+"određeni prozor unutar aplikacije; iako mnoge aplikacije ne pruÅŸaju korisne "
+"informacije kroz prozorske uloge. "
 
 #. i18n: ectx: property (text), widget (QRadioButton, use_role)
@@ -186 +200 @@
 #. +> trunk stable
 #: detectwidget.ui:207
-msgid "With some (non-KDE) applications whole window class can be sufficient for selecting a specific window in an application, as they set whole window class to contain both application and window role."
-msgstr "Za neke (ne-KDE) aplikacije cijela klasa prozora moÅŸe biti dovoljna za odabir određenog prozora u aplikaciji, kako je podeÅ¡eno da cijela klasa prozora sadrÅŸi i ulogu aplikacije i prozora."
+msgid ""
+"With some (non-KDE) applications whole window class can be sufficient for "
+"selecting a specific window in an application, as they set whole window class "
+"to contain both application and window role."
+msgstr ""
+"Za neke (ne-KDE) aplikacije cijela klasa prozora moÅŸe biti dovoljna za odabir "
+"određenog prozora u aplikaciji, kako je podešeno da cijela klasa prozora "
+"sadrÅŸi i ulogu aplikacije i prozora."
 
 #. i18n: ectx: property (text), widget (QRadioButton, use_whole_class)
@@ -205 +225 @@
 #: editshortcut.ui:18
 msgid ""
-"A single shortcut can be easily assigned or cleared using the two buttons. Only shortcuts with modifiers can be used.<p>\n"
-"It is possible to have several possible shortcuts, and the first available shortcut will be used. The shortcuts are specified using space-separated shortcut sets. One set is specified as <i>base</i>+(<i>list</i>), where base are modifiers and list is a list of keys.<br>\n"
-"For example \"<b>Shift+Alt+(123) Shift+Ctrl+(ABC)</b>\" will first try <b>Shift+Alt+1</b>, then others with <b>Shift+Ctrl+C</b> as the last one."
-msgstr ""
-"Pojedini prečac moÅŸe se jednostavno pridruÅŸiti ili izbrisati koristeći dva gumba. Mogu se koristit samo prečaci sa modifikatorima.<p>\n"
-"Moguće je imati nekoliko prečaca, a koristiti prvi slobodni prečac. Prečaci koriste posebni razmakno-separatorski skup. Jedan skup je određen kao <i>base</i>+(<i>list</i>), gdje su 'base' modifikatori, a 'list' lista tipki.<br>\n"
-"Na primjer \"<b>Shift+Alt+(123) Shift+Ctrl+(ABC)</b>\" će prvo pokušati <b>Shift+Alt+1</b>, a tada ostale sa <b>Shift+Ctrl+C</b> kao zadnjim."
+"A single shortcut can be easily assigned or cleared using the two buttons. "
+"Only shortcuts with modifiers can be used.<p>\n"
+"It is possible to have several possible shortcuts, and the first available "
+"shortcut will be used. The shortcuts are specified using space-separated "
+"shortcut sets. One set is specified as <i>base</i>+(<i>list</i>), where base "
+"are modifiers and list is a list of keys.<br>\n"
+"For example \"<b>Shift+Alt+(123) Shift+Ctrl+(ABC)</b>\" will first try <b>"
+"Shift+Alt+1</b>, then others with <b>Shift+Ctrl+C</b> as the last one."
+msgstr ""
+"Pojedini prečac moÅŸe se jednostavno pridruÅŸiti ili izbrisati koristeći dva "
+"gumba. Mogu se koristit samo prečaci sa modifikatorima.<p>\n"
+"Moguće je imati nekoliko prečaca, a koristiti prvi slobodni prečac. Prečaci "
+"koriste posebni razmakno-separatorski skup. Jedan skup je određen kao <i>"
+"base</i>+(<i>list</i>), gdje su 'base' modifikatori, a 'list' lista tipki.<br>"
+"\n"
+"Na primjer \"<b>Shift+Alt+(123) Shift+Ctrl+(ABC)</b>\" će prvo pokušati <b>"
+"Shift+Alt+1</b>, a tada ostale sa <b>Shift+Ctrl+C</b> kao zadnjim."
 
 #. i18n: ectx: property (text), widget (QPushButton, pushButton1)
@@ -247 +277 @@
 #. +> trunk stable
 #: kcm.cpp:86
-msgid "<p><h1>Window-specific Settings</h1> Here you can customize window settings specifically only for some windows.</p> <p>Please note that this configuration will not take effect if you do not use KWin as your window manager. If you do use a different window manager, please refer to its documentation for how to customize window behavior.</p>"
-msgstr "<p><h1>Prozorski-posebne postavke</h1> Ovdje moşete prilagoditi postavke prozora posebno za neki prozor.</p> <p>Imajte na umu da ova konfiguracija nema efekta ako ne koristite KWin kao vaš upravitelj prozorima. Ako koristite drugi upravitelj prozorima, onda konzultirajte njegovu dokumentaciju kako prilagoditi ponašanje prozora</p>"
+msgid ""
+"<p><h1>Window-specific Settings</h1> Here you can customize window settings "
+"specifically only for some windows.</p> <p>Please note that this "
+"configuration will not take effect if you do not use KWin as your window "
+"manager. If you do use a different window manager, please refer to its "
+"documentation for how to customize window behavior.</p>"
+msgstr ""
+"<p><h1>Prozorski-posebne postavke</h1> Ovdje moÅŸete prilagoditi postavke "
+"prozora posebno za neki prozor.</p> <p>Imajte na umu da ova konfiguracija "
+"nema efekta ako ne koristite KWin kao vaš upravitelj prozorima. Ako koristite "
+"drugi upravitelj prozorima, onda konzultirajte njegovu dokumentaciju kako "
+"prilagoditi ponašanje prozora</p>"
 
 #. +> trunk stable
@@ -304 +344 @@
 #. +> trunk stable
 #: ruleslist.cpp:155
-#, fuzzy
 msgid "Export Rule"
-msgstr "Izvezi rutu"
+msgstr "Izvezi pravilo"
 
 #. +> trunk stable
 #: ruleslist.cpp:166
-#, fuzzy
 msgid "Import Rules"
-msgstr "Stil ruba okvira"
+msgstr "Uvezi pravila"
 
 #. i18n: ectx: property (text), widget (KPushButton, new_button)
@@ -347 +385 @@
 #. +> trunk stable
 #: ruleslist.ui:91
-#, fuzzy
 msgid "&Import"
 msgstr "&Uvoz"
@@ -354 +391 @@
 #. +> trunk stable
 #: ruleslist.ui:98
-#, fuzzy
 msgid "&Export"
 msgstr "&Izvoz"
@@ -360 +396 @@
 #. +> trunk stable
 #: ruleswidget.cpp:57
-msgid "Enable this checkbox to alter this window property for the specified window(s)."
-msgstr "Omogući ovaj odabirni okvir kako bi promijenili svojstva određenih prozora sa svojstvima ovog prozora."
+msgid ""
+"Enable this checkbox to alter this window property for the specified "
+"window(s)."
+msgstr ""
+"Omogući ovaj odabirni okvir kako bi promijenili svojstva određenih prozora sa "
+"svojstvima ovog prozora."
 
 #. +> trunk stable
 #: ruleswidget.cpp:59
-msgid "Specify how the window property should be affected:<ul><li><em>Do Not Affect:</em> The window property will not be affected and therefore the default handling for it will be used. Specifying this will block more generic window settings from taking effect.</li><li><em>Apply Initially:</em> The window property will be only set to the given value after the window is created. No further changes will be affected.</li><li><em>Remember:</em> The value of the window property will be remembered and every time time the window is created, the last remembered value will be applied.</li><li><em>Force:</em> The window property will be always forced to the given value.</li><li><em>Apply Now:</em> The window property will be set to the given value immediately and will not be affected later (this action will be deleted afterwards).</li><li><em>Force temporarily:</em> The window property will be forced to the given value until it is hidden (this action will be deleted after the window is hidden).</li></ul>"
-msgstr "Odredite kakav će imati utjecaj prozorske osobitosti:<ul><li><em>Bez utjecaja:</em> Prozorske osobitosti neće imati utjecaja i biti će korišteno zadano rukovanje. Ovo će blokirati mnoge općenite postavke prozora.</li><li><em>Primijeni na početku:</em> Prozorske osobitosti će biti postavljene na određenu vrijednost samo pri stvaranju prozora. Buduće promjene neće imati utjecaja.</li><li><em>Zapamti:</em> Vrijednost prozorske osobitosti biti će zapamćena i svaki puta kada se prozor stvori, biti će primjenjena zadnja zapamćena vrijednost.</li><li><em>Prisilno:</em> Prozorska osobitost biti će uvijek prisilno postavljena na zadanu vrijednost.</li><li><em>Primjeni sada:</em> Prozorska osobitost biti će odmah postavljena na zadanu vrijednost i neće imati utjecaja kasnije (akcija će biti izbrisana).</li><li><em>Privremeno prisilno:</em> Prozorska osobitost biti će prisilno postavljena na zadanu vrijednost sve dok nije sakrivena (ova akcija biti će izbrisana nakon što se prozor sakrije).</li></ul>"
+msgid ""
+"Specify how the window property should be affected:<ul><li><em>Do Not "
+"Affect:</em> The window property will not be affected and therefore the "
+"default handling for it will be used. Specifying this will block more generic "
+"window settings from taking effect.</li><li><em>Apply Initially:</em> The "
+"window property will be only set to the given value after the window is "
+"created. No further changes will be affected.</li><li><em>Remember:</em> The "
+"value of the window property will be remembered and every time time the "
+"window is created, the last remembered value will be applied.</li><li><em>"
+"Force:</em> The window property will be always forced to the given value.</li>"
+"<li><em>Apply Now:</em> The window property will be set to the given value "
+"immediately and will not be affected later (this action will be deleted "
+"afterwards).</li><li><em>Force temporarily:</em> The window property will be "
+"forced to the given value until it is hidden (this action will be deleted "
+"after the window is hidden).</li></ul>"
+msgstr ""
+"Odredite kakav će imati utjecaj prozorske osobitosti:<ul><li><em>Bez "
+"utjecaja:</em> Prozorske osobitosti neće imati utjecaja i biti će korišteno "
+"zadano rukovanje. Ovo će blokirati mnoge općenite postavke prozora.</li><li><"
+"em>Primijeni na početku:</em> Prozorske osobitosti će biti postavljene na "
+"određenu vrijednost samo pri stvaranju prozora. Buduće promjene neće imati "
+"utjecaja.</li><li><em>Zapamti:</em> Vrijednost prozorske osobitosti biti će "
+"zapamćena i svaki puta kada se prozor stvori, biti će primjenjena zadnja "
+"zapamćena vrijednost.</li><li><em>Prisilno:</em> Prozorska osobitost biti će "
+"uvijek prisilno postavljena na zadanu vrijednost.</li><li><em>Primjeni sada:<"
+"/em> Prozorska osobitost biti će odmah postavljena na zadanu vrijednost i "
+"neće imati utjecaja kasnije (akcija će biti izbrisana).</li><li><em>"
+"Privremeno prisilno:</em> Prozorska osobitost biti će prisilno postavljena na "
+"zadanu vrijednost sve dok nije sakrivena (ova akcija biti će izbrisana nakon "
+"Å¡to se prozor sakrije).</li></ul>"
 
 #. +> trunk stable
 #: ruleswidget.cpp:74
-msgid "Specify how the window property should be affected:<ul><li><em>Do Not Affect:</em> The window property will not be affected and therefore the default handling for it will be used. Specifying this will block more generic window settings from taking effect.</li><li><em>Force:</em> The window property will be always forced to the given value.</li><li><em>Force temporarily:</em> The window property will be forced to the given value until it is hidden (this action will be deleted after the window is hidden).</li></ul>"
-msgstr "Odredite kakav će imati utjecaj prozorske osobitosti:<ul><li><em>Bez utjecaja:</em> Prozorske osobitosti neće imati utjecaja i biti će korišteno zadano rukovanje. Ovo će blokirati mnoge općenite postavke prozora.</li><li><em>Prisilno:</em> Prozorska osobitost biti će uvijek prisilno postavljena na zadanu vrijednost.</li><li><em>Privremeno prisilno:</em> Prozorska osobitost biti će prisilno postavljena na zadanu vrijednost sve dok nije sakrivena (ova akcija biti će izbrisana nakon što se prozor sakrije).</li></ul>"
+msgid ""
+"Specify how the window property should be affected:<ul><li><em>Do Not "
+"Affect:</em> The window property will not be affected and therefore the "
+"default handling for it will be used. Specifying this will block more generic "
+"window settings from taking effect.</li><li><em>Force:</em> The window "
+"property will be always forced to the given value.</li><li><em>Force "
+"temporarily:</em> The window property will be forced to the given value until "
+"it is hidden (this action will be deleted after the window is hidden).</li><"
+"/ul>"
+msgstr ""
+"Odredite kakav će imati utjecaj prozorske osobitosti:<ul><li><em>Bez "
+"utjecaja:</em> Prozorske osobitosti neće imati utjecaja i biti će korišteno "
+"zadano rukovanje. Ovo će blokirati mnoge općenite postavke prozora.</li><li><"
+"em>Prisilno:</em> Prozorska osobitost biti će uvijek prisilno postavljena na "
+"zadanu vrijednost.</li><li><em>Privremeno prisilno:</em> Prozorska osobitost "
+"biti će prisilno postavljena na zadanu vrijednost sve dok nije sakrivena (ova "
+"akcija biti će izbrisana nakon što se prozor sakrije).</li></ul>"
 
 #. +> trunk stable
@@ -396 +479 @@
 msgid ""
 "You have specified the window class as unimportant.\n"
-"This means the settings will possibly apply to windows from all applications. If you really want to create a generic setting, it is recommended you at least limit the window types to avoid special window types."
+"This means the settings will possibly apply to windows from all applications. "
+"If you really want to create a generic setting, it is recommended you at "
+"least limit the window types to avoid special window types."
 msgstr ""
 "Odredili ste klasu prozora kao nevaÅŸnu.\n"
-"To znači da je moguće da će se primjeniti postavke prozora iz svih aplikacija. Ako zaista ÅŸelite stvoriti općenite postavke, preporučamo vam da barem ograničite tipove prozora kako bi izbjegli posebne tipove."
+"To znači da je moguće da će se primjeniti postavke prozora iz svih aplikacija."
+" Ako zaista ÅŸelite stvoriti općenite postavke, preporučamo vam da barem "
+"ograničite tipove prozora kako bi izbjegli posebne tipove."
 
 #. +> trunk stable
@@ -408 +495 @@
 #. +> trunk stable
 #: ruleswidget.cpp:743
-msgid "This configuration dialog allows altering settings only for the selected window or application. Find the setting you want to affect, enable the setting using the checkbox, select in what way the setting should be affected and to which value."
-msgstr "Ovaj konfiguracijski dijalog dopuÅ¡ta vam promjenu postavki samo za odabraog prozora ili aplikacije. Pronađite postavku koju ÅŸelite promijeniti, omogućite postavku preko odabirnog okvira, odredite na koji način će postavka viti primjenjena i na koju vrijednost."
+msgid ""
+"This configuration dialog allows altering settings only for the selected "
+"window or application. Find the setting you want to affect, enable the "
+"setting using the checkbox, select in what way the setting should be affected "
+"and to which value."
+msgstr ""
+"Ovaj konfiguracijski dijalog dopušta vam promjenu postavki samo za odabraog "
+"prozora ili aplikacije. Pronađite postavku koju ÅŸelite promijeniti, omogućite "
+"postavku preko odabirnog okvira, odredite na koji način će postavka viti "
+"primjenjena i na koju vrijednost."
 
 #. +> trunk stable
@@ -424 +519 @@
 #. +> trunk stable
 #: ruleswidgetbase.ui:21
-#, fuzzy
 msgid "&Window matching"
-msgstr "Prebacivanje prozora"
+msgstr "P&rozor kojem se podudara"
 
 #. i18n: ectx: property (text), widget (QLabel, textLabel1)
@@ -437 +531 @@
 #. +> trunk stable
 #: ruleswidgetbase.ui:46
-#, fuzzy
 #| msgid "Window &class (application type):"
 msgid "Window &class (application):"
-msgstr "&Klasa prozora (tip aplikacije):"
+msgstr "Klasa prozora (aplika&cija):"
 
 #. i18n: ectx: property (text), item, widget (KComboBox, wmclass_match)
@@ -536 +629 @@
 #. +> trunk stable
 #: ruleswidgetbase.ui:381
-#, fuzzy
 msgid "s delay"
-msgstr "Bez odgode"
+msgstr "s-zadrška"
 
 #. i18n: ectx: property (text), item, widget (QListWidget, types)
 #. +> trunk stable
 #: ruleswidgetbase.ui:524
-#, fuzzy
 msgid "Unmanaged Window"
-msgstr "Nije pod kontrolom upravitelja mreÅŸe"
+msgstr "Slobodan prozor"
 
 #. i18n: ectx: attribute (title), widget (QWidget, TabPage3)
 #. +> trunk stable
 #: ruleswidgetbase.ui:545
-#, fuzzy
 msgid "&Size && Position"
-msgstr "PoloÅŸaj teksta"
+msgstr "&Veličina && poloşaj"
 
 #. i18n: ectx: property (text), widget (QCheckBox, enable_position)
@@ -780 +870 @@
 #: ruleswidgetbase.ui:598
 msgid "x,y"
-msgstr ""
+msgstr "x,y"
 
 #. i18n: ectx: property (validChars), widget (KRestrictedLine, position)
@@ -803 +893 @@
 #. +> trunk stable
 #: ruleswidgetbase.ui:655 ruleswidgetbase.ui:1058 ruleswidgetbase.ui:1205
-#, fuzzy
 msgid "width,height"
-msgstr "visina"
+msgstr "Å¡irina,visina"
 
 #. i18n: ectx: property (text), widget (QCheckBox, enable_maximizehoriz)
@@ -846 +935 @@
 #. +> trunk stable
 #: ruleswidgetbase.ui:891
-#, fuzzy
 msgid "Initial p&lacement"
-msgstr "Početna količina"
+msgstr "Početni po&loşaj"
 
 #. i18n: ectx: property (text), item, widget (KComboBox, placement)
@@ -952 +1040 @@
 #. +> trunk stable
 #: ruleswidgetbase.ui:1280
-#, fuzzy
 msgid "Obey geometry restrictions"
-msgstr "Makni filter"
+msgstr "Strogo prati geometrijska ograničenja"
 
 #. i18n: ectx: attribute (title), widget (QWidget, TabPage4)
 #. +> trunk stable
 #: ruleswidgetbase.ui:1313
-#, fuzzy
 msgid "&Arrangement && Access"
-msgstr "Razmještaj"
+msgstr "R&azmještaj && pristup"
 
 #. i18n: ectx: property (text), widget (QCheckBox, enable_above)
@@ -1014 +1100 @@
 #. +> trunk stable
 #: ruleswidgetbase.ui:1606
-#, fuzzy
 msgid "Window shall (not) appear in the taskbar."
-msgstr "Prozor se neće pojaviti na traci sa zadacima"
+msgstr "Prozor se (ne) smije pojaviti u traci sa zadacima."
 
 #. i18n: ectx: property (text), widget (QCheckBox, enable_skiptaskbar)
@@ -1029 +1114 @@
 msgid "Window shall (not) appear in the manager for virtual desktops"
 msgstr ""
+"Prozor se (ne) smije pojaviti u upravitelju za virtualne radne površine"
 
 #. i18n: ectx: property (text), widget (QCheckBox, enable_skippager)
@@ -1040 +1126 @@
 #: ruleswidgetbase.ui:1707
 msgid "Window shall (not) appear in the Alt+Tab list"
-msgstr ""
+msgstr "Prozor se (ne) smije pojaviti u listi Alt+Tab"
 
 #. i18n: ectx: property (text), widget (QCheckBox, enable_skipswitcher)
@@ -1063 +1149 @@
 #. +> trunk stable
 #: ruleswidgetbase.ui:1907
-#, fuzzy
 msgid "Appearance && &Fixes"
-msgstr "Vrijeme pojavljivanja:"
+msgstr "Izgled && &popravci"
 
 #. i18n: ectx: property (text), widget (QCheckBox, enable_noborder)
 #. +> trunk stable
 #: ruleswidgetbase.ui:1913
-#, fuzzy
 msgid "&No titlebar and frame"
-msgstr "Naslovna traka i okvir"
+msgstr "Bez &naslovne trake i okvira"
 
 #. i18n: ectx: property (text), widget (QCheckBox, enable_opacityactive)
 #. +> trunk stable
 #: ruleswidgetbase.ui:1964
-#, fuzzy
 #| msgid "A&ctive opacity in %"
 msgid "A&ctive opacity"
-msgstr "A&ktivna neprozirnost u %"
+msgstr "A&ktivna neprozirnost"
 
 #. i18n: ectx: property (suffix), widget (QSpinBox, opacityactive)
@@ -1086 +1169 @@
 #. +> trunk stable
 #: ruleswidgetbase.ui:1996 ruleswidgetbase.ui:2041
-#, fuzzy, no-c-format
+#, no-c-format
 msgid "%"
 msgstr "%"
@@ -1093 +1176 @@
 #. +> trunk stable
 #: ruleswidgetbase.ui:2009
-#, fuzzy
 #| msgid "I&nactive opacity in %"
 msgid "I&nactive opacity"
-msgstr "&Neaktivna neprozirnost u %"
+msgstr "&Neaktivna neprozirnost"
 
 #. i18n: ectx: property (text), widget (QCheckBox, enable_moveresizemode)
@@ -1136 +1218 @@
 #. +> trunk stable
 #: ruleswidgetbase.ui:2148
-#, fuzzy
 #| msgid "Block global shortcuts"
 msgid "Ignore global shortcuts"
-msgstr "Blokiraj opće prečace"
+msgstr "Ignoriraj globalne prečace"
 
 #. i18n: ectx: property (text), widget (QCheckBox, enable_closeable)

kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmlocale.po

@@ -13 +13 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-07-10 07:56+0200\n"
-"PO-Revision-Date: 2011-05-03 01:03+0200\n"
+"PO-Revision-Date: 2011-07-12 17:05+0200\n"
 "Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
@@ -20 +20 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Language: hr\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
 "X-Generator: Lokalize 1.2\n"
 "X-Environment: kde\n"
@@ -29 +30 @@
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
-msgstr "Dario Lah, Denis Lackovic, Vlatko Kosturjak, Oliver Mucafir, Andrej Dundović, Marko Dimjašević"
+msgstr ""
+"Dario Lah, Denis Lackovic, Vlatko Kosturjak, Oliver Mucafir, Andrej Dundović, "
+"Marko Dimjašević"
 
 #. +> trunk stable
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr "lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, oliver.untwist@gmail.com, adundovi@gmail.com, marko@dimjasevic.net"
+msgstr ""
+"lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, oliver."
+"untwist@gmail.com, adundovi@gmail.com, marko@dimjasevic.net"
 
 #. +> trunk stable
@@ -75 +80 @@
 #: kcmlocale.cpp:462
 #, kde-format
-msgid "You have the language with code '%1' in your list of languages to use for translation but the localization files for it could not be found. The language has been removed from your configuration. If you want to add it again please install the localization files for it and add the language again."
-msgstr "U VaÅ¡oj listi jezika za prijevod imate jezik s kÃŽdom '%1', no nije moguće pronaći lokalizacijske datoteke za dotični jezik. Taj je jezik uklonjen iz VaÅ¡e konfiguracije. Ako ga ÅŸelite ponovno dodati, instalirajte lokalizacijske datoteke za taj jezik i ponovno ga dodajte."
+msgid ""
+"You have the language with code '%1' in your list of languages to use for "
+"translation but the localization files for it could not be found. The "
+"language has been removed from your configuration. If you want to add it "
+"again please install the localization files for it and add the language again."
+msgstr ""
+"U VaÅ¡oj listi jezika za prijevod imate jezik s kÃŽdom '%1', no nije moguće "
+"pronaći lokalizacijske datoteke za dotični jezik. Taj je jezik uklonjen iz "
+"Vaše konfiguracije. Ako ga şelite ponovno dodati, instalirajte lokalizacijske "
+"datoteke za taj jezik i ponovno ga dodajte."
 
 #. +> trunk stable
@@ -84 +97 @@
 "To change the language of all programs, you will have to logout first."
 msgstr ""
-"Promijenjene jezične postavke primijenjuju se samo na novo pokrenute aplikacije.\n"
+"Promijenjene jezične postavke primijenjuju se samo na novo pokrenute "
+"aplikacije.\n"
 "Ako ÅŸelite promijeniti jezik u svim programima morate se prvo odjaviti."
 
@@ -96 +110 @@
 msgid ""
 "<h1>Country/Region & Language</h1>\n"
-"<p>Here you can set your localization settings such as language, numeric formats, date and time formats, etc.  Choosing a country will load a set of default formats which you can then change to your personal preferences.  These personal preferences will remain set even if you change the country.  The reset buttons allow you to easily see where you have personal settings and to restore those items to the country's default value.</p>"
+"<p>Here you can set your localization settings such as language, numeric "
+"formats, date and time formats, etc.  Choosing a country will load a set of "
+"default formats which you can then change to your personal preferences.  "
+"These personal preferences will remain set even if you change the country.  "
+"The reset buttons allow you to easily see where you have personal settings "
+"and to restore those items to the country's default value.</p>"
 msgstr ""
 "<h1>Zemlja i jezik</h1>\n"
-"<p>Ovdje moÅŸete postaviti vaÅ¡e lokalizacijske postavke kao Å¡to su jezik, brojčani formati, formati datuma i vremena itd. Odabir zemlje će učitati skup zadanih formata koje moÅŸete prilagoditi vlastitim ÅŸeljama i one će biti zapamćene i kad promijenite zemlju. Gumbi za povratak na uobičajeno omogućuju Vam da lako uočite gdje imate prilagođene postavke i da ih vratite na zadane vrijednosti za određenu zemlju.</p>"
+"<p>Ovdje moşete postaviti vaše lokalizacijske postavke kao što su jezik, "
+"brojčani formati, formati datuma i vremena itd. Odabir zemlje će učitati skup "
+"zadanih formata koje moÅŸete prilagoditi vlastitim ÅŸeljama i one će biti "
+"zapamćene i kad promijenite zemlju. Gumbi za povratak na uobičajeno omogućuju "
+"Vam da lako uočite gdje imate prilagođene postavke i da ih vratite na zadane "
+"vrijednosti za određenu zemlju.</p>"
 
 #. +> trunk stable
@@ -233 +257 @@
 #. +> trunk stable
 #: kcmlocale.cpp:1072
-msgid "<p>This is the country where you live.  The KDE Workspace will use the settings for this country or region.</p>"
-msgstr "<p>Ovo je drÅŸava u kojoj ÅŸivite.  KDE-ov radni prostor će koristiti postavke za ovu drÅŸavu ili regiju.</p>"
+msgid ""
+"<p>This is the country where you live.  The KDE Workspace will use the "
+"settings for this country or region.</p>"
+msgstr ""
+"<p>Ovo je drÅŸava u kojoj ÅŸivite.  KDE-ov radni prostor će koristiti postavke "
+"za ovu drÅŸavu ili regiju.</p>"
 
 #. +> trunk stable
@@ -256 +284 @@
 #. +> trunk stable
 #: kcmlocale.cpp:1132
-msgid "<p>This is the country subdivision where you live, e.g. your state or province.  The KDE Workspace will use this setting for local information services such as holidays.</p>"
-msgstr "<p>Ovo je podrazred drÅŸava gdje ÅŸivite, npr. savezna drÅŸava ili pokrajina.  KDE-ov radni prostor će koristiti ove postavke za servise za lokalne informacije kao Å¡to su praznici.</p>"
+msgid ""
+"<p>This is the country subdivision where you live, e.g. your state or "
+"province.  The KDE Workspace will use this setting for local information "
+"services such as holidays.</p>"
+msgstr ""
+"<p>Ovo je podrazred drÅŸava gdje ÅŸivite, npr. savezna drÅŸava ili pokrajina.  "
+"KDE-ov radni prostor će koristiti ove postavke za servise za lokalne "
+"informacije kao Å¡to su praznici.</p>"
 
 #. i18n: ectx: property (availableLabel), widget (KActionSelector, m_selectTranslations)
@@ -267 +301 @@
 #. +> trunk stable
 #: kcmlocale.cpp:1170
-msgid "<p>This is the list of installed KDE Workspace language translations not currently being used.  To use a language translation move it to the 'Preferred Languages' list in the order of preference.  If no suitable languages are listed, then you may need to install more language packages using your usual installation method.</p>"
-msgstr "<p>Ovo je lista instaliranih prijevoda KDE-ovog radnog prostora koji se trenutno ne koriste. Kako biste koristili neki jezik, premjestite ga u listu 'Preferirani jezici' na ÅŸeljeno mjesto. Ako nije naveden ni jedan Vama prikladan jezik, moÅŸda ćete trebati instalirati dodatne jezične pakete koristeći uobičajeni instalacijski postupak.</p>"
+msgid ""
+"<p>This is the list of installed KDE Workspace language translations not "
+"currently being used.  To use a language translation move it to the "
+"'Preferred Languages' list in the order of preference.  If no suitable "
+"languages are listed, then you may need to install more language packages "
+"using your usual installation method.</p>"
+msgstr ""
+"<p>Ovo je lista instaliranih prijevoda KDE-ovog radnog prostora koji se "
+"trenutno ne koriste. Kako biste koristili neki jezik, premjestite ga u listu "
+"'Preferirani jezici' na ÅŸeljeno mjesto. Ako nije naveden ni jedan Vama "
+"prikladan jezik, moÅŸda ćete trebati instalirati dodatne jezične pakete "
+"koristeći uobičajeni instalacijski postupak.</p>"
 
 #. i18n: ectx: property (selectedLabel), widget (KActionSelector, m_selectTranslations)
@@ -278 +322 @@
 #. +> trunk stable
 #: kcmlocale.cpp:1180
-msgid "<p>This is the list of installed KDE Workspace language translations currently being used, listed in order of preference.  If a translation is not available for the first language in the list, the next language will be used.  If no other translations are available then US English will be used.</p>"
-msgstr "<p>Ovo je lista instaliranih prijevoda KDE-ovog radnog prostora koji se trenutno koriste, navedenih ÅŸeljenim redoslijedom. Ako nije dostupan prijevod za prvi jezik u listi, koristit će se sljedeći jezik. Ako nije dostupan ni jedan drugi prijevod, koristit će se američki engleski.</p>"
+msgid ""
+"<p>This is the list of installed KDE Workspace language translations "
+"currently being used, listed in order of preference.  If a translation is not "
+"available for the first language in the list, the next language will be used. "
+" If no other translations are available then US English will be used.</p>"
+msgstr ""
+"<p>Ovo je lista instaliranih prijevoda KDE-ovog radnog prostora koji se "
+"trenutno koriste, navedenih ÅŸeljenim redoslijedom. Ako nije dostupan prijevod "
+"za prvi jezik u listi, koristit će se sljedeći jezik. Ako nije dostupan ni "
+"jedan drugi prijevod, koristit će se američki engleski.</p>"
 
 #. +> trunk stable
@@ -304 +356 @@
 #: kcmlocale.cpp:1300 kcmlocale.cpp:1754 kcmlocalewidget.ui:163
 #: kcmlocalewidget.ui:524
-#, fuzzy
 msgid "Digit grouping:"
-msgstr "svetlosna grupa"
+msgstr "Grupiranje znamenki:"
 
 #. +> trunk stable
@@ -312 +363 @@
 #, fuzzy
 #| msgid "<p>Here you can define the digit group separator used to display numbers.</p><p>Note that the digit group separator used to display monetary values has to be set separately (see the 'Money' tab).</p>"
-msgid "<p>Here you can define the digit grouping used to display numbers.</p><p>Note that the digit grouping used to display monetary values has to be set separately (see the 'Money' tab).</p>"
-msgstr "<p>Ovdje moşete odrediti razdjelnicu grupa znamenki za prikaz brojeva.</p><p>Primijetite da razdjelnik grupa znamenki za prikaz novčanih vrijednosti treba podesiti posebno (vidjeti karticu 'Novac').</p>"
+msgid ""
+"<p>Here you can define the digit grouping used to display numbers.</p><p>Note "
+"that the digit grouping used to display monetary values has to be set "
+"separately (see the 'Money' tab).</p>"
+msgstr ""
+"<p>Ovdje moÅŸete odrediti razdjelnicu grupa znamenki za prikaz brojeva.</p><p>"
+"Primijetite da razdjelnik grupa znamenki za prikaz novčanih vrijednosti treba "
+"podesiti posebno (vidjeti karticu 'Novac').</p>"
 
 #. i18n: ectx: property (text), widget (QLabel, m_labelThousandsSeparator)
@@ -325 +382 @@
 #. +> trunk stable
 #: kcmlocale.cpp:1339
-msgid "<p>Here you can define the digit group separator used to display numbers.</p><p>Note that the digit group separator used to display monetary values has to be set separately (see the 'Money' tab).</p>"
-msgstr "<p>Ovdje moşete odrediti razdjelnicu grupa znamenki za prikaz brojeva.</p><p>Primijetite da razdjelnik grupa znamenki za prikaz novčanih vrijednosti treba podesiti posebno (vidjeti karticu 'Novac').</p>"
+msgid ""
+"<p>Here you can define the digit group separator used to display numbers.</p>"
+"<p>Note that the digit group separator used to display monetary values has to "
+"be set separately (see the 'Money' tab).</p>"
+msgstr ""
+"<p>Ovdje moÅŸete odrediti razdjelnicu grupa znamenki za prikaz brojeva.</p><p>"
+"Primijetite da razdjelnik grupa znamenki za prikaz novčanih vrijednosti treba "
+"podesiti posebno (vidjeti karticu 'Novac').</p>"
 
 #. i18n: ectx: property (text), widget (QLabel, m_labelDecimalSymbol)
@@ -338 +401 @@
 #. +> trunk stable
 #: kcmlocale.cpp:1396
-msgid "<p>Here you can define the decimal separator used to display numbers (i.e. a dot or a comma in most countries).</p><p>Note that the decimal separator used to display monetary values has to be set separately (see the 'Money' tab).</p>"
-msgstr "<p>Ovdje moşete odrediti decimalnu razdjelnicu za prikaz brojeva (točka ili zarez u mnogim zemljama).</p><p>Primijetite da decimalna razdjelnica za prikaz novčanih vrijednosti valja definirati posebno (vidjeti karticu 'Novac').</p>"
+msgid ""
+"<p>Here you can define the decimal separator used to display numbers (i.e. a "
+"dot or a comma in most countries).</p><p>Note that the decimal separator used "
+"to display monetary values has to be set separately (see the 'Money' tab).</p>"
+msgstr ""
+"<p>Ovdje moşete odrediti decimalnu razdjelnicu za prikaz brojeva (točka ili "
+"zarez u mnogim zemljama).</p><p>Primijetite da decimalna razdjelnica za "
+"prikaz novčanih vrijednosti valja definirati posebno (vidjeti karticu "
+"'Novac').</p>"
 
 #. i18n: ectx: property (text), widget (QLabel, m_labelDecimalPlaces)
@@ -351 +421 @@
 #. +> trunk stable
 #: kcmlocale.cpp:1447
-msgid "<p>Here you can set the number of decimal places displayed for numeric values, i.e. the number of digits <em>after</em> the decimal separator.</p><p>Note that the decimal places used to display monetary values has to be set separately (see the 'Money' tab).</p>"
-msgstr "<p>Ovdje moşete postaviti broj decimalnih mjesta za prikaz brojčanih vrijednosti, odnosno broj znamenki <em>nakon</em> decimalne razdjelnice.</p><p>Primijetite da decimalna mjesta za prikaz novčanih vrijednosti valja podesiti posebno (vidjeti karticu 'Novac').</p>"
+msgid ""
+"<p>Here you can set the number of decimal places displayed for numeric "
+"values, i.e. the number of digits <em>after</em> the decimal separator.</p><p>"
+"Note that the decimal places used to display monetary values has to be set "
+"separately (see the 'Money' tab).</p>"
+msgstr ""
+"<p>Ovdje moşete postaviti broj decimalnih mjesta za prikaz brojčanih "
+"vrijednosti, odnosno broj znamenki <em>nakon</em> decimalne razdjelnice.</p><"
+"p>Primijetite da decimalna mjesta za prikaz novčanih vrijednosti valja "
+"podesiti posebno (vidjeti karticu 'Novac').</p>"
 
 #. i18n: ectx: property (text), widget (QLabel, m_labelPositiveFormat)
@@ -362 +440 @@
 #. +> trunk stable
 #: kcmlocale.cpp:1485
-msgid "<p>Here you can specify text used to prefix positive numbers. Most locales leave this blank.</p><p>Note that the positive sign used to display monetary values has to be set separately (see the 'Money' tab).</p>"
-msgstr "<p>Ovdje moÅŸete navesti tekst koji će biti prefiks pozitivnim brojevima. Većina zemalja ima prazan tekst.</p><p>Primijetite da pozitivni predznak za prikaz novčanih vrijednosti valja postavitiposebno (vidjeti karticu 'Novac').</p>"
+msgid ""
+"<p>Here you can specify text used to prefix positive numbers. Most locales "
+"leave this blank.</p><p>Note that the positive sign used to display monetary "
+"values has to be set separately (see the 'Money' tab).</p>"
+msgstr ""
+"<p>Ovdje moÅŸete navesti tekst koji će biti prefiks pozitivnim brojevima. "
+"Većina zemalja ima prazan tekst.</p><p>Primijetite da pozitivni predznak za "
+"prikaz novčanih vrijednosti valja postavitiposebno (vidjeti karticu 'Novac')."
+"</p>"
 
 #. +> trunk stable
@@ -379 +464 @@
 #. +> trunk stable
 #: kcmlocale.cpp:1542
-msgid "<p>Here you can specify text used to prefix negative numbers. This should not be empty, so you can distinguish positive and negative numbers. It is normally set to minus (-).</p><p>Note that the negative sign used to display monetary values has to be set separately (see the 'Money' tab).</p>"
-msgstr "<p>Ovdje moÅŸete navesti tekst koji će biti prefiks negativnim brojevima. Ovo ne bi smjelo biti prazno kako biste mogli razlikovati pozitivne od negativnih brojeva. Obično se postavlja minus (-).</p><p>Primijetite da negativni predznak za prikaz novčanih vrijednosti valja postaviti posebno (vidjeti karticu 'Novac').</p>"
+msgid ""
+"<p>Here you can specify text used to prefix negative numbers. This should not "
+"be empty, so you can distinguish positive and negative numbers. It is "
+"normally set to minus (-).</p><p>Note that the negative sign used to display "
+"monetary values has to be set separately (see the 'Money' tab).</p>"
+msgstr ""
+"<p>Ovdje moÅŸete navesti tekst koji će biti prefiks negativnim brojevima. Ovo "
+"ne bi smjelo biti prazno kako biste mogli razlikovati pozitivne od negativnih "
+"brojeva. Obično se postavlja minus (-).</p><p>Primijetite da negativni "
+"predznak za prikaz novčanih vrijednosti valja postaviti posebno (vidjeti "
+"karticu 'Novac').</p>"
 
 #. +> trunk stable
@@ -399 +493 @@
 #. +> trunk stable
 #: kcmlocale.cpp:1596
-msgid "<p>Here you can define the set of digits used to display numbers. If digits other than Arabic are selected, they will appear only if used in the language of the application or the piece of text where the number is shown.</p> <p>Note that the set of digits used to display monetary values has to be set separately (see the 'Money' tab).</p>"
-msgstr "<p>Ovdje moÅŸete odrediti brojevni sustav za prikaz brojeva. Ako je izabran nearapski brojevni sustav, prikazat će se samo ako je koriÅ¡ten u jeziku aplikacije ili dijelu teksta u kojem je prikazan broj.</p> <p>Primijetite da brojevni sustav za prikaz novčanih vrijednosti valja definirati posebno (vidjeti karticu 'Novac').</p>"
+msgid ""
+"<p>Here you can define the set of digits used to display numbers. If digits "
+"other than Arabic are selected, they will appear only if used in the language "
+"of the application or the piece of text where the number is shown.</p> <p>"
+"Note that the set of digits used to display monetary values has to be set "
+"separately (see the 'Money' tab).</p>"
+msgstr ""
+"<p>Ovdje moÅŸete odrediti brojevni sustav za prikaz brojeva. Ako je izabran "
+"nearapski brojevni sustav, prikazat će se samo ako je korišten u jeziku "
+"aplikacije ili dijelu teksta u kojem je prikazan broj.</p> <p>Primijetite da "
+"brojevni sustav za prikaz novčanih vrijednosti valja definirati posebno "
+"(vidjeti karticu 'Novac').</p>"
 
 #. i18n: ectx: property (text), widget (QLabel, m_labelCurrencyCode)
@@ -410 +514 @@
 #. +> trunk stable
 #: kcmlocale.cpp:1637
-msgid "<p>Here you can choose the currency to be used when displaying monetary values, e.g. United States Dollar or Pound Sterling.</p>"
-msgstr "<p>Ovdje moşete odabrati valutu za prikaznovčanih vrijednosti, npr. dolar Sjedinjenih Drşava ili funta Ujedinjenog Kraljevstva.</p>"
+msgid ""
+"<p>Here you can choose the currency to be used when displaying monetary "
+"values, e.g. United States Dollar or Pound Sterling.</p>"
+msgstr ""
+"<p>Ovdje moşete odabrati valutu za prikaznovčanih vrijednosti, npr. dolar "
+"Sjedinjenih DrÅŸava ili funta Ujedinjenog Kraljevstva.</p>"
 
 #. +> trunk stable
@@ -428 +536 @@
 #. +> trunk stable
 #: kcmlocale.cpp:1698
-msgid "<p>Here you can choose the symbol to be used when displaying monetary values, e.g. $, US$ or USD.</p>"
-msgstr "<p>Ovdje moşete odabrati simbol za prikaz novčanih vrijednosti, npr. $, US$ ili USD.</p>"
+msgid ""
+"<p>Here you can choose the symbol to be used when displaying monetary values, "
+"e.g. $, US$ or USD.</p>"
+msgstr ""
+"<p>Ovdje moşete odabrati simbol za prikaz novčanih vrijednosti, npr. $, US$ "
+"ili USD.</p>"
 
 #. +> trunk stable
@@ -435 +547 @@
 #, fuzzy
 #| msgid "<p>Here you can define the decimal separator used to display monetary values.</p><p>Note that the decimal separator used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>"
-msgid "<p>Here you can define the digit grouping used to display monetary values.</p><p>Note that the digit grouping used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>"
-msgstr "<p>Ovdje moşete definirati decimalnu razdjelnicu za prikaz novčanih vrijednosti.</p><p>Primijetite da decimalnu razdjelnicu za prikaz drugih brojeva treba podesiti posebno (vidjeti karticu 'Brojevi').</p>"
+msgid ""
+"<p>Here you can define the digit grouping used to display monetary values.</p>"
+"<p>Note that the digit grouping used to display other numbers has to be "
+"defined separately (see the 'Numbers' tab).</p>"
+msgstr ""
+"<p>Ovdje moşete definirati decimalnu razdjelnicu za prikaz novčanih "
+"vrijednosti.</p><p>Primijetite da decimalnu razdjelnicu za prikaz drugih "
+"brojeva treba podesiti posebno (vidjeti karticu 'Brojevi').</p>"
 
 #. +> trunk stable
 #: kcmlocale.cpp:1794
-msgid "<p>Here you can define the group separator used to display monetary values.</p><p>Note that the thousands separator used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>"
-msgstr "<p>Ovdje moÅŸete definirati razdjelnicu grupa za prikaz novčanih vrijednosti.</p><p>Primijetite da razdjelnica tisuća za prikaz drugih brojeva treba definirati posebno (vidjeti karticu 'Brojevi').</p>"
+msgid ""
+"<p>Here you can define the group separator used to display monetary values.<"
+"/p><p>Note that the thousands separator used to display other numbers has to "
+"be defined separately (see the 'Numbers' tab).</p>"
+msgstr ""
+"<p>Ovdje moşete definirati razdjelnicu grupa za prikaz novčanih vrijednosti.<"
+"/p><p>Primijetite da razdjelnica tisuća za prikaz drugih brojeva treba "
+"definirati posebno (vidjeti karticu 'Brojevi').</p>"
 
 #. +> trunk stable
 #: kcmlocale.cpp:1849
-msgid "<p>Here you can define the decimal separator used to display monetary values.</p><p>Note that the decimal separator used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>"
-msgstr "<p>Ovdje moşete definirati decimalnu razdjelnicu za prikaz novčanih vrijednosti.</p><p>Primijetite da decimalnu razdjelnicu za prikaz drugih brojeva treba podesiti posebno (vidjeti karticu 'Brojevi').</p>"
+msgid ""
+"<p>Here you can define the decimal separator used to display monetary values."
+"</p><p>Note that the decimal separator used to display other numbers has to "
+"be defined separately (see the 'Numbers' tab).</p>"
+msgstr ""
+"<p>Ovdje moşete definirati decimalnu razdjelnicu za prikaz novčanih "
+"vrijednosti.</p><p>Primijetite da decimalnu razdjelnicu za prikaz drugih "
+"brojeva treba podesiti posebno (vidjeti karticu 'Brojevi').</p>"
 
 #. +> trunk stable
 #: kcmlocale.cpp:1902
-msgid "<p>Here you can set the number of decimal places displayed for monetary values, i.e. the number of digits <em>after</em> the decimal separator.</p><p>Note that the decimal places used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>"
-msgstr "<p>Ovdje moşete postaviti broj decimalnih mjesta za prikaz novčanih vrijednosti, odnosno broj znamenki <em>nakon</em> decimalne razdjelnice.</p><p>Primijetite da decimalna mjesta za prikaz drugih brojeva treba definirati posebno (vidjeti karticu 'Brojevi').</p>"
+msgid ""
+"<p>Here you can set the number of decimal places displayed for monetary "
+"values, i.e. the number of digits <em>after</em> the decimal separator.</p><p>"
+"Note that the decimal places used to display other numbers has to be defined "
+"separately (see the 'Numbers' tab).</p>"
+msgstr ""
+"<p>Ovdje moşete postaviti broj decimalnih mjesta za prikaz novčanih "
+"vrijednosti, odnosno broj znamenki <em>nakon</em> decimalne razdjelnice.</p><"
+"p>Primijetite da decimalna mjesta za prikaz drugih brojeva treba definirati "
+"posebno (vidjeti karticu 'Brojevi').</p>"
 
 #. i18n: ectx: property (text), widget (QLabel, m_labelMonetaryPositiveFormat)
@@ -461 +599 @@
 #. +> trunk stable
 #: kcmlocale.cpp:1953
-msgid "<p>Here you can set the format of positive monetary values.</p><p>Note that the positive sign used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>"
-msgstr "<p>Ovdje moşete postaviti format pozitivnih novčanih vrijednosti.</p><p>Primijetite da pozitivni predznak za prikaz drugih brojeva valja definirati posebno (vidjeti karticu 'Brojevi').</p>"
+msgid ""
+"<p>Here you can set the format of positive monetary values.</p><p>Note that "
+"the positive sign used to display other numbers has to be defined separately "
+"(see the 'Numbers' tab).</p>"
+msgstr ""
+"<p>Ovdje moşete postaviti format pozitivnih novčanih vrijednosti.</p><p>"
+"Primijetite da pozitivni predznak za prikaz drugih brojeva valja definirati "
+"posebno (vidjeti karticu 'Brojevi').</p>"
 
 #. +> trunk stable
@@ -496 +640 @@
 #. +> trunk stable
 #: kcmlocale.cpp:2010
-msgid "Here you can select how a positive sign will be positioned. This only affects monetary values."
-msgstr "Ovdje birate kako će znak za pozitivno biti postavljen. Ovdje podešeno će ujtecati samo na novčane vrijednosti."
+msgid ""
+"Here you can select how a positive sign will be positioned. This only affects "
+"monetary values."
+msgstr ""
+"Ovdje birate kako će znak za pozitivno biti postavljen. Ovdje podešeno će "
+"ujtecati samo na novčane vrijednosti."
 
 #. +> trunk stable
@@ -506 +654 @@
 #. +> trunk stable
 #: kcmlocale.cpp:2014
-msgid "If this option is checked, the currency sign will be prefixed (i.e. to the left of the value) for all positive monetary values. If not, it will be postfixed (i.e. to the right)."
-msgstr "Ako ovdje odaberete, znak valute će se pisati kao prefix (slijeva) za sve pozitivne vrijednosti novca. U suprotnom, on će biti zdesna."
+msgid ""
+"If this option is checked, the currency sign will be prefixed (i.e. to the "
+"left of the value) for all positive monetary values. If not, it will be "
+"postfixed (i.e. to the right)."
+msgstr ""
+"Ako ovdje odaberete, znak valute će se pisati kao prefix (slijeva) za sve "
+"pozitivne vrijednosti novca. U suprotnom, on će biti zdesna."
 
 #. i18n: ectx: property (text), widget (QLabel, m_labelMonetaryNegativeFormat)
@@ -517 +670 @@
 #. +> trunk stable
 #: kcmlocale.cpp:2108
-msgid "<p>Here you can set the format of negative monetary values.</p><p>Note that the negative sign used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>"
-msgstr "<p>Ovdje moşete postaviti format negativnih novčanih vrijednosti.</p><p>Primijetite da negativnih predznak za prikaz drugih brojeva valja definirati posebno (vidjeti karticu 'Brojevi').</p>"
+msgid ""
+"<p>Here you can set the format of negative monetary values.</p><p>Note that "
+"the negative sign used to display other numbers has to be defined separately "
+"(see the 'Numbers' tab).</p>"
+msgstr ""
+"<p>Ovdje moşete postaviti format negativnih novčanih vrijednosti.</p><p>"
+"Primijetite da negativnih predznak za prikaz drugih brojeva valja definirati "
+"posebno (vidjeti karticu 'Brojevi').</p>"
 
 #. +> trunk stable
 #: kcmlocale.cpp:2120
-msgid "Here you can select how a negative sign will be positioned. This only affects monetary values."
-msgstr "Ovdje moşete odabrati smještaj znaka negativnosti. Ovo se odnosi samo na novačane vrijednosti."
+msgid ""
+"Here you can select how a negative sign will be positioned. This only affects "
+"monetary values."
+msgstr ""
+"Ovdje moşete odabrati smještaj znaka negativnosti. Ovo se odnosi samo na "
+"novačane vrijednosti."
 
 #. +> trunk stable
 #: kcmlocale.cpp:2125
-msgid "If this option is checked, the currency sign will be prefixed (i.e. to the left of the value) for all negative monetary values. If not, it will be postfixed (i.e. to the right)."
-msgstr "Ako ovdje omogućite, znak za valutu će biti stavljen ispred (slijeva) negativnih novčanih vrijednosti. U surotnom, biti će stavljen straga (zdesna)."
+msgid ""
+"If this option is checked, the currency sign will be prefixed (i.e. to the "
+"left of the value) for all negative monetary values. If not, it will be "
+"postfixed (i.e. to the right)."
+msgstr ""
+"Ako ovdje omogućite, znak za valutu će biti stavljen ispred (slijeva) "
+"negativnih novčanih vrijednosti. U surotnom, biti će stavljen straga (zdesna)."
 
 #. +> trunk stable
 #: kcmlocale.cpp:2215
-msgid "<p>Here you can define the set of digits used to display monetary values. If digits other than Arabic are selected, they will appear only if used in the language of the application or the piece of text where the number is shown.</p><p>Note that the set of digits used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>"
-msgstr "<p>Ovdje moÅŸete odabrati brojevni sustav za prikaz novčanih vrijednosti. Ako je izabran nearapski brojevni sustav, pokazat će se ako je koriÅ¡ten u jeziku aplikacije ili dijelu teksta u kojem je prikazan broj.</p><p>Primijetite da brojevni sustav za prikaz drugih brojeva treba podesiti posebno (vidjeti karticu 'Brojevi').</p>"
+msgid ""
+"<p>Here you can define the set of digits used to display monetary values. If "
+"digits other than Arabic are selected, they will appear only if used in the "
+"language of the application or the piece of text where the number is shown.<"
+"/p><p>Note that the set of digits used to display other numbers has to be "
+"defined separately (see the 'Numbers' tab).</p>"
+msgstr ""
+"<p>Ovdje moşete odabrati brojevni sustav za prikaz novčanih vrijednosti. Ako "
+"je izabran nearapski brojevni sustav, pokazat će se ako je korišten u jeziku "
+"aplikacije ili dijelu teksta u kojem je prikazan broj.</p><p>Primijetite da "
+"brojevni sustav za prikaz drugih brojeva treba podesiti posebno (vidjeti "
+"karticu 'Brojevi').</p>"
 
 #. i18n: ectx: property (text), widget (QLabel, m_labelCalendarSystem)
@@ -544 +722 @@
 #: kcmlocale.cpp:2258
 msgid "<p>Here you can set the Calendar System to use to display dates.</p>"
-msgstr "<p>Ovdje moÅŸete postaviti kalendarski sustav koji će se koristiti za prikaz datuma.</p>"
+msgstr ""
+"<p>Ovdje moÅŸete postaviti kalendarski sustav koji će se koristiti za prikaz "
+"datuma.</p>"
 
 #. i18n: ectx: property (text), widget (QCheckBox, m_checkCalendarGregorianUseCommonEra)
@@ -554 +734 @@
 #. +> trunk stable
 #: kcmlocale.cpp:2314
-msgid "<p>This option determines if the Common Era (CE/BCE) should be used instead of the Christian Era (AD/BC).</p>"
-msgstr "<p>Ova opcija određuje da li se koristi \"Naša era\" (CE/BCE) umjesto \"Kršćanska era\" (AD/BC).</p>"
+msgid ""
+"<p>This option determines if the Common Era (CE/BCE) should be used instead "
+"of the Christian Era (AD/BC).</p>"
+msgstr ""
+"<p>Ova opcija određuje da li se koristi \"Naša era\" (CE/BCE) umjesto "
+"\"Kršćanska era\" (AD/BC).</p>"
 
 #. i18n: ectx: property (text), widget (QLabel, m_labelShortYearWindow)
@@ -572 +756 @@
 #. +> trunk stable
 #: kcmlocale.cpp:2359
-msgid "<p>This option determines what year range a two digit date is interpreted as, for example with a range of 1950 to 2049 the value 10 is interpreted as 2010.  This range is only applied when reading the Short Year (YY) date format.</p>"
-msgstr "<p>Ova opcija određuje koje se razdoblje godina podrazumijeva za dvije znamenke, npr. u razdoblju od 1950. do 2049. vrijednost 10. predstavlja 2010. godinu.  Ovo se koristi samo pri formatu kratkog prikaza godine (YY).</p>"
+msgid ""
+"<p>This option determines what year range a two digit date is interpreted as, "
+"for example with a range of 1950 to 2049 the value 10 is interpreted as 2010. "
+" This range is only applied when reading the Short Year (YY) date format.</p>"
+msgstr ""
+"<p>Ova opcija određuje koje se razdoblje godina podrazumijeva za dvije "
+"znamenke, npr. u razdoblju od 1950. do 2049. vrijednost 10. predstavlja 2010. "
+"godinu.  Ovo se koristi samo pri formatu kratkog prikaza godine (YY).</p>"
 
 #. i18n: ectx: property (text), widget (QLabel, m_labelWeekNumberSystem)
 #. +> trunk stable
 #: kcmlocale.cpp:2401 kcmlocalewidget.ui:938
-#, fuzzy
 #| msgid "Measure system:"
 msgid "Week number system:"
-msgstr "Mjerni sustav:"
+msgstr "Sustav brojanja tjedana:"
 
 #. +> trunk
 #: kcmlocale.cpp:2402
-msgid "<p>This option determines how the Week Number will be calculated. There are four options available:</p> <ul><li><b>ISO Week</b> Use the ISO standard Week Number. This will always use Monday as the first day of the ISO week. This is the most commonly used system.</li><li><b>Full First Week</b> The first week of the year starts on the first occurrence of the <i>First day of the week</i>, and lasts for seven days.  Any days before Week 1 are considered part of the last week of the previous year. This system is most commonly used in the USA.</li><li><b>Partial First Week</b> The first week starts on the first day of the year. The second week of the year starts on the first occurrence of the <i>First day of the week</i>, and lasts for seven days. The first week may not contain seven days.</li><li><b>Simple Week</b> The first week starts on the first day of the year and lasts seven days, with all new weeks starting on the same weekday as the first day of the year.</li></ul>"
+msgid ""
+"<p>This option determines how the Week Number will be calculated. There are "
+"four options available:</p> <ul><li><b>ISO Week</b> Use the ISO standard Week "
+"Number. This will always use Monday as the first day of the ISO week. This is "
+"the most commonly used system.</li><li><b>Full First Week</b> The first week "
+"of the year starts on the first occurrence of the <i>First day of the week</i>"
+", and lasts for seven days.  Any days before Week 1 are considered part of "
+"the last week of the previous year. This system is most commonly used in the "
+"USA.</li><li><b>Partial First Week</b> The first week starts on the first day "
+"of the year. The second week of the year starts on the first occurrence of "
+"the <i>First day of the week</i>, and lasts for seven days. The first week "
+"may not contain seven days.</li><li><b>Simple Week</b> The first week starts "
+"on the first day of the year and lasts seven days, with all new weeks "
+"starting on the same weekday as the first day of the year.</li></ul>"
 msgstr ""
 
 #. +> stable
 #: kcmlocale.cpp:2402
-msgid "<p>This option determines how the Week Number will be calculated. There are four options available:</p> <ul><li><b>ISO Week</b> Use the ISO standard Week Number. This will always use Monday as the first day of the ISO week. This is the most commonly used system.</li><li><b>Full First Week</b> The first week of the year starts on the first occurrence of the <i>First day of the week</i>, and lasts for seven days.  Any days before Week 1 are considered part of the last week of the previous year. This system is most commonly used in the USA.</li><li><b>Partial First Week</b> The first week starts on the first day of the year. The second week of the year starts on the first occurrence of the <i>First day of the week</i>, and lasts for seven days. The first week may not contain seven days.</li><li><b>Simple Week</b> The first week starts on the first day of the year and lasts seven days, will all new weeks starting on the same weekday as the first day of the year.</li></ul>"
+msgid ""
+"<p>This option determines how the Week Number will be calculated. There are "
+"four options available:</p> <ul><li><b>ISO Week</b> Use the ISO standard Week "
+"Number. This will always use Monday as the first day of the ISO week. This is "
+"the most commonly used system.</li><li><b>Full First Week</b> The first week "
+"of the year starts on the first occurrence of the <i>First day of the week</i>"
+", and lasts for seven days.  Any days before Week 1 are considered part of "
+"the last week of the previous year. This system is most commonly used in the "
+"USA.</li><li><b>Partial First Week</b> The first week starts on the first day "
+"of the year. The second week of the year starts on the first occurrence of "
+"the <i>First day of the week</i>, and lasts for seven days. The first week "
+"may not contain seven days.</li><li><b>Simple Week</b> The first week starts "
+"on the first day of the year and lasts seven days, will all new weeks "
+"starting on the same weekday as the first day of the year.</li></ul>"
 msgstr ""
 
 #. +> trunk stable
 #: kcmlocale.cpp:2425
-#, fuzzy
 msgid "ISO Week"
-msgstr "1 tjedan"
+msgstr "ISO tjedan"
 
 #. +> trunk stable
 #: kcmlocale.cpp:2427
-#, fuzzy
 msgid "Full First Week"
-msgstr "Broj"
+msgstr "Puni prvi tjedan"
 
 #. +> trunk stable
 #: kcmlocale.cpp:2429
-#, fuzzy
 msgid "Partial First Week"
-msgstr "Parcijalni naboj"
+msgstr "Djelomični prvi tjedan"
 
 #. +> trunk stable
 #: kcmlocale.cpp:2431
-#, fuzzy
 msgid "Simple Week"
-msgstr "Jednostavan test"
+msgstr "Jednostavni tjedan"
 
 #. i18n: ectx: property (text), widget (QLabel, m_labelWeekStartDay)
@@ -625 +836 @@
 #. +> trunk stable
 #: kcmlocale.cpp:2461
-#, fuzzy
 #| msgid "<p>This option determines which day will be considered as the first one of the week.</p> "
-msgid "<p>This option determines which day will be considered as the first one of the week.  This value may affect the Week Number System.</p> "
-msgstr "<p>Ova opcija određuje koji se dan smatra prvim danom tjedna.</p> "
+msgid ""
+"<p>This option determines which day will be considered as the first one of "
+"the week.  This value may affect the Week Number System.</p> "
+msgstr ""
+"<p>Ova opcija određuje koji se dan smatra prvim danom tjedna. Ova vrijednost "
+"moÅŸe utjecati na Sustav brojanja tjedana.</p> "
 
 #. i18n: ectx: property (text), widget (QLabel, m_labelWorkingWeekStartDay)
@@ -638 +852 @@
 #. +> trunk stable
 #: kcmlocale.cpp:2496
-msgid "<p>This option determines which day will be considered as the first working day of the week.</p>"
-msgstr "<p>Ova opcija određuje koji dan se smatra prvim radnim danom u tjednu.</p>"
+msgid ""
+"<p>This option determines which day will be considered as the first working "
+"day of the week.</p>"
+msgstr ""
+"<p>Ova opcija određuje koji dan se smatra prvim radnim danom u tjednu.</p>"
 
 #. i18n: ectx: property (text), widget (QLabel, m_labelWorkingWeekEndDay)
@@ -649 +866 @@
 #. +> trunk stable
 #: kcmlocale.cpp:2530
-msgid "<p>This option determines which day will be considered as the last working day of the week.</p>"
-msgstr "<p>Ova opcija određuje koji se dan smatra zadnjim radnim danom u tjednu.</p>"
+msgid ""
+"<p>This option determines which day will be considered as the last working "
+"day of the week.</p>"
+msgstr ""
+"<p>Ova opcija određuje koji se dan smatra zadnjim radnim danom u tjednu.</p>"
 
 #. i18n: ectx: property (text), widget (QLabel, m_labelWeekDayOfPray)
@@ -660 +880 @@
 #. +> trunk stable
 #: kcmlocale.cpp:2564
-msgid "<p>This option determines which day if any will be considered as the day of the week for special religious observance.</p>"
-msgstr "<p>Ova opcija određuje koji će se dan u tjednu smatrati danom u tjednu za posebne vjerske obrede.</p>"
+msgid ""
+"<p>This option determines which day if any will be considered as the day of "
+"the week for special religious observance.</p>"
+msgstr ""
+"<p>Ova opcija određuje koji će se dan u tjednu smatrati danom u tjednu za "
+"posebne vjerske obrede.</p>"
 
 #. +> trunk stable
@@ -677 +901 @@
 #. +> trunk stable
 #: kcmlocale.cpp:2599
-msgid "<p>The text in this textbox will be used to format time strings. The sequences below will be replaced:</p><table><tr><td><b>HH</b></td><td>The hour as a decimal number using a 24-hour clock (00-23).</td></tr><tr><td><b>hH</b></td><td>The hour (24-hour clock) as a decimal number (0-23).</td></tr><tr><td><b>PH</b></td><td>The hour as a decimal number using a 12-hour clock (01-12).</td></tr><tr><td><b>pH</b></td><td>The hour (12-hour clock) as a decimal number (1-12).</td></tr><tr><td><b>MM</b></td><td>The minutes as a decimal number (00-59).</td></tr><tr><td><b>SS</b></td><td>The seconds as a decimal number (00-59).</td></tr><tr><td><b>AMPM</b></td><td>Either 'AM' or 'PM' according to the given time value. Noon is treated as 'PM' and midnight as 'AM'.</td></tr></table>"
-msgstr "<p>Tekst u ovom tekstualnom polju koristi se za oblikovanje oznaka vremena. Sljedeći nizovi bit će zamijenjeni:</p><table><tr><td><b>HH</b></td><td>Sat kao decimalni broj kod 24-satnog formata (00-23).</td></tr><tr><td><b>hH</b></td><td>Sat (24-satni prikaz) kao decimalni broj (0-23).</td></tr><tr><td><b>PH</b></td><td>Sat kao decimalni broj kod 12-satnog formata (01-12).</td></tr><tr><td><b>pH</b></td><td>Sat (12-satni prikaz) kao decimalni broj (1-12).</td></tr><tr><td><b>MM</b></td><td>Minute kao decimalni broj (00-59).</td></tr><tr><td><b>SS</b></td><td>Sekunde kao decimalni broj (00-59).</td></tr><tr><td><b>AMPM</b></td><td>Ili 'AM' ili 'PM' ovisno o danom vremenu. Podne je 'PM', a ponoć je 'AM'.</td></tr></table>"
+msgid ""
+"<p>The text in this textbox will be used to format time strings. The "
+"sequences below will be replaced:</p><table><tr><td><b>HH</b></td><td>The "
+"hour as a decimal number using a 24-hour clock (00-23).</td></tr><tr><td><b>"
+"hH</b></td><td>The hour (24-hour clock) as a decimal number (0-23).</td></tr>"
+"<tr><td><b>PH</b></td><td>The hour as a decimal number using a 12-hour clock "
+"(01-12).</td></tr><tr><td><b>pH</b></td><td>The hour (12-hour clock) as a "
+"decimal number (1-12).</td></tr><tr><td><b>MM</b></td><td>The minutes as a "
+"decimal number (00-59).</td></tr><tr><td><b>SS</b></td><td>The seconds as a "
+"decimal number (00-59).</td></tr><tr><td><b>AMPM</b></td><td>Either 'AM' or "
+"'PM' according to the given time value. Noon is treated as 'PM' and midnight "
+"as 'AM'.</td></tr></table>"
+msgstr ""
+"<p>Tekst u ovom tekstualnom polju koristi se za oblikovanje oznaka vremena. "
+"Sljedeći nizovi bit će zamijenjeni:</p><table><tr><td><b>HH</b></td><td>Sat "
+"kao decimalni broj kod 24-satnog formata (00-23).</td></tr><tr><td><b>hH</b><"
+"/td><td>Sat (24-satni prikaz) kao decimalni broj (0-23).</td></tr><tr><td><b>"
+"PH</b></td><td>Sat kao decimalni broj kod 12-satnog formata (01-12).</td></tr>"
+"<tr><td><b>pH</b></td><td>Sat (12-satni prikaz) kao decimalni broj (1-12).<"
+"/td></tr><tr><td><b>MM</b></td><td>Minute kao decimalni broj (00-59).</td><"
+"/tr><tr><td><b>SS</b></td><td>Sekunde kao decimalni broj (00-59).</td></tr><"
+"tr><td><b>AMPM</b></td><td>Ili 'AM' ili 'PM' ovisno o danom vremenu. Podne je "
+"'PM', a ponoć je 'AM'.</td></tr></table>"
 
 #. +> trunk stable
@@ -735 +980 @@
 #: kcmlocale.cpp:2709
 msgid "<p>Here you can set the text to be displayed for AM.</p>"
-msgstr "<p>Ovdje moÅŸete postaviti tekst koji će se prikazati za prijepodne.</p>"
+msgstr ""
+"<p>Ovdje moÅŸete postaviti tekst koji će se prikazati za prijepodne.</p>"
 
 #. i18n: ectx: property (text), widget (QLabel, m_labelPmSymbol)
@@ -746 +992 @@
 #: kcmlocale.cpp:2714
 msgid "<p>Here you can set the text to be displayed for PM.</p>"
-msgstr "<p>Ovdje moÅŸete postaviti tekst koji će se prikazati za poslijepodne.</p>"
+msgstr ""
+"<p>Ovdje moÅŸete postaviti tekst koji će se prikazati za poslijepodne.</p>"
 
 #. i18n: ectx: property (text), widget (QLabel, m_labelDateFormat)
@@ -756 +1003 @@
 #. +> trunk stable
 #: kcmlocale.cpp:2819
-msgid "<p>The text in this textbox will be used to format long dates. The sequences below will be replaced:</p><table><tr><td><b>YYYY</b></td><td>The year with century as a decimal number.</td></tr><tr><td><b>YY</b></td><td>The year without century as a decimal number (00-99).</td></tr><tr><td><b>MM</b></td><td>The month as a decimal number (01-12).</td></tr><tr><td><b>mM</b></td><td>The month as a decimal number (1-12).</td></tr><tr><td><b>SHORTMONTH</b></td><td>The first three characters of the month name.</td></tr><tr><td><b>MONTH</b></td><td>The full month name.</td></tr><tr><td><b>DD</b></td><td>The day of month as a decimal number (01-31).</td></tr><tr><td><b>dD</b></td><td>The day of month as a decimal number (1-31).</td></tr><tr><td><b>SHORTWEEKDAY</b></td><td>The first three characters of the weekday name.</td></tr><tr><td><b>WEEKDAY</b></td><td>The full weekday name.</td></tr><tr><td><b>ERAYEAR</b></td><td>The Era Year in local format (e.g. 2000 AD).</td></tr><tr><td><b>SHORTERANAME</b></td><td>The short Era Name.</td></tr><tr><td><b>YEARINERA</b></td><td>The Year in Era as a decimal number.</td></tr><tr><td><b>DAYOFYEAR</b></td><td>The Day of Year as a decimal number.</td></tr><tr><td><b>ISOWEEK</b></td><td>The ISO Week as a decimal number.</td></tr><tr><td><b>DAYOFISOWEEK</b></td><td>The Day of the ISO Week as a decimal number.</td></tr></table>"
-msgstr "<p>Tekst u ovom tekstualnom polju koristit će se u formatiranju dugih datuma. NiÅŸe navedeni nizovi bit će zamijenjeni:</p><table><tr><td><b>GGGG</b></td><td>Godina sa stoljećem kao decimalni broj.</td></tr><tr><td><b>GG</b></td><td>Godina bez stoljeća kao decimalni broj (00-99).</td></tr><tr><td><b>MM</b></td><td>Mjesec kao decimalni broj (01-12).</td></tr><tr><td><b>mM</b></td><td>Mjesec kao decimalni broj (1-12).</td></tr><tr><td><b>KRATKIMJESEC</b></td><td>Prva tri slova iz naziva mjeseca. </td></tr><tr><td><b>MJESEC</b></td><td>Puni naziv mjeseca.</td></tr><tr><td><b>DD</b></td><td>Dan u mjesecu kao decimalni broj (01-31).</td></tr><tr><td><b>dD</b></td><td>Dan u mjesecu kao decimalni broj (1-31).</td></tr><tr><td><b>KRATKIDAN</b></td><td>Prva tri slova imena dana.</td></tr><tr><td><b>DANUTJEDNU</b></td><td>Puni naziv dana u tjednu.</td></tr><tr><td><b>ERAGODINA</b></td><td>Godina ere u lokalnom formatu (npr. 2000. AD).</td></tr><tr><td><b>KRATKINAZIVERE</b></td><td>Kratki naziv ere.</td></tr><tr><td><b>GODINAUERI</b></td><td>Godina u eri kao decimalni broj.</td></tr><tr><td><b>DANGODINE</b></td><td>Dan u godini kao decimalni broj.</td></tr><tr><td><b>ISOTJEDAN</b></td><td>ISO tjedan kao decimalni broj.</td></tr><tr><td><b>DANISOTJEDNA</b></td><td>Dan ISO tjedna kao decimalni broj.</td></tr></table>"
+msgid ""
+"<p>The text in this textbox will be used to format long dates. The sequences "
+"below will be replaced:</p><table><tr><td><b>YYYY</b></td><td>The year with "
+"century as a decimal number.</td></tr><tr><td><b>YY</b></td><td>The year "
+"without century as a decimal number (00-99).</td></tr><tr><td><b>MM</b></td><"
+"td>The month as a decimal number (01-12).</td></tr><tr><td><b>mM</b></td><td>"
+"The month as a decimal number (1-12).</td></tr><tr><td><b>SHORTMONTH</b></td>"
+"<td>The first three characters of the month name.</td></tr><tr><td><b>MONTH<"
+"/b></td><td>The full month name.</td></tr><tr><td><b>DD</b></td><td>The day "
+"of month as a decimal number (01-31).</td></tr><tr><td><b>dD</b></td><td>The "
+"day of month as a decimal number (1-31).</td></tr><tr><td><b>SHORTWEEKDAY</b>"
+"</td><td>The first three characters of the weekday name.</td></tr><tr><td><b>"
+"WEEKDAY</b></td><td>The full weekday name.</td></tr><tr><td><b>ERAYEAR</b><"
+"/td><td>The Era Year in local format (e.g. 2000 AD).</td></tr><tr><td><b>"
+"SHORTERANAME</b></td><td>The short Era Name.</td></tr><tr><td><b>YEARINERA</b>"
+"</td><td>The Year in Era as a decimal number.</td></tr><tr><td><b>DAYOFYEAR<"
+"/b></td><td>The Day of Year as a decimal number.</td></tr><tr><td><b>ISOWEEK<"
+"/b></td><td>The ISO Week as a decimal number.</td></tr><tr><td><b>"
+"DAYOFISOWEEK</b></td><td>The Day of the ISO Week as a decimal number.</td><"
+"/tr></table>"
+msgstr ""
+"<p>Tekst u ovom tekstualnom polju koristit će se u formatiranju dugih datuma. "
+"NiÅŸe navedeni nizovi bit će zamijenjeni:</p><table><tr><td><b>GGGG</b></td><"
+"td>Godina sa stoljećem kao decimalni broj.</td></tr><tr><td><b>GG</b></td><td>"
+"Godina bez stoljeća kao decimalni broj (00-99).</td></tr><tr><td><b>MM</b><"
+"/td><td>Mjesec kao decimalni broj (01-12).</td></tr><tr><td><b>mM</b></td><td>"
+"Mjesec kao decimalni broj (1-12).</td></tr><tr><td><b>KRATKIMJESEC</b></td><"
+"td>Prva tri slova iz naziva mjeseca. </td></tr><tr><td><b>MJESEC</b></td><td>"
+"Puni naziv mjeseca.</td></tr><tr><td><b>DD</b></td><td>Dan u mjesecu kao "
+"decimalni broj (01-31).</td></tr><tr><td><b>dD</b></td><td>Dan u mjesecu kao "
+"decimalni broj (1-31).</td></tr><tr><td><b>KRATKIDAN</b></td><td>Prva tri "
+"slova imena dana.</td></tr><tr><td><b>DANUTJEDNU</b></td><td>Puni naziv dana "
+"u tjednu.</td></tr><tr><td><b>ERAGODINA</b></td><td>Godina ere u lokalnom "
+"formatu (npr. 2000. AD).</td></tr><tr><td><b>KRATKINAZIVERE</b></td><td>"
+"Kratki naziv ere.</td></tr><tr><td><b>GODINAUERI</b></td><td>Godina u eri kao "
+"decimalni broj.</td></tr><tr><td><b>DANGODINE</b></td><td>Dan u godini kao "
+"decimalni broj.</td></tr><tr><td><b>ISOTJEDAN</b></td><td>ISO tjedan kao "
+"decimalni broj.</td></tr><tr><td><b>DANISOTJEDNA</b></td><td>Dan ISO tjedna "
+"kao decimalni broj.</td></tr></table>"
 
 #. +> trunk stable
@@ -858 +1142 @@
 #. +> trunk stable
 #: kcmlocale.cpp:2953
-msgid "<p>The text in this textbox will be used to format short dates. For instance, this is used when listing files. The sequences below will be replaced:</p><table><tr><td><b>YYYY</b></td><td>The year with century as a decimal number.</td></tr><tr><td><b>YY</b></td><td>The year without century as a decimal number (00-99).</td></tr><tr><td><b>MM</b></td><td>The month as a decimal number (01-12).</td></tr><tr><td><b>mM</b></td><td>The month as a decimal number (1-12).</td></tr><tr><td><b>SHORTMONTH</b></td><td>The first three characters of the month name.</td></tr><tr><td><b>MONTH</b></td><td>The full month name.</td></tr><tr><td><b>DD</b></td><td>The day of month as a decimal number (01-31).</td></tr><tr><td><b>dD</b></td><td>The day of month as a decimal number (1-31).</td></tr><tr><td><b>SHORTWEEKDAY</b></td><td>The first three characters of the weekday name.</td></tr><tr><td><b>WEEKDAY</b></td><td>The full weekday name.</td></tr><tr><td><b>ERAYEAR</b></td><td>The Era Year in local format (e.g. 2000 AD).</td></tr><tr><td><b>SHORTERANAME</b></td><td>The short Era Name.</td></tr><tr><td><b>YEARINERA</b></td><td>The Year in Era as a decimal number.</td></tr><tr><td><b>DAYOFYEAR</b></td><td>The Day of Year as a decimal number.</td></tr><tr><td><b>ISOWEEK</b></td><td>The ISO Week as a decimal number.</td></tr><tr><td><b>DAYOFISOWEEK</b></td><td>The Day of the ISO Week as a decimal number.</td></tr></table>"
-msgstr "<p>Tekst u ovom tekstualnom polju koristit će se u formatiranju kratkih datuma. Na primjer, ovo se koristi pri izlistavanju datoteka. NiÅŸe navedeni nizovi bit će zamijenjeni:</p><table><tr><td><b>GGGG</b></td><td>Godina sa stoljećem kao decimalni broj.</td></tr><tr><td><b>GG</b></td><td>Godina bez stoljeća kao decimalni broj (00-99).</td></tr><tr><td><b>MM</b></td><td>Mjesec kao decimalni broj (01-12).</td></tr><tr><td><b>mM</b></td><td>Mjesec kao decimalni broj (1-12).</td></tr><tr><td><b>KRATKIMJESEC</b></td><td>Prva tri slova iz naziva mjeseca.</td></tr><tr><td><b>MJESEC</b></td><td>Puni naziv mjeseca.</td></tr><tr><td><b>DD</b></td><td>Dan u mjesecu kao decimalni broj (01-31).</td></tr><tr><td><b>dD</b></td><td>Dan u mjesecu kao decimalni broj (1-31).</td></tr><tr><td><b>KRATKIDAN</b></td><td>Prva tri znaka naziva dana u tjednu.</td></tr><tr><td><b>DANUTJEDNU</b></td><td>Puni naziv dana u tjednu.</td></tr><tr><td><b>ERAGODINA</b></td><td>Godina u eri u lokalnom formatu (npr. 2000. AD).</td></tr><tr><td><b>KRATKINAZIVERE</b></td><td>Kratki naziv ere.</td></tr><tr><td><b>GODINAUERI</b></td><td>Godina u eri kao decimalni broj.</td></tr><tr><td><b>DANGODINE</b></td><td>Dan u godini kao decimalni broj.</td></tr><tr><td><b>ISOTJEDAN</b></td><td>ISO tjedan kao decimalni broj.</td></tr><tr><td><b>DANISOTJEDNA</b></td><td>Dan u ISO tjednu kao decimalni broj.</td></tr></table>"
+msgid ""
+"<p>The text in this textbox will be used to format short dates. For instance, "
+"this is used when listing files. The sequences below will be replaced:</p><"
+"table><tr><td><b>YYYY</b></td><td>The year with century as a decimal number.<"
+"/td></tr><tr><td><b>YY</b></td><td>The year without century as a decimal "
+"number (00-99).</td></tr><tr><td><b>MM</b></td><td>The month as a decimal "
+"number (01-12).</td></tr><tr><td><b>mM</b></td><td>The month as a decimal "
+"number (1-12).</td></tr><tr><td><b>SHORTMONTH</b></td><td>The first three "
+"characters of the month name.</td></tr><tr><td><b>MONTH</b></td><td>The full "
+"month name.</td></tr><tr><td><b>DD</b></td><td>The day of month as a decimal "
+"number (01-31).</td></tr><tr><td><b>dD</b></td><td>The day of month as a "
+"decimal number (1-31).</td></tr><tr><td><b>SHORTWEEKDAY</b></td><td>The first "
+"three characters of the weekday name.</td></tr><tr><td><b>WEEKDAY</b></td><td>"
+"The full weekday name.</td></tr><tr><td><b>ERAYEAR</b></td><td>The Era Year "
+"in local format (e.g. 2000 AD).</td></tr><tr><td><b>SHORTERANAME</b></td><td>"
+"The short Era Name.</td></tr><tr><td><b>YEARINERA</b></td><td>The Year in Era "
+"as a decimal number.</td></tr><tr><td><b>DAYOFYEAR</b></td><td>The Day of "
+"Year as a decimal number.</td></tr><tr><td><b>ISOWEEK</b></td><td>The ISO "
+"Week as a decimal number.</td></tr><tr><td><b>DAYOFISOWEEK</b></td><td>The "
+"Day of the ISO Week as a decimal number.</td></tr></table>"
+msgstr ""
+"<p>Tekst u ovom tekstualnom polju koristit će se u formatiranju kratkih "
+"datuma. Na primjer, ovo se koristi pri izlistavanju datoteka. NiÅŸe navedeni "
+"nizovi bit će zamijenjeni:</p><table><tr><td><b>GGGG</b></td><td>Godina sa "
+"stoljećem kao decimalni broj.</td></tr><tr><td><b>GG</b></td><td>Godina bez "
+"stoljeća kao decimalni broj (00-99).</td></tr><tr><td><b>MM</b></td><td>"
+"Mjesec kao decimalni broj (01-12).</td></tr><tr><td><b>mM</b></td><td>Mjesec "
+"kao decimalni broj (1-12).</td></tr><tr><td><b>KRATKIMJESEC</b></td><td>Prva "
+"tri slova iz naziva mjeseca.</td></tr><tr><td><b>MJESEC</b></td><td>Puni "
+"naziv mjeseca.</td></tr><tr><td><b>DD</b></td><td>Dan u mjesecu kao decimalni "
+"broj (01-31).</td></tr><tr><td><b>dD</b></td><td>Dan u mjesecu kao decimalni "
+"broj (1-31).</td></tr><tr><td><b>KRATKIDAN</b></td><td>Prva tri znaka naziva "
+"dana u tjednu.</td></tr><tr><td><b>DANUTJEDNU</b></td><td>Puni naziv dana u "
+"tjednu.</td></tr><tr><td><b>ERAGODINA</b></td><td>Godina u eri u lokalnom "
+"formatu (npr. 2000. AD).</td></tr><tr><td><b>KRATKINAZIVERE</b></td><td>"
+"Kratki naziv ere.</td></tr><tr><td><b>GODINAUERI</b></td><td>Godina u eri kao "
+"decimalni broj.</td></tr><tr><td><b>DANGODINE</b></td><td>Dan u godini kao "
+"decimalni broj.</td></tr><tr><td><b>ISOTJEDAN</b></td><td>ISO tjedan kao "
+"decimalni broj.</td></tr><tr><td><b>DANISOTJEDNA</b></td><td>Dan u ISO tjednu "
+"kao decimalni broj.</td></tr></table>"
 
 #. +> trunk stable
@@ -881 +1203 @@
 #. +> trunk stable
 #: kcmlocale.cpp:3073
-msgid "<p>This option determines whether possessive form of month names should be used in dates.</p>"
-msgstr "<p>Ova opcija određuje da li se u datumima koristi duÅŸi oblik imena mjeseca.</p>"
+msgid ""
+"<p>This option determines whether possessive form of month names should be "
+"used in dates.</p>"
+msgstr ""
+"<p>Ova opcija određuje da li se u datumima koristi duÅŸi oblik imena mjeseca.<"
+"/p>"
 
 #. +> trunk stable
 #: kcmlocale.cpp:3114
-msgid "<p>Here you can define the set of digits used to display dates and times.  If digits other than Arabic are selected, they will appear only if used in the language of the application or the piece of text where the date or time is shown.</p><p>Note that the set of digits used to display numeric and monetary values have to be set separately (see the 'Number' or 'Money' tabs).</p>"
-msgstr "<p>Ovdje moÅŸete odrediti brojevni sustav za prikaz datuma i vremena. Ako je izabran nearapski brojevni sustav, prikazat će se samo ako je koriÅ¡ten u jeziku aplikacije ili dijelu teksta u kojem je prikazan datum ili vrijeme.</p><p> Primijetite da brojevni sustav za prikaz brojčanih i novčanih vrijednosti valja postaviti posebno (vidjeti kartice 'Brojevi' i 'Novac').</p>"
+msgid ""
+"<p>Here you can define the set of digits used to display dates and times.  If "
+"digits other than Arabic are selected, they will appear only if used in the "
+"language of the application or the piece of text where the date or time is "
+"shown.</p><p>Note that the set of digits used to display numeric and monetary "
+"values have to be set separately (see the 'Number' or 'Money' tabs).</p>"
+msgstr ""
+"<p>Ovdje moÅŸete odrediti brojevni sustav za prikaz datuma i vremena. Ako je "
+"izabran nearapski brojevni sustav, prikazat će se samo ako je korišten u "
+"jeziku aplikacije ili dijelu teksta u kojem je prikazan datum ili vrijeme.</p>"
+"<p> Primijetite da brojevni sustav za prikaz brojčanih i novčanih vrijednosti "
+"valja postaviti posebno (vidjeti kartice 'Brojevi' i 'Novac').</p>"
 
 #. +> trunk stable
@@ -896 +1232 @@
 #. +> trunk stable
 #: kcmlocale.cpp:3152
-msgid "<p>Here you can define the default page size to be used in new documents.</p><p>Note that this setting has no effect on printer paper size.</p>"
-msgstr "<p>Ovdje moÅŸete definirati zadanu veličinu stranice koja će se koristiti u novim dokumentima.</p>  <p>Primijetite da ova postavka nema utjecaj na veličinu papira pisača.</p>"
+msgid ""
+"<p>Here you can define the default page size to be used in new documents.</p>"
+"<p>Note that this setting has no effect on printer paper size.</p>"
+msgstr ""
+"<p>Ovdje moÅŸete definirati zadanu veličinu stranice koja će se koristiti u "
+"novim dokumentima.</p>  <p>Primijetite da ova postavka nema utjecaj na "
+"veličinu papira pisača.</p>"
 
 #. +> trunk stable
@@ -1112 +1453 @@
 #. +> trunk stable
 #: kcmlocale.cpp:3290
-msgid "<p>This changes the units used by most KDE programs to display numbers counted in bytes. Traditionally \"kilobytes\" meant units of 1024, instead of the metric 1000, for most (but not all) byte sizes.<ul><li>To reduce confusion you can use the recently standardized IEC units which are always in multiples of 1024.</li><li>You can also select metric, which is always in units of 1000.</li><li>Selecting JEDEC restores the older-style units used in KDE 3.5 and some other operating systems.</li></p>"
-msgstr "<p>Ovo mijenja jedinice koje koristi većina KDE-ovih programa za prikaz brojeva u bajtovima. Tradicionalni \"kilobajt\" je značio 1024 jedinica, umjesto metričkih 1000 za većinu (ali ne svih) bajtnih veličina.<ul><li>Kako bi smanjili zbunjenost, moÅŸete koristiti nedavno standardizirane jedinice IEC-a koje su uvijek viÅ¡ekratnici od 1024.</li><li>Također moÅŸete odabrati metričke koje su uvijek u jedincama po 1000.</li><li>Odabiranjem JEDEC-a vraćate stare jedinice koje su se koristile u KDE-u 3.5 i u nekim drugim operacijskim sustavima.</li></p>"
+msgid ""
+"<p>This changes the units used by most KDE programs to display numbers "
+"counted in bytes. Traditionally \"kilobytes\" meant units of 1024, instead of "
+"the metric 1000, for most (but not all) byte sizes.<ul><li>To reduce "
+"confusion you can use the recently standardized IEC units which are always in "
+"multiples of 1024.</li><li>You can also select metric, which is always in "
+"units of 1000.</li><li>Selecting JEDEC restores the older-style units used in "
+"KDE 3.5 and some other operating systems.</li></p>"
+msgstr ""
+"<p>Ovo mijenja jedinice koje koristi većina KDE-ovih programa za prikaz "
+"brojeva u bajtovima. Tradicionalni \"kilobajt\" je značio 1024 jedinica, "
+"umjesto metričkih 1000 za većinu (ali ne svih) bajtnih veličina.<ul><li>Kako "
+"bi smanjili zbunjenost, moÅŸete koristiti nedavno standardizirane jedinice "
+"IEC-a koje su uvijek viÅ¡ekratnici od 1024.</li><li>Također moÅŸete odabrati "
+"metričke koje su uvijek u jedincama po 1000.</li><li>Odabiranjem JEDEC-a "
+"vraćate stare jedinice koje su se koristile u KDE-u 3.5 i u nekim drugim "
+"operacijskim sustavima.</li></p>"
 
 #. +> trunk stable

kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmnic.po

@@ -3 +3 @@
 # Andrej Dundović <adundovi@gmail.com>, 2009.
 # DoDo <DoDoEntertainment@gmail.com>, 2009.
+# Marko Dimjašević <marko@dimjasevic.net>, 2011.
 msgid ""
 msgstr ""
@@ -8 +9 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-01-11 10:25+0100\n"
-"PO-Revision-Date: 2009-08-11 16:29+0200\n"
-"Last-Translator: DoDo <DoDoEntertainment@gmail.com>\n"
+"PO-Revision-Date: 2011-07-12 17:37+0200\n"
+"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
 "MIME-Version: 1.0\n"
@@ -15 +16 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Language: hr\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
-"X-Generator: Lokalize 0.3\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Generator: Lokalize 1.2\n"
 "X-Environment: kde\n"
 "X-Accelerator-Marker: &\n"
@@ -73 +75 @@
 #. +> trunk stable
 #: nic.cpp:112
-#, fuzzy
 #| msgid "KDE Panel System Information Control Module"
 msgid "System Information Control Module"
-msgstr "KDE panel – Upravljački modul podataka o sustavu"
+msgstr "Upravljački modul za informacije o sustavu"
 
 #. +> trunk stable

kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmopengl.po

@@ -2 +2 @@
 #
 # Zarko Pintar <zarko.pintar@gmail.com>, 2009.
+# Marko Dimjašević <marko@dimjasevic.net>, 2011.
 msgid ""
 msgstr ""
@@ -7 +8 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-07-08 10:22+0200\n"
-"PO-Revision-Date: 2009-08-25 08:28+0200\n"
-"Last-Translator: Zarko Pintar <zarko.pintar@gmail.com>\n"
+"PO-Revision-Date: 2011-07-12 17:42+0200\n"
+"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
 "MIME-Version: 1.0\n"
@@ -14 +15 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Language: hr\n"
-"X-Generator: Lokalize 0.3\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Generator: Lokalize 1.2\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
 "X-Environment: kde\n"
 "X-Accelerator-Marker: &\n"
@@ -263 +265 @@
 #. +> trunk stable
 #: opengl.cpp:580
-#, fuzzy
 #| msgid "OpenGL version"
 msgid "OpenGL/ES version"
-msgstr "openGL verzija"
+msgstr "Inačica OpenGL/ES-a"
 
 #. +> trunk stable
@@ -275 +276 @@
 #. +> trunk stable
 #: opengl.cpp:587
-#, fuzzy
 #| msgid "OpenGL extensions"
 msgid "OpenGL/ES extensions"
-msgstr "OpenGL proširenja"
+msgstr "OpenGL/ES-proširenja"
 
 #. +> trunk stable
@@ -303 +303 @@
 #: opengl.cpp:606
 msgid "server GLX extensions"
-msgstr "Proširenja GLX posluşitelja"
+msgstr "Posluşiteljska GLX-proširenja"
 
 #. +> trunk stable
@@ -318 +318 @@
 #: opengl.cpp:611
 msgid "client GLX extensions"
-msgstr "Proširenja GLX klijenta"
+msgstr "Klijentska GLX-proširenja"
 
 #. +> trunk stable
 #: opengl.cpp:613
 msgid "GLX extensions"
-msgstr "GLX proširenja"
+msgstr "GLX-proširenja"
 
 #. +> trunk stable
@@ -338 +338 @@
 #: opengl.cpp:618
 msgid "GLU extensions"
-msgstr "GLU proširenja"
+msgstr "GLU-proširenja"
 
 #. +> trunk stable
 #: opengl.cpp:627
-#, fuzzy
 #| msgid "GLX"
 msgid "EGL"
-msgstr "GLX"
+msgstr "EGL"
 
 #. +> trunk stable
 #: opengl.cpp:628
-#, fuzzy
 #| msgid "Vendor"
 msgid "EGL Vendor"
-msgstr "Proizvođač"
+msgstr "Razvijatelj EGL-a"
 
 #. +> trunk stable
 #: opengl.cpp:629
-#, fuzzy
 #| msgid "GLU version"
 msgid "EGL Version"
-msgstr "GLU verzija"
+msgstr "Inačica EGL-a"
 
 #. +> trunk stable
 #: opengl.cpp:630
-#, fuzzy
 #| msgid "GLX extensions"
 msgid "EGL Extensions"
-msgstr "GLX proširenja"
+msgstr "EGL-proširenja"
 
 #. +> trunk stable
@@ -390 +386 @@
 #. +> trunk stable
 #: opengl.cpp:865
-#, fuzzy
 #| msgid "Could not initialize OpenGL"
 msgid "Could not initialize OpenGL ES2.0"
-msgstr "Ne mogu inicijalizirati OpenGL"
+msgstr "Ne mogu inicijalizirati OpenGL ES2.0"
 
 #. i18n: ectx: property (text), widget (QTreeWidget, glinfoTreeWidget)

kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmstyle.po

@@ -7 +7 @@
 # Andrej Dundovic <adundovi@gmail.com>, 2009.
 # Andrej Dundović <adundovi@gmail.com>, 2009.
+# Marko Dimjašević <marko@dimjasevic.net>, 2011.
 msgid ""
 msgstr ""
@@ -12 +13 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-01-11 10:25+0100\n"
-"PO-Revision-Date: 2009-12-09 08:24+0100\n"
-"Last-Translator: Andrej Dundović <adundovi@gmail.com>\n"
+"PO-Revision-Date: 2011-07-12 17:43+0200\n"
+"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
 "MIME-Version: 1.0\n"
@@ -19 +20 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Language: hr\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
-"X-Generator: Lokalize 1.0\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Generator: Lokalize 1.2\n"
 "X-Environment: kde\n"
 "X-Accelerator-Marker: &\n"
@@ -28 +30 @@
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
-msgstr "Denis Lackovic, Goran Åœugelj, Mato Kutlić, Robert Sedak, Roko Roic, Vlatko Kosturjak, Oliver Mucafir, Andrej Dundović"
+msgstr ""
+"Denis Lackovic, Goran Åœugelj, Mato Kutlić, Robert Sedak, Roko Roic, Vlatko "
+"Kosturjak, Oliver Mucafir, Andrej Dundović"
 
 #. +> trunk stable
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr "lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, oliver.untwist@gmail.com, adundovi@gmail.com"
+msgstr ""
+"lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, "
+"lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, oliver."
+"untwist@gmail.com, adundovi@gmail.com"
 
 #. i18n: ectx: property (text), widget (QLabel, label_4)
@@ -102 +109 @@
 #. +> trunk stable
 #: kcmstyle.cpp:165
-msgid "<h1>Style</h1>This module allows you to modify the visual appearance of user interface elements, such as the widget style and effects."
-msgstr "<h1>Stil</h1>Ovaj modul dopušta vam mijenjati izgled elemenata korisničkog sučelja, kao što su stilovi ukrasa i efekti."
+msgid ""
+"<h1>Style</h1>This module allows you to modify the visual appearance of user "
+"interface elements, such as the widget style and effects."
+msgstr ""
+"<h1>Stil</h1>Ovaj modul dopušta vam mijenjati izgled elemenata korisničkog "
+"sučelja, kao što su stilovi ukrasa i efekti."
 
 #. +> trunk stable
@@ -195 +206 @@
 #: kcmstyle.cpp:297 kcmstyle.cpp:308
 msgid "There was an error loading the configuration dialog for this style."
-msgstr "Došlo je do greške prilikom učitavanja dijaloga za podešavanje ovog stila."
+msgstr ""
+"Došlo je do greške prilikom učitavanja dijaloga za podešavanje ovog stila."
 
 #. +> trunk stable
@@ -205 +217 @@
 #: kcmstyle.cpp:382
 #, fuzzy
-msgid "<p>Changes to the visibility of menu icons will only affect newly started applications.</p>"
-msgstr "<p>Neke izmjene, poput postavki DPI-a, imat će učinak samo na novo pokrenutim aplikacijama.</p>"
+msgid ""
+"<p>Changes to the visibility of menu icons will only affect newly started "
+"applications.</p>"
+msgstr ""
+"<p>Neke izmjene, poput postavki DPI-a, imat će učinak samo na novo pokrenutim "
+"aplikacijama.</p>"
 
 #. +> trunk stable
@@ -228 +244 @@
 #. +> trunk stable
 #: kcmstyle.cpp:734
-msgid "Here you can choose from a list of predefined widget styles (e.g. the way buttons are drawn) which may or may not be combined with a theme (additional information like a marble texture or a gradient)."
-msgstr "Ovdje moÅŸete odabrati jedan od unaprijed definiranih stilova ukrasa(izgled komponenti kao Å¡to su gumbi, padajući meniji
).Ovo se moÅŸe kombinirati s temom (koja dodaje dodatne efekte kao Å¡to su pozadine ili prijelazi boja)"
+msgid ""
+"Here you can choose from a list of predefined widget styles (e.g. the way "
+"buttons are drawn) which may or may not be combined with a theme (additional "
+"information like a marble texture or a gradient)."
+msgstr ""
+"Ovdje moÅŸete odabrati jedan od unaprijed definiranih stilova ukrasa(izgled "
+"komponenti kao Å¡to su gumbi, padajući meniji
).Ovo se moÅŸe kombinirati s "
+"temom (koja dodaje dodatne efekte kao Å¡to su pozadine ili prijelazi boja)"
 
 #. +> trunk stable
 #: kcmstyle.cpp:738
-msgid "This area shows a preview of the currently selected style without having to apply it to the whole desktop."
-msgstr "Ovdje moşete vidjeti pregled trenutno odabaranog stila prije nego ga primjenite na cijelu radnu površinu."
+msgid ""
+"This area shows a preview of the currently selected style without having to "
+"apply it to the whole desktop."
+msgstr ""
+"Ovdje moÅŸete vidjeti pregled trenutno odabaranog stila prije nego ga "
+"primjenite na cijelu radnu površinu."
 
 #. +> trunk stable
@@ -243 +269 @@
 #. +> trunk stable
 #: kcmstyle.cpp:742
-msgid "<p><b>No Text:</b> Shows only icons on toolbar buttons. Best option for low resolutions.</p><p><b>Text Only: </b>Shows only text on toolbar buttons.</p><p><b>Text Beside Icons: </b> Shows icons and text on toolbar buttons. Text is aligned beside the icon.</p><b>Text Below Icons: </b> Shows icons and text on toolbar buttons. Text is aligned below the icon."
-msgstr "<p><b>Bez teksta:</b> Prikazuje samo ikone na gumbima alatne trake. Najbolji izbor za niske rezolucije.</p><p><b>Samo tekst: </b>Prikazuje samo tekst gumbima alatne trake.</p><p><b>Tekst uz ikone: </b> Prikazuje ikone i tekst na gumbima alatne trake. Tekst je pokraj ikone.</p><b>Tekst ispod ikona: </b> Prikazuje ikone i tekst na gumbima alatne trake. Tekst je ispod ikone."
+msgid ""
+"<p><b>No Text:</b> Shows only icons on toolbar buttons. Best option for low "
+"resolutions.</p><p><b>Text Only: </b>Shows only text on toolbar buttons.</p><"
+"p><b>Text Beside Icons: </b> Shows icons and text on toolbar buttons. Text is "
+"aligned beside the icon.</p><b>Text Below Icons: </b> Shows icons and text on "
+"toolbar buttons. Text is aligned below the icon."
+msgstr ""
+"<p><b>Bez teksta:</b> Prikazuje samo ikone na gumbima alatne trake. Najbolji "
+"izbor za niske rezolucije.</p><p><b>Samo tekst: </b>Prikazuje samo tekst "
+"gumbima alatne trake.</p><p><b>Tekst uz ikone: </b> Prikazuje ikone i tekst "
+"na gumbima alatne trake. Tekst je pokraj ikone.</p><b>Tekst ispod ikona: </b> "
+"Prikazuje ikone i tekst na gumbima alatne trake. Tekst je ispod ikone."
 
 #. +> trunk stable
 #: kcmstyle.cpp:749
-msgid "If you enable this option, KDE Applications will show small icons alongside some important buttons."
-msgstr "Ako uključite ovu mogućnost, KDE Aplikacije će prikazati male ikone uz neke vaÅŸne gumbe."
+msgid ""
+"If you enable this option, KDE Applications will show small icons alongside "
+"some important buttons."
+msgstr ""
+"Ako uključite ovu mogućnost, KDE Aplikacije će prikazati male ikone uz neke "
+"vaÅŸne gumbe."
 
 #. +> trunk stable
 #: kcmstyle.cpp:751
-#, fuzzy
 #| msgid "If you enable this option, KDE Applications will show small icons alongside some important buttons."
-msgid "If you enable this option, KDE Applications will show small icons alongside most menu items."
-msgstr "Ako uključite ovu mogućnost, KDE Aplikacije će prikazati male ikone uz neke vaÅŸne gumbe."
+msgid ""
+"If you enable this option, KDE Applications will show small icons alongside "
+"most menu items."
+msgstr ""
+"Ako uključite ovu mogućnost, KDE-aplikacije će prikazati male ikone uz većinu "
+"izbornih stavki."
 
 #. +> trunk stable
 #: kcmstyle.cpp:753
-msgid "If you enable this option, KDE Applications will run internal animations."
-msgstr "Ako uključite ovu mogućnost, KDE Aplikacije će pokrenuti interne animacije."
+msgid ""
+"If you enable this option, KDE Applications will run internal animations."
+msgstr ""
+"Ako uključite ovu mogućnost, KDE Aplikacije će pokrenuti interne animacije."
 
 #. +> trunk stable

kde-croatia/kde4/summit/hr/summit/messages/kdebase/kurifilter.po

@@ -3 +3 @@
 # DoDo <DoDoEntertainment@gmail.com>, 2009.
 # Marko Dimjasevic <marko@dimjasevic.net>, 2011.
+# Marko Dimjašević <marko@dimjasevic.net>, 2011.
 msgid ""
 msgstr ""
@@ -8 +9 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-01-11 10:25+0100\n"
-"PO-Revision-Date: 2011-03-04 19:21+0100\n"
-"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
+"PO-Revision-Date: 2011-07-12 17:47+0200\n"
+"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
 "MIME-Version: 1.0\n"
@@ -16 +17 @@
 "Language: hr\n"
 "X-Generator: Lokalize 1.2\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
 "X-Environment: kde\n"
 "X-Accelerator-Marker: &\n"
@@ -40 +42 @@
 #, fuzzy
 #| msgid "<p>In this module you can configure the web shortcuts feature. Web shortcuts allow you to quickly search or lookup words on the Internet. For example, to search for information about the KDE project using the Google engine, you simply type <b>gg:KDE</b> or <b>google:KDE</b>.</p><p>If you select a default search engine, normal words or phrases will be looked up at the specified search engine by simply typing them into applications, such as Konqueror, that have built-in support for such a feature.</p>"
-msgid "<p>In this module you can configure the web shortcuts feature. Web shortcuts allow you to quickly search or lookup words on the Internet. For example, to search for information about the KDE project using the Google engine, you simply type <b>gg:KDE</b> or <b>google:KDE</b>.</p><p>If you select a default search engine, then you can search for normal words or phrases by simply typing them into the input widget of applications that have built-in support for such a feature, e.g Konqueror.</p>"
-msgstr "<p>U ovom modulu moÅŸete konfigurirati web prečace. Web prečaci Vam omogućuju brzo pretraÅŸivanje Interneta. Na primjer, za traÅŸenje informacija o KDE projektu pomoću Google traÅŸilice, jednostavno upiÅ¡ete <b>gg:KDE</b> ili <b>google:KDE</b>.</p> <p>Ako odaberete uobičajenu traÅŸilicu, normalne riječi i fraze će se traÅŸiti pomoću te traÅŸilice ako samo upiÅ¡ete navedene u aplikacije poput Konquerora koje podrÅŸavaju web prečace.</p>"
+msgid ""
+"<p>In this module you can configure the web shortcuts feature. Web shortcuts "
+"allow you to quickly search or lookup words on the Internet. For example, to "
+"search for information about the KDE project using the Google engine, you "
+"simply type <b>gg:KDE</b> or <b>google:KDE</b>.</p><p>If you select a default "
+"search engine, then you can search for normal words or phrases by simply "
+"typing them into the input widget of applications that have built-in support "
+"for such a feature, e.g Konqueror.</p>"
+msgstr ""
+"<p>U ovom modulu moÅŸete konfigurirati web prečace. Web prečaci Vam omogućuju "
+"brzo pretraÅŸivanje Interneta. Na primjer, za traÅŸenje informacija o KDE "
+"projektu pomoću Google traÅŸilice, jednostavno upiÅ¡ete <b>gg:KDE</b> ili <b>"
+"google:KDE</b>.</p> <p>Ako odaberete uobičajenu traşilicu, normalne riječi i "
+"fraze će se traÅŸiti pomoću te traÅŸilice ako samo upiÅ¡ete navedene u "
+"aplikacije poput Konquerora koje podrşavaju web prečace.</p>"
 
 #. i18n: ectx: property (whatsThis), widget (QCheckBox, cbEnableShortcuts)
@@ -48 +63 @@
 msgid ""
 "<qt>\n"
-"Enable shortcuts that allow you to quickly search for information on the web. For example, entering the shortcut <b>gg:KDE</b> will result in a search for the word <b>KDE</b> on the Google(TM) search engine.\n"
-"</qt>"
-msgstr ""
-"<qt>\n"
-"Omogućite prečace koji Vam omogućuju brzo pretraÅŸivanje informacija na Internetu- Na primjer, unoÅ¡enjem prečice <b>gg:KDE</b> će rezultirati traÅŸenjem riječi <b>KDE</b> na Google(TM) traÅŸilici.\n"
+"Enable shortcuts that allow you to quickly search for information on the web. "
+"For example, entering the shortcut <b>gg:KDE</b> will result in a search for "
+"the word <b>KDE</b> on the Google(TM) search engine.\n"
+"</qt>"
+msgstr ""
+"<qt>\n"
+"Omogućite prečace koji Vam omogućuju brzo pretraÅŸivanje informacija na "
+"Internetu- Na primjer, unošenjem prečice <b>gg:KDE</b> će rezultirati "
+"traşenjem riječi <b>KDE</b> na Google(TM) traşilici.\n"
 "</qt>"
 
@@ -64 +83 @@
 #. +> trunk stable
 #: ikwsopts_ui.ui:32
-#, fuzzy
 msgid "&Use selected shortcuts only"
-msgstr "Pomakni prema lijevo"
+msgstr "Koristi sam&o odabrane prečace"
 
 #. i18n: ectx: property (whatsThis), widget (QPushButton, pbNew)
@@ -110 +128 @@
 msgid ""
 "<qt>\n"
-"Select the search engine to use for input boxes that provide automatic lookup services when you type in normal words and phrases instead of a URL. To disable this feature select <b>None</b> from the list.\n"
-"</qt>"
-msgstr ""
-"<qt>\n"
-"Odaberite traÅŸilicu za koriÅ¡tenje u poljima koja pruÅŸaju uslugu automatske pretrage dok unosite tekst u njih umjesto URL-a. Za isključenje te mogućnosti, odaberite <b>NiÅ¡ta</b> iz popisa.\n"
+"Select the search engine to use for input boxes that provide automatic lookup "
+"services when you type in normal words and phrases instead of a URL. To "
+"disable this feature select <b>None</b> from the list.\n"
+"</qt>"
+msgstr ""
+"<qt>\n"
+"Odaberite traşilicu za korištenje u poljima koja pruşaju uslugu automatske "
+"pretrage dok unosite tekst u njih umjesto URL-a. Za isključenje te "
+"mogućnosti, odaberite <b>Ništa</b> iz popisa.\n"
 "</qt>"
 
@@ -127 +149 @@
 #. +> trunk stable
 #: ikwsopts_ui.ui:176 ikwsopts_ui.ui:198
-msgid "Choose the delimiter that separates the keyword from the phrase or word to be searched."
-msgstr "Odaberite razdvojnik koji razdvaja ključnu riječ od fraze ili riječi koja se pretraşuje."
+msgid ""
+"Choose the delimiter that separates the keyword from the phrase or word to be "
+"searched."
+msgstr ""
+"Odaberite razdvojnik koji razdvaja ključnu riječ od fraze ili riječi koja se "
+"pretraÅŸuje."
 
 #. i18n: ectx: property (text), widget (QLabel, lbDelimiter)
@@ -150 +176 @@
 #. +> trunk stable
 #: kuriikwsfilter.cpp:125
-#, fuzzy
 msgid "No preferred search providers were found."
-msgstr "nije pronađen valjani rukovoditelj pretraÅŸivanja."
+msgstr "Nije pronađen ni jedan preferirani pretraÅŸivački pruÅŸatelj."
 
 #. +> trunk stable
 #: kuriikwsfilter.cpp:144
-#, fuzzy
 msgid "No search providers were found."
-msgstr "Nova pretraga za pruÅŸateljem usluga"
+msgstr "Nije pronađen ni jedan pretraÅŸivački pruÅŸatelj."
 
 #. +> trunk stable
@@ -182 +206 @@
 #. +> trunk stable
 #: searchproviderdlg.cpp:106
-#, fuzzy, kde-format
-msgid "The shortcut \"%1\" is already assigned to \"%2\". Please choose a different one."
-msgstr "Nadimak je već u upotrebi. Odaberite drugi nadimak."
+#, kde-format
+msgid ""
+"The shortcut \"%1\" is already assigned to \"%2\". Please choose a different "
+"one."
+msgstr ""
+"Prečac \"%1\" je već pridruÅŸen na \"%2\". Molim odaberite drugačiji prečac."
 
 #. +> trunk stable
@@ -205 +232 @@
 msgid ""
 "The URI does not contain a \\{...} placeholder for the user query.\n"
-"This means that the same page is always going to be visited, regardless of what the user types."
+"This means that the same page is always going to be visited, regardless of "
+"what the user types."
 msgstr ""
 "URI ne sadrÅŸi \\
} oznaku za korisnički upit.\n"
@@ -238 +266 @@
 msgid ""
 "<qt>\n"
-"Enter the URI that is used to perform a search on the search engine here.<br/>The whole text to be searched for can be specified as \\{@} or \\{0}.<br/>\n"
-"Recommended is \\{@}, since it removes all query variables (name=value) from the resulting string, whereas \\{0} will be substituted with the unmodified query string.<br/>You can use \\{1} ... \\{n} to specify certain words from the query and \\{name} to specify a value given by 'name=value' in the user query.<br/>In addition it is possible to specify multiple references (names, numbers and strings) at once (\\{name1,name2,...,\"string\"}).<br/>The first matching value (from the left) will be used as the substitution value for the resulting URI.<br/>A quoted string can be used as the default value if nothing matches from the left of the reference list.\n"
-"</qt>"
-msgstr ""
-"<qt>\n"
-"Ovdje unesite URI koji se koristi za traÅŸenje na traÅŸilici.<br/> Cijeli tekst za pretragu se moÅŸe odrediti kao \\{@} ili \\{0}.<br/> \n"
-"Preporučeno je \\{@}, jer on ukloni sve varijable upita (ime=vrijednost) iz rezultata, dok će \\{0} biti zamijenjen sa nepromijenjenim upitom.<br/> MoÅŸete koristiti \\{1}
 \\{n} za specificiranje određenih riječi iz upita i \\{ime} za specificiranje vrijednosti dobivene kao 'ime=vrijednost' iz korisničkog upita.<br/> Također je moguće specificirati viÅ¡e referenci (imena, brojevi i tekstovi) odjednom (\\{ime1, ime2,
, \"neki nekst\"}).<br/> Prva podudarna vrijednost (s lijeva) će se koristiti kao zamjenska vrijednost za rezultirajući URI.<br/> Tekst pod navodnicima se moÅŸe koristiti kao uobičajena vrijednost ako se niÅ¡ta iz referentnog popisa ne podudara s lijeva.\n"
+"Enter the URI that is used to perform a search on the search engine here.<br/>"
+"The whole text to be searched for can be specified as \\{@} or \\{0}.<br/>\n"
+"Recommended is \\{@}, since it removes all query variables (name=value) from "
+"the resulting string, whereas \\{0} will be substituted with the unmodified "
+"query string.<br/>You can use \\{1} ... \\{n} to specify certain words from "
+"the query and \\{name} to specify a value given by 'name=value' in the user "
+"query.<br/>In addition it is possible to specify multiple references (names, "
+"numbers and strings) at once (\\{name1,name2,...,\"string\"}).<br/>The first "
+"matching value (from the left) will be used as the substitution value for the "
+"resulting URI.<br/>A quoted string can be used as the default value if "
+"nothing matches from the left of the reference list.\n"
+"</qt>"
+msgstr ""
+"<qt>\n"
+"Ovdje unesite URI koji se koristi za traÅŸenje na traÅŸilici.<br/> Cijeli tekst "
+"za pretragu se moÅŸe odrediti kao \\{@} ili \\{0}.<br/> \n"
+"Preporučeno je \\{@}, jer on ukloni sve varijable upita (ime=vrijednost) iz "
+"rezultata, dok će \\{0} biti zamijenjen sa nepromijenjenim upitom.<br/> "
+"MoÅŸete koristiti \\{1}
 \\{n} za specificiranje određenih riječi iz upita i "
+"\\{ime} za specificiranje vrijednosti dobivene kao 'ime=vrijednost' iz "
+"korisničkog upita.<br/> Također je moguće specificirati više referenci "
+"(imena, brojevi i tekstovi) odjednom (\\{ime1, ime2,
, \"neki nekst\"}).<br/> "
+"Prva podudarna vrijednost (s lijeva) će se koristiti kao zamjenska vrijednost "
+"za rezultirajući URI.<br/> Tekst pod navodnicima se moÅŸe koristiti kao "
+"uobičajena vrijednost ako se ništa iz referentnog popisa ne podudara s lijeva."
+"\n"
 "</qt>"
 
@@ -261 +308 @@
 msgid ""
 "<qt>\n"
-"The shortcuts entered here can be used as a pseudo-URI scheme in KDE. For example, the shortcut <b>av</b> can be used as in <b>av</b>:<b>my search</b>\n"
-"</qt>"
-msgstr ""
-"<qt>\n"
-"Ovdje uneseni prečaci mogu biti korišteni kao polu-URI shema u KDE-u. Na primjer, prečac <b>av</b> moşe biti korišten kao u <b>av</b>:<b>moja pretraga</b>\n"
+"The shortcuts entered here can be used as a pseudo-URI scheme in KDE. For "
+"example, the shortcut <b>av</b> can be used as in <b>av</b>:<b>my search</b>\n"
+"</qt>"
+msgstr ""
+"<qt>\n"
+"Ovdje uneseni prečaci mogu biti korišteni kao polu-URI shema u KDE-u. Na "
+"primjer, prečac <b>av</b> moşe biti korišten kao u <b>av</b>:<b>moja "
+"pretraga</b>\n"
 "</qt>"
 
@@ -278 +328 @@
 #: searchproviderdlg_ui.ui:119
 msgid "Select the character set that will be used to encode your search query"
-msgstr "Odaberite skup znakova koji će biti koriÅ¡ten za kodiranje VaÅ¡eg upita traÅŸilici"
+msgstr ""
+"Odaberite skup znakova koji će biti korišten za kodiranje Vašeg upita "
+"traÅŸilici"
 
 #. i18n: ectx: property (text), widget (QLabel, lbCharset)
@@ -290 +342 @@
 #: searchproviderdlg_ui.ui:141
 msgid "Select the character set that will be used to encode your search query."
-msgstr "Odaberite skup znakova koji će biti koriÅ¡ten za kodiranje VaÅ¡eg upita traÅŸilici."
+msgstr ""
+"Odaberite skup znakova koji će biti korišten za kodiranje Vašeg upita "
+"traÅŸilici."
 
 #~ msgid "<p>In this module you can configure the web shortcuts feature. Web shortcuts allow you to quickly search or lookup words on the Internet. For example, to search for information about the KDE project using the Google engine, you simply type <b>gg:KDE</b> or <b>google:KDE</b>.</p><p>If you select a default search engine, normal words or phrases will be looked up at the specified search engine by simply typing them into applications, such as Konqueror, that have built-in support for such a feature.</p>"

kde-croatia/kde4/summit/hr/summit/messages/kdebase/kwin.po

@@ -12 +12 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-07-10 07:56+0200\n"
-"PO-Revision-Date: 2011-04-20 22:35+0200\n"
+"PO-Revision-Date: 2011-07-12 17:48+0200\n"
 "Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
@@ -19 +19 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Language: hr\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
 "X-Generator: Lokalize 1.2\n"
 "X-Poedit-Bookmarks: 110,-1,-1,-1,-1,-1,-1,-1,-1,-1\n"
@@ -34 +35 @@
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr "renato@translator-shop.org, zarko.pintar@gmail.com, adundovi@gmail.com, marko@dimjasevic.net"
+msgstr ""
+"renato@translator-shop.org, zarko.pintar@gmail.com, adundovi@gmail.com, "
+"marko@dimjasevic.net"
 
 #. +> trunk stable
@@ -45 +48 @@
 #: composite.cpp:279
 #, kde-format
-msgid "Desktop effects have been suspended by another application.<br/>You can resume using the '%1' shortcut."
-msgstr "Druga je aplikacija obustavila efekte radne povrÅ¡ine.<br/>MoÅŸete ih vratiti koristeći prečac '%1'."
+msgid ""
+"Desktop effects have been suspended by another application.<br/>You can "
+"resume using the '%1' shortcut."
+msgstr ""
+"Druga je aplikacija obustavila efekte radne površine.<br/>Moşete ih vratiti "
+"koristeći prečac '%1'."
 
 #. +> stable
@@ -52 +59 @@
 msgid ""
 "Desktop effects were too slow and have been suspended.\n"
-"You can disable functionality checks in System Settings (on the Advanced tab in Desktop Effects)."
+"You can disable functionality checks in System Settings (on the Advanced tab "
+"in Desktop Effects)."
 msgstr ""
 "3D efekti bili su prespori pa su obustavljeni.\n"
-"MoÅŸete onemogućiti provjere funkcionalnosti u Postavkama sustava (unutar kartice Napredno kod 3D efekata)."
+"MoÅŸete onemogućiti provjere funkcionalnosti u Postavkama sustava (unutar "
+"kartice Napredno kod 3D efekata)."
 
 #. +> stable
@@ -62 +71 @@
 msgid ""
 "Desktop effects were too slow and have been suspended.\n"
-"If this was only a temporary problem, you can resume using the '%1' shortcut.\n"
-"You can disable functionality checks in System Settings (on the Advanced tab in Desktop Effects)."
+"If this was only a temporary problem, you can resume using the '%1' shortcut."
+"\n"
+"You can disable functionality checks in System Settings (on the Advanced tab "
+"in Desktop Effects)."
 msgstr ""
 "3D efekti bili su prespori pa su obustavljeni.\n"
 "Ako je ovo samo privremeni problem, moÅŸete ih vratiti koristeći prečac '%1'.\n"
-"Također moÅŸete onemogućiti provjere funkcionalnosti u Postavkama sustava (unutar kartice Napredno kod 3D efekata)."
+"Također moÅŸete onemogućiti provjere funkcionalnosti u Postavkama sustava "
+"(unutar kartice Napredno kod 3D efekata)."
 
 #. +> trunk stable
 #: compositingprefs.cpp:108
-msgid "<b>OpenGL compositing (the default) has crashed KWin in the past.</b><br>This was most likely due to a driver bug.<p>If you think that you have meanwhile upgraded to a stable driver,<br>you can reset this protection but <b>be aware that this might result in an immediate crash!</b></p><p>Alternatively, you might want to use the XRender backend instead.</p>"
+msgid ""
+"<b>OpenGL compositing (the default) has crashed KWin in the past.</b><br>This "
+"was most likely due to a driver bug.<p>If you think that you have meanwhile "
+"upgraded to a stable driver,<br>you can reset this protection but <b>be aware "
+"that this might result in an immediate crash!</b></p><p>Alternatively, you "
+"might want to use the XRender backend instead.</p>"
 msgstr ""
 
@@ -86 +103 @@
 #. +> trunk stable
 #: compositingprefs.cpp:123
-msgid "XRender/XFixes extensions are not available and only XRender support is compiled."
+msgid ""
+"XRender/XFixes extensions are not available and only XRender support is "
+"compiled."
 msgstr "XRender/XFixes proširenja nisu dostupna, podrşan je samo XRender."
 
@@ -151 +170 @@
 #: killer/killer.cpp:70
 #, kde-format
-msgid "<p>The window \"<b>%2</b>\" is not responding. It belongs to the application <b>%1</b> (Process ID = %3, hostname = %4).</p><p>Do you wish to terminate the application process <em>including <b>all</b> of its child windows</em>?<br /><b>Any unsaved data will be lost.</b></p>"
-msgstr "<p>Prozor \"<b>%2</b>\" nema odziva. Pripada aplikaciji <b>%1</b> (Proces ID = %3, ime računala = %4).</p><p>Da li ÅŸelite prekinuti proces ove aplikacije <em>uključujući <b>sve</b> prozore koji joj pripadaju</em>?<br /><b>Svi nespremljeni podaci biti će izgubljeni.</b></p>"
+msgid ""
+"<p>The window \"<b>%2</b>\" is not responding. It belongs to the application "
+"<b>%1</b> (Process ID = %3, hostname = %4).</p><p>Do you wish to terminate "
+"the application process <em>including <b>all</b> of its child windows</em>?<"
+"br /><b>Any unsaved data will be lost.</b></p>"
+msgstr ""
+"<p>Prozor \"<b>%2</b>\" nema odziva. Pripada aplikaciji <b>%1</b> (Proces ID "
+"= %3, ime računala = %4).</p><p>Da li şelite prekinuti proces ove aplikacije "
+"<em>uključujući <b>sve</b> prozore koji joj pripadaju</em>?<br /><b>Svi "
+"nespremljeni podaci biti će izgubljeni.</b></p>"
 
 #. +> trunk stable
@@ -382 +409 @@
 #. +> trunk stable
 #: kwinbindings.cpp:147
-#, fuzzy, kde-format
+#, kde-format
 #| msgid "Window to Desktop 1"
 msgid "Window to Desktop %1"
-msgstr "Prozor na radnu površinu 1"
+msgstr "Prozor na radnu površinu %1"
 
 #. +> trunk stable
@@ -419 +446 @@
 #. +> trunk stable
 #: kwinbindings.cpp:157
-#, fuzzy, kde-format
+#, kde-format
 #| msgid "Window to Screen 1"
 msgid "Window to Screen %1"
-msgstr "Prozor na zaslon 1"
+msgstr "Prozor na zaslon %1"
 
 #. +> trunk stable
@@ -441 +468 @@
 #. +> trunk stable
 #: kwinbindings.cpp:169
-#, fuzzy, kde-format
+#, kde-format
 msgid "Switch to Desktop %1"
 msgstr "Prebaci na radnu površinu %1"
@@ -477 +504 @@
 #. +> trunk stable
 #: kwinbindings.cpp:180
-#, fuzzy, kde-format
+#, kde-format
 #| msgid "Switch to Screen 1"
 msgid "Switch to Screen %1"
-msgstr "Prebaci na zaslon 1"
+msgstr "Prebaci na zaslon %1"
 
 #. +> trunk stable
@@ -579 +606 @@
 #. +> trunk stable
 #: main.cpp:179
-msgid "kwin: it looks like there's already a window manager running. kwin not started.\n"
-msgstr "kwin: izgleda da je upravitelj prozora već pokrenut. kwin nije pokrenut.\n"
+msgid ""
+"kwin: it looks like there's already a window manager running. kwin not "
+"started.\n"
+msgstr ""
+"kwin: izgleda da je upravitelj prozora već pokrenut. kwin nije pokrenut.\n"
 
 #. +> trunk stable
@@ -595 +625 @@
 #. +> trunk stable
 #: main.cpp:264
-msgid "kwin: unable to claim manager selection, another wm running? (try using --replace)\n"
-msgstr "kwin: ne mogu izvršiti zahtjev za odabir upravitelja, moşda je drugi upravitelj pokrenut? (pokušajte koristiti --replace)\n"
+msgid ""
+"kwin: unable to claim manager selection, another wm running? (try using "
+"--replace)\n"
+msgstr ""
+"kwin: ne mogu izvršiti zahtjev za odabir upravitelja, moşda je drugi "
+"upravitelj pokrenut? (pokušajte koristiti --replace)\n"
 
 #. +> trunk stable
@@ -915 +949 @@
 msgid ""
 "You have selected to show a window without its border.\n"
-"Without the border, you will not be able to enable the border again using the mouse: use the window operations menu instead, activated using the %1 keyboard shortcut."
+"Without the border, you will not be able to enable the border again using the "
+"mouse: use the window operations menu instead, activated using the %1 "
+"keyboard shortcut."
 msgstr ""
 "Odabrali ste prikazivanje prozora bez njegovog ruba.\n"
-"Bez ruba, nećete moći ponovo uključiti rub mišem. Umjesto toga upotrebite izbornik prozorskih operacija, koji se aktivira prečacom tipkovnice %1."
+"Bez ruba, nećete moći ponovo uključiti rub mišem. Umjesto toga upotrebite "
+"izbornik prozorskih operacija, koji se aktivira prečacom tipkovnice %1."
 
 #. +> trunk stable
@@ -925 +962 @@
 msgid ""
 "You have selected to show a window in fullscreen mode.\n"
-"If the application itself does not have an option to turn the fullscreen mode off you will not be able to disable it again using the mouse: use the window operations menu instead, activated using the %1 keyboard shortcut."
+"If the application itself does not have an option to turn the fullscreen mode "
+"off you will not be able to disable it again using the mouse: use the window "
+"operations menu instead, activated using the %1 keyboard shortcut."
 msgstr ""
 "Odabrali ste prikazivanje prozora preko cijelog zaslona.\n"
-"Ako sâm program nema opciju da se način rada preko cijelog zaslona isključi, nećete ga moći isključiti upotrebom miša. Umjesto toga upotrebite izbornik prozorskih operacija, koji se aktivira prečacom tipkovnice %1."
+"Ako sâm program nema opciju da se način rada preko cijelog zaslona isključi, "
+"nećete ga moći isključiti upotrebom miša. Umjesto toga upotrebite izbornik "
+"prozorskih operacija, koji se aktivira prečacom tipkovnice %1."
 
 #~ msgid "Window to Desktop 1"

kde-croatia/kde4/summit/hr/summit/messages/kdebase/kwin_clients.po

@@ -12 +12 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-07-08 10:23+0200\n"
-"PO-Revision-Date: 2011-03-14 20:32+0100\n"
+"PO-Revision-Date: 2011-07-12 17:49+0200\n"
 "Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
@@ -20 +20 @@
 "Language: hr\n"
 "X-Generator: Lokalize 1.2\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
 "X-Environment: kde\n"
 "X-Accelerator-Marker: &\n"
@@ -152 +153 @@
 #. +> trunk stable
 #: b2/config/config.cpp:61
-msgid "When selected, the window borders are drawn using the titlebar colors; otherwise, they are drawn using normal border colors."
-msgstr "Kada je označeno, rubovi prozora iscrtavati će se koristeći boje naslovne trake; inače će se iscrtavati koristeći uobićajene boje ruba."
+msgid ""
+"When selected, the window borders are drawn using the titlebar colors; "
+"otherwise, they are drawn using normal border colors."
+msgstr ""
+"Kada je označeno, rubovi prozora iscrtavati će se koristeći boje naslovne "
+"trake; inače će se iscrtavati koristeći uobićajene boje ruba."
 
 #. +> trunk stable
@@ -162 +167 @@
 #. +> trunk stable
 #: b2/config/config.cpp:69
-msgid "When selected, decorations are drawn with a \"grab handle\" in the bottom right corner of the windows; otherwise, no grab handle is drawn."
-msgstr "Kada je označeno, ukrasi će biti iscrtani sa \"oznakom uhvati\" u donjem desnom kutu prozora; inače se neće iscratvati oznaka hvatanja."
+msgid ""
+"When selected, decorations are drawn with a \"grab handle\" in the bottom "
+"right corner of the windows; otherwise, no grab handle is drawn."
+msgstr ""
+"Kada je označeno, ukrasi će biti iscrtani sa \"oznakom uhvati\" u donjem "
+"desnom kutu prozora; inače se neće iscratvati oznaka hvatanja."
 
 #. +> trunk stable
@@ -172 +181 @@
 #. +> trunk stable
 #: b2/config/config.cpp:77
-msgid "When selected, titlebars are automatically relocated to visible positions; otherwise, they are only moved manually using shift+drag."
-msgstr "Kad je odabrano, naslovne su trake automatski relocirane na vidljive pozicije; u suprotnom, moguće ih je samo ručno pomicati koristeći shift+povlačenje."
+msgid ""
+"When selected, titlebars are automatically relocated to visible positions; "
+"otherwise, they are only moved manually using shift+drag."
+msgstr ""
+"Kad je odabrano, naslovne su trake automatski relocirane na vidljive "
+"pozicije; u suprotnom, moguće ih je samo ručno pomicati koristeći "
+"shift+povlačenje."
 
 #. +> trunk stable
@@ -207 +221 @@
 #. +> trunk stable
 #: b2/config/config.cpp:93
-msgid "An action can be associated to a double click of the menu button. Leave it to none if in doubt."
-msgstr "Radnja moşe biti pridruşena dvostrukom kliku gumba izbornika. Ostavite na ništa ako se dvoumite."
+msgid ""
+"An action can be associated to a double click of the menu button. Leave it to "
+"none if in doubt."
+msgstr ""
+"Radnja moÅŸe biti pridruÅŸena dvostrukom kliku gumba izbornika. Ostavite na "
+"ništa ako se dvoumite."
 
 #. +> trunk stable
@@ -217 +235 @@
 #. +> trunk
 #: oxygen/config/oxygenconfigurationui.cpp:145
-#, fuzzy
 msgid "Hide Advanced Configuration Options"
-msgstr "Izvorni kod"
+msgstr "Sakrij napredne opcije podešavanja"
 
 #. +> trunk
 #: oxygen/config/oxygenconfigurationui.cpp:145
-#, fuzzy
 msgid "Show Advanced Configuration Options"
-msgstr "Nema opcija za konfiguriranje"
+msgstr "Prikaşi napredne opcije podešavanja"
 
 #. +> trunk stable
@@ -792 +808 @@
 #. +> trunk stable
 #: plastik/config/configdialog.ui:53
-msgid "Check this option if the window border should be painted in the titlebar color. Otherwise it will be painted in the background color."
-msgstr "Označite ovu opciju kako bi rub prozora bio obojan u boju naslovne trake. Inače će biti obojan u boju pozadine."
+msgid ""
+"Check this option if the window border should be painted in the titlebar "
+"color. Otherwise it will be painted in the background color."
+msgstr ""
+"Označite ovu opciju kako bi rub prozora bio obojan u boju naslovne trake. "
+"Inače će biti obojan u boju pozadine."
 
 #. i18n: ectx: property (text), widget (QCheckBox, coloredBorder)
@@ -804 +824 @@
 #. +> trunk stable
 #: plastik/config/configdialog.ui:66
-msgid "Check this option if you want the titlebar text to have a 3D look with a shadow behind it."
-msgstr "Označite ovu opciju ako şelite da tekst naslovne trake ima 3D izgled sa sjenom ispod. "
+msgid ""
+"Check this option if you want the titlebar text to have a 3D look with a "
+"shadow behind it."
+msgstr ""
+"Označite ovu opciju ako şelite da tekst naslovne trake ima 3D izgled sa "
+"sjenom ispod. "
 
 #. i18n: ectx: property (text), widget (QCheckBox, titleShadow)
@@ -816 +840 @@
 #. +> trunk stable
 #: plastik/config/configdialog.ui:76
-msgid "Check this option if you want the buttons to fade in when the mouse pointer hovers over them and fade out again when it moves away."
-msgstr "Označite ovu opciju ako ÅŸelite da se gumbi naglase kada se prijeđe preko njih miÅ¡em i ponovo izblijede kada se miÅ¡ makne."
+msgid ""
+"Check this option if you want the buttons to fade in when the mouse pointer "
+"hovers over them and fade out again when it moves away."
+msgstr ""
+"Označite ovu opciju ako ÅŸelite da se gumbi naglase kada se prijeđe preko njih "
+"mišem i ponovo izblijede kada se miš makne."
 
 #. i18n: ectx: property (text), widget (QCheckBox, animateButtons)
@@ -828 +856 @@
 #. +> trunk stable
 #: plastik/config/configdialog.ui:86
-msgid "Check this option if you want windows to be closed when you double click the menu button, similar to Microsoft Windows."
-msgstr "Označite ovu opciju ako şelite da se prozori zatvore kada dvaput kliknete na gumb izbornika, slično kao u Microsoft Windows-ima."
+msgid ""
+"Check this option if you want windows to be closed when you double click the "
+"menu button, similar to Microsoft Windows."
+msgstr ""
+"Označite ovu opciju ako şelite da se prozori zatvore kada dvaput kliknete na "
+"gumb izbornika, slično kao u Microsoft Windows-ima."
 
 #. i18n: ectx: property (text), widget (QCheckBox, menuClose)

kde-croatia/kde4/summit/hr/summit/messages/kdebase/kwin_effects.po

@@ -12 +12 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-07-08 10:23+0200\n"
-"PO-Revision-Date: 2011-03-14 20:48+0100\n"
+"PO-Revision-Date: 2011-07-12 17:50+0200\n"
 "Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
@@ -19 +19 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Language: hr\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
 "X-Generator: Lokalize 1.2\n"
 "X-Environment: kde\n"
@@ -202 +203 @@
 #. +> trunk stable
 #: coverswitch/coverswitch_config.ui:187
-msgid "Only show thumbnail bar if there are at least specified number of windows"
+msgid ""
+"Only show thumbnail bar if there are at least specified number of windows"
 msgstr "PrikaÅŸi traku sa sličicama samo ako postoji neki određeni broj prozora"
 
@@ -414 +416 @@
 #: cube/cube_config.ui:411
 msgid ""
-"If enabled the effect will be deactivated after rotating the cube with the mouse,\n"
+"If enabled the effect will be deactivated after rotating the cube with the "
+"mouse,\n"
 "otherwise it will remain active"
 msgstr ""
@@ -1456 +1459 @@
 #: zoom/zoom_config.ui:25 zoom/zoom_config.ui:41
 msgid "On zoom-in and zoom-out change the zoom by the defined zoom-factor."
-msgstr "Pri pribliÅŸavanju ili udaljavanju promijeni zoom za definirani faktor zumiranja."
+msgstr ""
+"Pri pribliÅŸavanju ili udaljavanju promijeni zoom za definirani faktor "
+"zumiranja."
 
 #. i18n: ectx: property (text), widget (QLabel, label)
@@ -1467 +1472 @@
 #. +> trunk stable
 #: zoom/zoom_config.ui:66
-msgid "Enable tracking of the focused location. This needs QAccessible to be enabled per application (\"export QT_ACCESSIBILITY=1\")."
-msgstr "Omogući praćenje fokusirane lokacije. Za ovo treba biti omogućeno QAccessible po aplikaciji (\"export QT_ACCESSIBILITY=1\")."
+msgid ""
+"Enable tracking of the focused location. This needs QAccessible to be enabled "
+"per application (\"export QT_ACCESSIBILITY=1\")."
+msgstr ""
+"Omogući praćenje fokusirane lokacije. Za ovo treba biti omogućeno QAccessible "
+"po aplikaciji (\"export QT_ACCESSIBILITY=1\")."
 
 #. i18n: ectx: property (text), widget (QCheckBox, focusTrackingCheckBox)
@@ -1539 +1548 @@
 #. +> trunk stable
 #: zoom/zoom_config.ui:138
-#, fuzzy
 msgid "Push"
-msgstr "Pushto"
+msgstr "Guranje"
 
 #. i18n: ectx: property (text), item, widget (QComboBox, mouseTrackingComboBox)

kde-croatia/kde4/summit/hr/summit/messages/kdebase/kxkb.po

@@ -3 +3 @@
 # DoDo <DoDoEntertainment@gmail.com>, 2009.
 # Andrej Dundovic <adundovi@gmail.com>, 2009, 2010.
+# Marko Dimjašević <marko@dimjasevic.net>, 2011.
 msgid ""
 msgstr ""
@@ -8 +9 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-07-08 10:23+0200\n"
-"PO-Revision-Date: 2010-03-18 11:06+0100\n"
-"Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
+"PO-Revision-Date: 2011-07-12 17:54+0200\n"
+"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
 "MIME-Version: 1.0\n"
@@ -15 +16 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Language: hr\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
-"X-Generator: Lokalize 1.0\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Generator: Lokalize 1.2\n"
 "X-Environment: kde\n"
 "X-Accelerator-Marker: &\n"
@@ -23 +25 @@
 #. +> trunk stable
 #: flags.cpp:132
-#, fuzzy, kde-format
+#, kde-format
 msgctxt "short layout label - full layout name"
 msgid "%1 - %2"
-msgstr "%1 – %2"
+msgstr "%1 - %2"
 
 #. +> trunk stable
 #: flags.cpp:140
-#, fuzzy, kde-format
+#, kde-format
 msgctxt "layout - variant"
 msgid "%1 - %2"
-msgstr "%1 – %2"
+msgstr "%1 - %2"
 
 #. +> trunk stable
@@ -58 +60 @@
 #. +> trunk stable
 #: kcm_keyboard.cpp:58
-msgid "<h1>Keyboard</h1> This control module can be used to configure keyboard parameters and layouts."
-msgstr "<h1>Tipkovnica</h1> Ovaj kontrolni modul moşe biti korišten za podešavanje parametara i rasporeda tipkovnice."
+msgid ""
+"<h1>Keyboard</h1> This control module can be used to configure keyboard "
+"parameters and layouts."
+msgstr ""
+"<h1>Tipkovnica</h1> Ovaj kontrolni modul moşe biti korišten za podešavanje "
+"parametara i rasporeda tipkovnice."
 
 #. +> trunk stable
@@ -69 +75 @@
 #. +> trunk stable
 #: kcm_keyboard_widget.cpp:203
-#, fuzzy, kde-format
+#, kde-format
 #| msgctxt "vendor, keyboard model"
 #| msgid "%1 | %2"
@@ -78 +84 @@
 #. +> trunk stable
 #: kcm_keyboard_widget.cpp:213
-#, fuzzy, kde-format
+#, kde-format
 msgid "Only up to %1 keyboard layout is supported"
 msgid_plural "Only up to %1 keyboard layouts are supported"
-msgstr[0] "PodrÅŸane su samo lokalne datoteke."
-msgstr[1] "PodrÅŸane su samo lokalne datoteke."
-msgstr[2] "PodrÅŸane su samo lokalne datoteke."
+msgstr[0] "PodrÅŸano je samo do %1 raspored tipkovnice"
+msgstr[1] "PodrÅŸano je samo do %1 rasporeda tipkovnice"
+msgstr[2] "PodrÅŸano je samo do %1 rasporeda tipkovnice"
 
 #. +> trunk stable
 #: kcm_keyboard_widget.cpp:561
-#, fuzzy
 msgctxt "no shortcuts defined"
 msgid "None"
@@ -94 +99 @@
 #. +> trunk stable
 #: kcm_keyboard_widget.cpp:577
-#, fuzzy, kde-format
+#, kde-format
 #| msgid "%1 shortcuts"
 msgid "%1 shortcut"
 msgid_plural "%1 shortcuts"
 msgstr[0] "%1 prečac"
-msgstr[1] "%1 prečac"
-msgstr[2] "%1 prečac"
-
-#. +> trunk stable
-#: kcm_view_models.cpp:225
-#, fuzzy
+msgstr[1] "%1 prečaca"
+msgstr[2] "%1 prečaca"
+
+#. +> trunk stable
+#: kcm_view_models.cpp:225
 #| msgid "Map"
 msgctxt "layout map name"
 msgid "Map"
-msgstr "Mapiranje"
+msgstr "Preslikavanje"
 
 #. +> trunk stable
@@ -127 +131 @@
 #. +> trunk stable
 #: kcm_view_models.cpp:225
-#, fuzzy
 msgid "Shortcut"
 msgstr "Prečac"
@@ -133 +136 @@
 #. +> trunk stable
 #: keyboard_applet.cpp:52
-#, fuzzy
 msgid "XKB extension failed to initialize"
-msgstr "Biblioteka libsmbclient nije uspješno inicijalizirana."
+msgstr "XKB-ovo proširenje nije se uspjelo inicijalizirati"
 
 #. +> trunk stable
 #: layout_tray_icon.cpp:46 layout_tray_icon.cpp:47
-#, fuzzy
 #| msgid "Keyboard Layout"
 msgctxt "tooltip title"

kde-croatia/kde4/summit/hr/summit/messages/kdebase/libkdecorations.po

@@ -3 +3 @@
 # Zarko Pintar <zarko.pintar@gmail.com>, 2009.
 # Andrej Dundovic <adundovi@gmail.com>, 2010.
+# Marko Dimjašević <marko@dimjasevic.net>, 2011.
 msgid ""
 msgstr ""
@@ -8 +9 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-07-08 10:23+0200\n"
-"PO-Revision-Date: 2010-05-30 16:30+0200\n"
-"Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
+"PO-Revision-Date: 2011-07-12 17:55+0200\n"
+"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
 "MIME-Version: 1.0\n"
@@ -15 +16 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Language: hr\n"
-"X-Generator: Lokalize 1.0\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Generator: Lokalize 1.2\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
 "X-Environment: kde\n"
 "X-Accelerator-Marker: &\n"
@@ -101 +103 @@
 #. +> trunk stable
 #: kdecoration_plugins_p.cpp:109
-#, fuzzy
 #| msgid "No window decoration plugin library was found."
 msgid "Loading of window decoration plugin library disabled in configuration."
-msgstr "Nije pronađen priključak biblioteke za dekoraciju prozora."
+msgstr ""
+"U postavkama je onemogućeno učitavanje biblioteki za priključke za dekoraciju "
+"prozora."
 
 #. +> trunk stable

kde-croatia/kde4/summit/hr/summit/messages/kdebase/libplasmaclock.po

@@ -4 +4 @@
 # Andrej Dundovic <andrej@dundovic.com.hr>, 2009, 2010.
 # Marko Dimjasevic <marko@dimjasevic.net>, 2010, 2011.
+# Marko Dimjašević <marko@dimjasevic.net>, 2011.
 msgid ""
 msgstr ""
@@ -9 +10 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-07-08 10:23+0200\n"
-"PO-Revision-Date: 2011-02-15 16:31+0100\n"
-"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
+"PO-Revision-Date: 2011-07-12 17:57+0200\n"
+"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
 "MIME-Version: 1.0\n"
@@ -16 +17 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Language: hr\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
 "X-Generator: Lokalize 1.2\n"
 "X-Environment: kde\n"
@@ -49 +51 @@
 #. +> trunk stable
 #: calendartable.cpp:663
-#, fuzzy, kde-format
+#, kde-format
 msgctxt "Not day off: Holiday name (holiday region)"
 msgid "%1 (%2)"
@@ -56 +58 @@
 #. +> trunk stable
 #: calendartable.cpp:672
-#, fuzzy, kde-format
+#, kde-format
 #| msgid "<i>Event</i>: %1<br>"
 msgid "<i>Event</i>: %1"
-msgstr "<i>Događaj</i>: %1<br>"
+msgstr "<i>Događaj</i>: %1"
 
 #. +> trunk stable
 #: calendartable.cpp:679
-#, fuzzy, kde-format
+#, kde-format
 #| msgid "<i>Todo</i>: %1<br>"
 msgid "<i>Todo</i>: %1"
-msgstr "<i>Za napraviti</i>: %1<br>"
+msgstr "<i>Za napraviti</i>: %1"
 
 #. +> trunk stable
@@ -73 +75 @@
 msgctxt "All-day calendar event summary"
 msgid "<br>%1"
-msgstr ""
+msgstr "<br>%1"
 
 #. +> trunk stable
@@ -80 +82 @@
 msgctxt "Time and summary for a calendarevent"
 msgid "%1<br>%2"
-msgstr ""
+msgstr "%1<br>%2"
 
 #. +> trunk stable
 #: calendartable.cpp:701
-#, fuzzy, kde-format
+#, kde-format
 msgctxt "Start and end time and summary for a calendar event"
 msgid "%1 - %2<br>%3"
-msgstr ""
-"Qt: %1\n"
-"KDE: %2\n"
-"%3: %4\n"
+msgstr "%1 - %2<br>%3"
 
 #. +> trunk stable
@@ -130 +129 @@
 #: clockapplet.cpp:218
 #, kde-format
-msgctxt "Text sent to the text to speech service when minutes==0 and it is the 24 hour clock"
+msgctxt ""
+"Text sent to the text to speech service when minutes==0 and it is the 24 hour "
+"clock"
 msgid "It is 1 o clock"
 msgid_plural "It is %1 o clock"
@@ -242 +243 @@
 #: timezonesConfig.ui:43
 msgid ""
-"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n"
-"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n"
+"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3."
+"org/TR/REC-html40/strict.dtd\">\n"
+"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">"
+"\n"
 "p, li { white-space: pre-wrap; }\n"
-"</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; font-weight:400; font-style:normal;\">\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Your <span style=\" font-weight:600;\">Local</span> time and time zone are defined in System Settings, in the Date and Time tab. As default, your plasma clock will use this setting.</p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">The plasma clock tooltip can display the time in several other time zones: to do so, select one or several more time zones in the list. Click on a line to select it and click on it again to deselect it. </p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">After you validate your choices with the OK button, when your mouse is over the clock, a tooltip will display the time in all the selected time zones.</p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">To select a <span style=\" font-weight:600;\">Default</span> time zone: you can either scroll over the clock with your mouse wheel and set the one you want or you can set it with \"Clock defaults to:\". .</p></body></html>"
+"</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; "
+"font-weight:400; font-style:normal;\">\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Your <span style=\" "
+"font-weight:600;\">Local</span> time and time zone are defined in System "
+"Settings, in the Date and Time tab. As default, your plasma clock will use "
+"this setting.</p>\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">The plasma clock "
+"tooltip can display the time in several other time zones: to do so, select "
+"one or several more time zones in the list. Click on a line to select it and "
+"click on it again to deselect it. </p>\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">After you validate "
+"your choices with the OK button, when your mouse is over the clock, a tooltip "
+"will display the time in all the selected time zones.</p>\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">To select a <span "
+"style=\" font-weight:600;\">Default</span> time zone: you can either scroll "
+"over the clock with your mouse wheel and set the one you want or you can set "
+"it with \"Clock defaults to:\". .</p></body></html>"
 msgstr ""
-"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n"
-"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n"
+"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3."
+"org/TR/REC-html40/strict.dtd\">\n"
+"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">"
+"\n"
 "p, li { white-space: pre-wrap; }\n"
-"</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; font-weight:400; font-style:normal;\">\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Vaše <span style=\" font-weight:600;\">lokalno</span> vrijeme i vremenska zona su definirane u Postavkama sustava, u kartici Datum i vrijeme. Uobičajeno će plasma-sat koristiti te postavke.</p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Iskočna pomoć plasma-sata moÅŸe prikazivati vrijeme iz nekoliko drugih vremenskih zona: da biste to postigli, odaberite jednu ili viÅ¡e vremenskih zona iz popisa. Kliknite na liniju za odabir iste i kliknite ponovo na nju da biste uklonili odabir iste. </p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Nakon što potvrdite svoj odabir gumbom 'U redu', svaki put kad se pokazivač miša nađe iznad sata, pojavit će se iskočna pomoć s prikazom vremena u odabranim vremenskim zonama.</p>\n"
-"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Za odabrati <span style=\" font-weight:600;\">uobičajenu</span> vremensku zonu: kotačićem miÅ¡a moÅŸete klizati iznad sata i postaviti vremensku zonu koju ÅŸelite ili je postaviti s \"Uobičajena vremenska zona:\".</p></body></html>"
+"</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; "
+"font-weight:400; font-style:normal;\">\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Vaše <span style=\" "
+"font-weight:600;\">lokalno</span> vrijeme i vremenska zona su definirane u "
+"Postavkama sustava, u kartici Datum i vrijeme. Uobičajeno će plasma-sat "
+"koristiti te postavke.</p>\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Iskočna pomoć "
+"plasma-sata moÅŸe prikazivati vrijeme iz nekoliko drugih vremenskih zona: da "
+"biste to postigli, odaberite jednu ili više vremenskih zona iz popisa. "
+"Kliknite na liniju za odabir iste i kliknite ponovo na nju da biste uklonili "
+"odabir iste. </p>\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Nakon Å¡to potvrdite "
+"svoj odabir gumbom 'U redu', svaki put kad se pokazivač miša nađe iznad sata, "
+"pojavit će se iskočna pomoć s prikazom vremena u odabranim vremenskim zonama."
+"</p>\n"
+"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Za odabrati <span "
+"style=\" font-weight:600;\">uobičajenu</span> vremensku zonu: kotačićem miša "
+"moÅŸete klizati iznad sata i postaviti vremensku zonu koju ÅŸelite ili je "
+"postaviti s \"Uobičajena vremenska zona:\".</p></body></html>"
 
 #. i18n: ectx: property (text), widget (QLabel, label)

kde-croatia/kde4/summit/hr/summit/messages/kdebase/plasma-desktop.po

@@ -5 +5 @@
 # Marko Dimjasevic <marko@dimjasevic.net>, 2009, 2010, 2011.
 # Andrej Dundovic <andrej@dundovic.com.hr>, 2009, 2010.
+# Marko Dimjašević <marko@dimjasevic.net>, 2011.
 msgid ""
 msgstr ""
@@ -10 +11 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-07-08 10:23+0200\n"
-"PO-Revision-Date: 2011-02-18 18:14+0100\n"
-"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
+"PO-Revision-Date: 2011-07-12 17:58+0200\n"
+"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
 "MIME-Version: 1.0\n"
@@ -18 +19 @@
 "Language: hr\n"
 "X-Generator: Lokalize 1.2\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
 "X-Environment: kde\n"
 "X-Accelerator-Marker: &\n"
@@ -134 +136 @@
 #. +> trunk stable
 #: data/plasma-shell-desktop.kcfg:15
-msgid "Set to true if each virtual desktop should get its own, unique Plasma view."
-msgstr "Postavite na uključeno ako şelite da svaka virtualna radna površina ima svoj posebni Plasma izgled."
+msgid ""
+"Set to true if each virtual desktop should get its own, unique Plasma view."
+msgstr ""
+"Postavite na uključeno ako şelite da svaka virtualna radna površina ima svoj "
+"posebni Plasma izgled."
 
 #. +> trunk stable
@@ -219 +224 @@
 #: main.cpp:42
 msgid "The KDE desktop, panels and widgets workspace application."
-msgstr "Aplikacija za KDE-ov radni prostor s widgetima, panelima i radnom površinom."
+msgstr ""
+"Aplikacija za KDE-ov radni prostor s widgetima, panelima i radnom površinom."
 
 #. +> trunk stable
@@ -304 +310 @@
 #: panelcontroller.cpp:191
 msgid "Press left mouse button and drag to a screen edge to change panel edge"
-msgstr "Pritisnite lijevi gumb miša i vucite prema rubu zaslona kako biste promijenili rub panela"
+msgstr ""
+"Pritisnite lijevi gumb miša i vucite prema rubu zaslona kako biste "
+"promijenili rub panela"
 
 #. +> trunk stable
@@ -314 +322 @@
 #: panelcontroller.cpp:197
 msgid "Press left mouse button and drag vertically to change panel height"
-msgstr "Pritisnite lijevi gumb miša i vucite vertikalno kako biste promijenili visinu panela"
+msgstr ""
+"Pritisnite lijevi gumb miša i vucite vertikalno kako biste promijenili visinu "
+"panela"
 
 #. +> trunk stable
@@ -324 +334 @@
 #: panelcontroller.cpp:206
 msgid "Show more options about panel alignment, visibility and other settings"
-msgstr "Prikaşi više opcija o poravnanju panela, vidljivosti i drugim postavkama"
+msgstr ""
+"Prikaşi više opcija o poravnanju panela, vidljivosti i drugim postavkama"
 
 #. +> trunk stable
@@ -344 +355 @@
 #: panelcontroller.cpp:275
 msgid "Add a spacer to the panel useful to add some space between two widgets"
-msgstr "Dodaj razmak u panel koji se koristi za stvaranje prostora između widgeta"
+msgstr ""
+"Dodaj razmak u panel koji se koristi za stvaranje prostora između widgeta"
 
 #. +> trunk stable
@@ -381 +393 @@
 #: plasmaapp.cpp:1350
 #, kde-format
-msgid "A new widget has become available on the network:<br><b>%1</b> - <i>%2</i>"
+msgid ""
+"A new widget has become available on the network:<br><b>%1</b> - <i>%2</i>"
 msgstr "Novi widget je postao dostupan na mreÅŸi:<br><b>%1</b> – <i>%2</i>"
 
 #. +> trunk stable
 #: plasmaapp.cpp:1361
-#, fuzzy
 #| msgid "Add to current activity"
 msgid "Unlock and add to current activity"
-msgstr "Dodaj trenutnu aktivnost"
+msgstr "Otključaj i dodaj u trenutnu aktivnost"
 
 #. +> trunk stable
@@ -398 +410 @@
 #. +> trunk stable
 #: plasmaapp.cpp:1425
-#, fuzzy
 msgid "Run applications"
-msgstr "Dodaj aplikacije"
+msgstr "Pokreni aplikacije"
 
 #. +> trunk stable
 #: plasmaapp.cpp:1426
 msgid "This activity template requests to run the following applications"
-msgstr ""
+msgstr "Ovaj predloÅŸak aktivnosti zahtijeva pokretanje sljedećih aplikacija"
 
 #. +> trunk stable
 #: plasmaapp.cpp:1427
-#, fuzzy
 msgid "Run selected"
-msgstr "Sve odabrano"
+msgstr "Pokreni odabrane"
 
 #. +> trunk stable
 #: plasmaapp.cpp:1428
-#, fuzzy
 msgid "Run none"
-msgstr "Način rada rada"
+msgstr "Ništa ne pokreći"
 
 #. +> trunk stable

kde-croatia/kde4/summit/hr/summit/messages/kdebase/plasma_applet_folderview.po

@@ -5 +5 @@
 # Andrej Dundović <adundovi@gmail.com>, 2009.
 # Marko Dimjasevic <marko@dimjasevic.net>, 2010.
+# Marko Dimjašević <marko@dimjasevic.net>, 2011.
 msgid ""
 msgstr ""
@@ -10 +11 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-07-08 10:23+0200\n"
-"PO-Revision-Date: 2010-07-22 18:42+0200\n"
-"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
+"PO-Revision-Date: 2011-07-12 17:59+0200\n"
+"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
 "MIME-Version: 1.0\n"
@@ -17 +18 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Language: hr\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
-"X-Generator: Lokalize 1.0\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Generator: Lokalize 1.2\n"
 "X-Environment: kde\n"
 "X-Accelerator-Marker: &\n"
@@ -25 +27 @@
 #. +> trunk stable
 #: folderview.cpp:616
-#, fuzzy
 msgid "Title"
 msgstr "Naslov"
@@ -32 +33 @@
 #: folderview.cpp:618 folderview.cpp:620 folderview.cpp:2030
 #: folderview.cpp:2032
-#, fuzzy
 msgid "None"
-msgstr "Nijedan"
+msgstr "Ništa"
 
 #. +> trunk stable
 #: folderview.cpp:618 folderview.cpp:621 folderview.cpp:2034
-#, fuzzy
 msgid "Default"
-msgstr "Uobičajeno"
+msgstr "Zadano"
 
 #. +> trunk stable
 #: folderview.cpp:618 folderview.cpp:622 folderview.cpp:2037
-#, fuzzy
 msgid "Full path"
-msgstr "Å irina &celog zaslona"
+msgstr "Cijela putanja"
 
 #. +> trunk stable
@@ -76 +74 @@
 #. +> trunk stable
 #: folderview.cpp:678
-msgctxt "Title of the page that lets the user choose which location should the folderview show"
+msgctxt ""
+"Title of the page that lets the user choose which location should the "
+"folderview show"
 msgid "Location"
 msgstr "Mjesto"
@@ -82 +82 @@
 #. +> trunk stable
 #: folderview.cpp:679
-msgctxt "Title of the page that lets the user choose how the folderview should be shown"
+msgctxt ""
+"Title of the page that lets the user choose how the folderview should be shown"
 msgid "Display"
 msgstr "Prikaz"
@@ -88 +89 @@
 #. +> trunk stable
 #: folderview.cpp:680
-msgctxt "Title of the page that lets the user choose how to filter the folderview contents"
+msgctxt ""
+"Title of the page that lets the user choose how to filter the folderview "
+"contents"
 msgid "Filter"
 msgstr "Filtar"
@@ -246 +249 @@
 #. +> trunk stable
 #: folderviewDisplayConfig.ui:116
-msgid "Use this control to choose if you want the icons to be arranged top to bottom starting on the left side of the view, or arranged left to right starting at the top of the view."
-msgstr "Koristite ovu kontrolu za odabir razmještaja ikona. Ŝelite li da se ikone razmjeste odozgo prema dolje s lijeve strane pogleda ili s lijeva na desno s početkom na vrhu?"
+msgid ""
+"Use this control to choose if you want the icons to be arranged top to bottom "
+"starting on the left side of the view, or arranged left to right starting at "
+"the top of the view."
+msgstr ""
+"Koristite ovu kontrolu za odabir razmještaja ikona. Ŝelite li da se ikone "
+"razmjeste odozgo prema dolje s lijeve strane pogleda ili s lijeva na desno s "
+"početkom na vrhu?"
 
 #. i18n: ectx: property (text), widget (QLabel, label)
@@ -258 +267 @@
 #. +> trunk stable
 #: folderviewDisplayConfig.ui:136
-msgid "Use this control to choose the criteria by which the icons will be sorted in the view."
-msgstr "Koristite ovu kontrolu za odabir kriterija po kojem će se ikone sortirati u prikazu."
+msgid ""
+"Use this control to choose the criteria by which the icons will be sorted in "
+"the view."
+msgstr ""
+"Koristite ovu kontrolu za odabir kriterija po kojem će se ikone sortirati u "
+"prikazu."
 
 #. i18n: ectx: property (text), widget (QLabel, label_4)
@@ -276 +289 @@
 #. +> trunk stable
 #: folderviewDisplayConfig.ui:181
-msgid "Use this slider to increase or decrease the size of the icons in the view."
+msgid ""
+"Use this slider to increase or decrease the size of the icons in the view."
 msgstr "Koristite ovaj klizač za povećanje/smanjenje veličine ikona u pogledu."
 
@@ -294 +308 @@
 #. +> trunk stable
 #: folderviewDisplayConfig.ui:224
-msgid "Check this option if you want to see previews of the file contents in the icons."
-msgstr "Uključite ovu opciju ako şelite vidjeti pretpreglede sadrşaja datoteka u ikonama."
+msgid ""
+"Check this option if you want to see previews of the file contents in the "
+"icons."
+msgstr ""
+"Uključite ovu opciju ako şelite vidjeti pretpreglede sadrşaja datoteka u "
+"ikonama."
 
 #. i18n: ectx: property (whatsThis), widget (QPushButton, previewsAdvanced)
 #. +> trunk stable
 #: folderviewDisplayConfig.ui:234
-msgid "Click this button to choose for which types of files previews will be shown."
-msgstr "Kliknite na ovaj gumb da biste odabrali koje za koje tipove datoteka će biti prikazani pretpregledi."
+msgid ""
+"Click this button to choose for which types of files previews will be shown."
+msgstr ""
+"Kliknite na ovaj gumb da biste odabrali koje za koje tipove datoteka će biti "
+"prikazani pretpregledi."
 
 #. i18n: ectx: property (text), widget (QPushButton, previewsAdvanced)
@@ -321 +342 @@
 "Check this option if you do not want the icons to be moveable in the view.\n"
 "\n"
-"This option is useful if you want to avoid accidentally moving the icons while interacting with them."
+"This option is useful if you want to avoid accidentally moving the icons "
+"while interacting with them."
 msgstr ""
 "Uključite ovu opciju ako ne şelite da se ikone mogu premjestati po pogledu.\n"
 "\n"
-"Ova opcija je korisna ako şelite spriječiti nehotično pomicanje ikona dok klikate po njima."
+"Ova opcija je korisna ako şelite spriječiti nehotično pomicanje ikona dok "
+"klikate po njima."
 
 #. i18n: ectx: property (text), widget (QLabel, label_12)
@@ -339 +362 @@
 "Check this option if you want the icons to be arranged in a grid.\n"
 "\n"
-"When this option is checked, icons will automatically snap to the nearest grid cell when you move them around in the view."
+"When this option is checked, icons will automatically snap to the nearest "
+"grid cell when you move them around in the view."
 msgstr ""
 "Uključite ovu opciju ako şelite da se ikone razmjeste po mreşi.\n"
 "\n"
-"Kad je ta opcija uključena, ikone automatski skoće u najbliÅŸu ćeliju mreÅŸe dok ih pomičete po pogledu."
+"Kad je ta opcija uključena, ikone automatski skoće u najbliÅŸu ćeliju mreÅŸe "
+"dok ih pomičete po pogledu."
 
 #. i18n: ectx: property (text), widget (QLabel, label_9)
@@ -360 +385 @@
 #. +> trunk stable
 #: folderviewDisplayConfig.ui:341
-msgid "Use this control to choose how many lines of text will be shown below the icons."
-msgstr "Koristite ovu kontrolu za odabir koliko linija teksta će se prikazati ispod ikona."
+msgid ""
+"Use this control to choose how many lines of text will be shown below the "
+"icons."
+msgstr ""
+"Koristite ovu kontrolu za odabir koliko linija teksta će se prikazati ispod "
+"ikona."
 
 #. i18n: ectx: property (specialValueText), widget (KIntSpinBox, numLinesEdit)
@@ -384 +413 @@
 #. +> trunk stable
 #: folderviewDisplayConfig.ui:389
-msgid "Click this button to choose the color which is used for the text labels in the view."
-msgstr "Kliknite na ovaj gumb da biste odabrali boju koja će biti korištena za natpise u pogledu."
+msgid ""
+"Click this button to choose the color which is used for the text labels in "
+"the view."
+msgstr ""
+"Kliknite na ovaj gumb da biste odabrali boju koja će biti korištena za "
+"natpise u pogledu."
 
 #. i18n: ectx: property (text), widget (QLabel, label_10)
@@ -397 +430 @@
 #: folderviewDisplayConfig.ui:416
 msgid ""
-"<html><body><p>Check this option if you want the text labels to cast a shadow on the background.</p>\n"
+"<html><body><p>Check this option if you want the text labels to cast a shadow "
+"on the background.</p>\n"
 "<p></p>\n"
-"<p>Shadows help make the text easier to read by making it stand out more from the background.</p>\n"
+"<p>Shadows help make the text easier to read by making it stand out more from "
+"the background.</p>\n"
 "<p></p>\n"
-"<p><i>Note that with dark text colors, this option will cause the text to glow with a bright halo, instead of casting a shadow.</i></p></body></html>"
-msgstr ""
-"<html><body><p>Odaberite ovu opciju ako ÅŸelite da natpisi bacaju sjenu na pozadinu.</p>\n"
+"<p><i>Note that with dark text colors, this option will cause the text to "
+"glow with a bright halo, instead of casting a shadow.</i></p></body></html>"
+msgstr ""
+"<html><body><p>Odaberite ovu opciju ako ÅŸelite da natpisi bacaju sjenu na "
+"pozadinu.</p>\n"
 "<p></p>\n"
-"<p>Sjene olakšavaju čitanje teksta jer tekst izgleda kao da je \"blişe\" od pozadine.</p>\n"
+"<p>Sjene olakšavaju čitanje teksta jer tekst izgleda kao da je \"blişe\" od "
+"pozadine.</p>\n"
 "<p></p>\n"
-"<p><i>Primijetite da će sa tamnim bojama teksta ovaj efekt izazvati svijetljenje teksta umjesto bacanja sjene.</i></p></body></html>"
+"<p><i>Primijetite da će sa tamnim bojama teksta ovaj efekt izazvati "
+"svijetljenje teksta umjesto bacanja sjene.</i></p></body></html>"
 
 #. i18n: ectx: property (toolTip), widget (QComboBox, filterType)
@@ -413 +452 @@
 #: folderviewFilterConfig.ui:34
 msgid ""
-"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n"
-"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n"
+"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3."
+"org/TR/REC-html40/strict.dtd\">\n"
+"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">"
+"\n"
 "p, li { white-space: pre-wrap; }\n"
-"</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; font-weight:400; font-style:normal;\">\n"
-"<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">If you have selected \"Show Files Matching\" or \"Hide Files Matching\", only the files matching BOTH the conditions will be shown or hidden respectively.</p>\n"
-"<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">For example, if you have \"*\" as your pattern, but have nothing selected in the MIME types, no files will be shown.</p></body></html>"
-msgstr ""
-"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n"
-"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n"
+"</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; "
+"font-weight:400; font-style:normal;\">\n"
+"<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">If you have selected "
+"\"Show Files Matching\" or \"Hide Files Matching\", only the files matching "
+"BOTH the conditions will be shown or hidden respectively.</p>\n"
+"<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">For example, if you "
+"have \"*\" as your pattern, but have nothing selected in the MIME types, no "
+"files will be shown.</p></body></html>"
+msgstr ""
+"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3."
+"org/TR/REC-html40/strict.dtd\">\n"
+"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">"
+"\n"
 "p, li { white-space: pre-wrap; }\n"
-"</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; font-weight:400; font-style:normal;\">\n"
-"<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Ako ste odabrali \"PrikaÅŸi datoteke koje se podudaraju s\" ili \"Sakrij datoteke koje se podudaraju s\", samo će datoteke koje se podudaraju s oba uvjeta biti prikazane ili sakrivene.</p>\n"
-"<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Na primjer, ako imate \"*\" kao izraz, ali niste ništa odabrali u mimetipovima, ništa neće biti prikazano.</p></body></html>"
+"</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; "
+"font-weight:400; font-style:normal;\">\n"
+"<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Ako ste odabrali "
+"\"PrikaÅŸi datoteke koje se podudaraju s\" ili \"Sakrij datoteke koje se "
+"podudaraju s\", samo će datoteke koje se podudaraju s oba uvjeta biti "
+"prikazane ili sakrivene.</p>\n"
+"<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; "
+"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Na primjer, ako "
+"imate \"*\" kao izraz, ali niste ništa odabrali u mimetipovima, ništa neće "
+"biti prikazano.</p></body></html>"
 
 #. i18n: ectx: property (text), item, widget (QComboBox, filterType)
@@ -461 +519 @@
 #: folderviewFilterConfig.ui:112
 msgid ""
-"Note that if you have selected \"Show Files Matching\" or \"Hide Files Matching\",\n"
-"only the files matching BOTH the conditions will be shown or hidden respectively.\n"
-"For example, if you have \"*\" as your pattern, but have nothing selected in the MIME types, no files will be shown."
-msgstr ""
-"Primijetite da ko ste odabrali \"PrikaÅŸi datoteke koje se podudaraju s\" ili \"Sakrij datoteke koje se podudaraju s\", samo će datoteke koje se podudaraju s oba uvjeta biti prikazane ili sakrivene.\n"
+"Note that if you have selected \"Show Files Matching\" or \"Hide Files "
+"Matching\",\n"
+"only the files matching BOTH the conditions will be shown or hidden "
+"respectively.\n"
+"For example, if you have \"*\" as your pattern, but have nothing selected in "
+"the MIME types, no files will be shown."
+msgstr ""
+"Primijetite da ko ste odabrali \"PrikaÅŸi datoteke koje se podudaraju s\" ili "
+"\"Sakrij datoteke koje se podudaraju s\", samo će datoteke koje se podudaraju "
+"s oba uvjeta biti prikazane ili sakrivene.\n"
 "\n"
-"Na primjer, ako imate \"*\" kao izraz, ali niste ništa odabrali u mimetipovima, ništa neće biti prikazano."
+"Na primjer, ako imate \"*\" kao izraz, ali niste ništa odabrali u "
+"mimetipovima, ništa neće biti prikazano."
 
 #. i18n: ectx: property (text), widget (QLabel, label)
@@ -502 +566 @@
 #. +> trunk stable
 #: folderviewFilterConfig.ui:175
-msgid "Space-separated list of extensions, e.g. *.txt *.od* to display only office- and text-files"
-msgstr "Popis ekstenzija odvojen razmakom, npr. *.txt *.od* za prikaz samo tekstualnih i uredskih datoteka"
+msgid ""
+"Space-separated list of extensions, e.g. *.txt *.od* to display only office- "
+"and text-files"
+msgstr ""
+"Popis ekstenzija odvojen razmakom, npr. *.txt *.od* za prikaz samo "
+"tekstualnih i uredskih datoteka"
 
 #. i18n: ectx: property (clickMessage), widget (KLineEdit, filterFilesPattern)
@@ -571 +639 @@
 #. +> trunk stable
 #: tooltipwidget.cpp:143
-#, fuzzy, kde-format
+#, kde-format
 #| msgid "1 MPixel"
 #| msgid_plural "%1 MPixels"
 msgid "%1 MPixels"
-msgstr "%1 MegaPiksel"
+msgstr "%1 MegaPixela"
 
 #. +> trunk stable

kde-croatia/kde4/summit/hr/summit/messages/kdebase/plasma_applet_launcher.po

@@ -5 +5 @@
 # Andrej Dundovic <adundovi@gmail.com>, 2009, 2010.
 # Marko Dimjasevic <marko@dimjasevic.net>, 2010.
+# Marko Dimjašević <marko@dimjasevic.net>, 2011.
 msgid ""
 msgstr ""
@@ -10 +11 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-07-08 10:23+0200\n"
-"PO-Revision-Date: 2010-11-06 12:51+0100\n"
-"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
+"PO-Revision-Date: 2011-07-12 18:00+0200\n"
+"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
 "MIME-Version: 1.0\n"
@@ -17 +18 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Language: hr\n"
-"X-Generator: Lokalize 1.1\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Generator: Lokalize 1.2\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
 "X-Environment: kde\n"
 "X-Accelerator-Marker: &\n"
@@ -40 +42 @@
 #. +> trunk stable
 #: applet/applet.cpp:85
-msgid "Favorites, applications, computer places, recently used items and desktop sessions"
-msgstr "Omiljeno, aplikacije, mjesta na računalu, nedavno korištene stvari i sjednice radne površine"
+msgid ""
+"Favorites, applications, computer places, recently used items and desktop "
+"sessions"
+msgstr ""
+"Omiljeno, aplikacije, mjesta na računalu, nedavno korištene stvari i sjednice "
+"radne površine"
 
 #. +> trunk stable
@@ -110 +116 @@
 #. +> trunk stable
 #: core/leavemodel.cpp:55
-#, fuzzy
 #| msgid "Lock Screen"
 msgid "Lock screen"
@@ -117 +122 @@
 #. +> trunk stable
 #: core/leavemodel.cpp:57
-#, fuzzy
 msgid "Switch user"
 msgstr "Zamijeni korisnika"
@@ -144 +148 @@
 #. +> trunk stable
 #: core/leavemodel.cpp:67
-#, fuzzy
 msgid "Restart computer"
-msgstr "Ponovno pokretanje &računala"
+msgstr "Ponovo pokreni računalo"
 
 #. +> trunk stable
@@ -412 +415 @@
 #. +> trunk stable
 #: ui/contextmenufactory.cpp:236
-#, fuzzy
 msgid "Uninstall"
-msgstr "Odinstaliraj"
+msgstr "Ukloni"
 
 #. +> trunk stable

kde-croatia/kde4/summit/hr/summit/messages/kdebase/plasma_applet_system-monitor.po

@@ -4 +4 @@
 # Andrej Dundović <adundovi@gmail.com>, 2009.
 # Andrej Dundovic <adundovi@gmail.com>, 2010.
+# Marko Dimjašević <marko@dimjasevic.net>, 2011.
 msgid ""
 msgstr ""
@@ -9 +10 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-07-08 10:23+0200\n"
-"PO-Revision-Date: 2010-02-21 10:30+0100\n"
-"Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
+"PO-Revision-Date: 2011-07-12 18:00+0200\n"
+"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
 "MIME-Version: 1.0\n"
@@ -16 +17 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Language: hr\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
-"X-Generator: Lokalize 1.0\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Generator: Lokalize 1.2\n"
 "X-Environment: kde\n"
 "X-Accelerator-Marker: &\n"
@@ -188 +190 @@
 #. +> trunk stable
 #: temperature.cpp:97
-#, fuzzy
 msgid "Offset"
 msgstr "Pomak:"

kde-croatia/kde4/summit/hr/summit/messages/kdebase/plasma_engine_weather.po

@@ -11 +11 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-07-08 10:23+0200\n"
-"PO-Revision-Date: 2011-04-15 08:43+0200\n"
+"PO-Revision-Date: 2011-07-12 18:01+0200\n"
 "Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
@@ -19 +19 @@
 "Language: hr\n"
 "X-Generator: Lokalize 1.2\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
 "X-Environment: kde\n"
 "X-Accelerator-Marker: &\n"
@@ -2809 +2810 @@
 #. +> trunk stable
 #: ions/bbcukmet/ion_bbcukmet.cpp:923 ions/envcan/ion_envcan.cpp:1680
-#, fuzzy
 #| msgid "Sat"
 msgctxt "Short for Saturday"
@@ -2817 +2817 @@
 #. +> trunk stable
 #: ions/bbcukmet/ion_bbcukmet.cpp:927 ions/envcan/ion_envcan.cpp:1684
-#, fuzzy
 #| msgid "Sun"
 msgctxt "Short for Sunday"
@@ -2825 +2824 @@
 #. +> trunk stable
 #: ions/bbcukmet/ion_bbcukmet.cpp:931 ions/envcan/ion_envcan.cpp:1688
-#, fuzzy
 #| msgid "Mon"
 msgctxt "Short for Monday"
@@ -2833 +2831 @@
 #. +> trunk stable
 #: ions/bbcukmet/ion_bbcukmet.cpp:935 ions/envcan/ion_envcan.cpp:1692
-#, fuzzy
 #| msgid "Tue"
 msgctxt "Short for Tuesday"
@@ -2841 +2838 @@
 #. +> trunk stable
 #: ions/bbcukmet/ion_bbcukmet.cpp:939 ions/envcan/ion_envcan.cpp:1696
-#, fuzzy
 #| msgid "Wed"
 msgctxt "Short for Wednesday"
@@ -2849 +2845 @@
 #. +> trunk stable
 #: ions/bbcukmet/ion_bbcukmet.cpp:943 ions/envcan/ion_envcan.cpp:1700
-#, fuzzy
 #| msgid "Thu"
 msgctxt "Short for Thursday"
@@ -2857 +2852 @@
 #. +> trunk stable
 #: ions/bbcukmet/ion_bbcukmet.cpp:946 ions/envcan/ion_envcan.cpp:1703
-#, fuzzy
 #| msgid "Fri"
 msgctxt "Short for Friday"

kde-croatia/kde4/summit/hr/summit/messages/kdebase/plasmagenericshell.po

@@ -5 +5 @@
 # Andrej Dundovic <adundovi@gmail.com>, 2009, 2010.
 # Marko Dimjasevic <marko@dimjasevic.net>, 2010.
+# Marko Dimjašević <marko@dimjasevic.net>, 2011.
 msgid ""
 msgstr ""
@@ -10 +11 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-07-08 10:23+0200\n"
-"PO-Revision-Date: 2010-11-06 13:25+0100\n"
-"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
+"PO-Revision-Date: 2011-07-12 18:02+0200\n"
+"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
 "MIME-Version: 1.0\n"
@@ -17 +18 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Language: hr\n"
-"X-Generator: Lokalize 1.1\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Generator: Lokalize 1.2\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
 "X-Environment: kde\n"
 "X-Accelerator-Marker: &\n"
@@ -45 +47 @@
 #. +> trunk stable
 #: backgrounddialog.cpp:224
-msgid "This picture of a monitor contains a preview of what the current settings will look like on your desktop."
-msgstr "Slika zaslona sadrÅŸi prikaz na koji će način trenutne postavke izgledati na vaÅ¡oj radnoj povrÅ¡ini."
+msgid ""
+"This picture of a monitor contains a preview of what the current settings "
+"will look like on your desktop."
+msgstr ""
+"Slika zaslona sadrÅŸi prikaz na koji će način trenutne postavke izgledati na "
+"vašoj radnoj površini."
 
 #. +> trunk stable
@@ -145 +151 @@
 #. +> trunk stable
 #: mouseinputbutton.cpp:71
-msgid "Hold down the modifier keys you want, then click a mouse button or scroll a mouse wheel here"
-msgstr "DrÅŸite modifikatorsku tipku koju ÅŸelite, zatim ovdje pritisnite gumb miÅ¡a ili zavrtite kotačić miÅ¡a"
+msgid ""
+"Hold down the modifier keys you want, then click a mouse button or scroll a "
+"mouse wheel here"
+msgstr ""
+"Drşite modifikatorsku tipku koju şelite, zatim ovdje pritisnite gumb miša ili "
+"zavrtite kotačić miša"
 
 #. +> trunk stable
@@ -201 +211 @@
 #. +> trunk stable
 #: scripting/i18n.cpp:33
-#, fuzzy
 msgid "i18n() takes at least one argument"
-msgstr "i18n() uzima barem jedan argument"
+msgstr "i18n() treba barem jedan argument"
 
 #. +> trunk stable
 #: scripting/i18n.cpp:52
-#, fuzzy
 msgid "i18nc() takes at least two arguments"
-msgstr "i18nc() uzima barem 2 argumenta"
+msgstr "i18nc() treba barem dva argumenta"
 
 #. +> trunk stable
 #: scripting/i18n.cpp:72
-#, fuzzy
 msgid "i18np() takes at least two arguments"
-msgstr "i18np() uzima barem 2 argumenta"
+msgstr "i18np() treba barem dva argumenta"
 
 #. +> trunk stable
 #: scripting/i18n.cpp:97
-#, fuzzy
 msgid "i18ncp() takes at least three arguments"
-msgstr "i18ncp() uzima barem 3 argumenta"
+msgstr "i18ncp() treba barem tri argumenta"
 
 #. +> trunk stable
@@ -288 +294 @@
 #: widgetsexplorer/appletsfiltering.cpp:321
 #, kde-format
-msgctxt "%1 is a type of widgets, as defined by e.g. some plasma-packagestructure-*.desktop files"
+msgctxt ""
+"%1 is a type of widgets, as defined by e.g. some plasma-packagestructure-*."
+"desktop files"
 msgid "Download New %1"
 msgstr "Skini novi %1"

kde-croatia/kde4/summit/hr/summit/messages/kdebase/plasmapkg.po

@@ -4 +4 @@
 # Andrej Dundovic <adundovi@gmail.com>, 2009, 2010.
 # Marko Dimjasevic <marko@dimjasevic.net>, 2010.
+# Marko Dimjašević <marko@dimjasevic.net>, 2011.
 msgid ""
 msgstr ""
@@ -9 +10 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-07-08 10:23+0200\n"
-"PO-Revision-Date: 2010-11-06 13:31+0100\n"
-"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
+"PO-Revision-Date: 2011-07-12 18:06+0200\n"
+"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
 "MIME-Version: 1.0\n"
@@ -16 +17 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Language: hr\n"
-"X-Generator: Lokalize 1.1\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Generator: Lokalize 1.2\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
 "X-Environment: kde\n"
 "X-Accelerator-Marker: &\n"
@@ -30 +32 @@
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr "zarko.pintar@gmail.com, DoDoEntertainment@gmail.com, adundovi@gmail.com"
+msgstr ""
+"zarko.pintar@gmail.com, DoDoEntertainment@gmail.com, adundovi@gmail.com"
 
 #. +> trunk stable
@@ -39 +42 @@
 #. +> trunk stable
 #: main.cpp:80
-#, fuzzy
 msgid "Addon Name"
-msgstr "Ime zvuka"
+msgstr "Naziv dodatka"
 
 #. +> trunk stable
 #: main.cpp:81
-#, fuzzy
 msgid "Service Type"
 msgstr "Tip usluge"
@@ -51 +52 @@
 #. +> trunk stable
 #: main.cpp:82
-#, fuzzy
 msgid "Path"
 msgstr "Putanja"
@@ -67 +67 @@
 #. +> trunk stable
 #: main.cpp:126
-#, fuzzy
 msgid "DataEngine"
-msgstr "Podrške za podatke"
+msgstr "Podatkovni mehanizam"
 
 #. +> trunk stable
 #: main.cpp:127
-#, fuzzy
 #| msgctxt "package type"
 #| msgid "layout-template"
 msgid "Layout Template"
-msgstr "predloÅŸak-izgleda"
+msgstr "PredloÅŸak izgleda"
 
 #. +> trunk stable
 #: main.cpp:128
-#, fuzzy
 msgid "Plasmoid"
-msgstr "plasmoid"
+msgstr "Plasmoid"
 
 #. +> trunk stable
 #: main.cpp:129
-#, fuzzy
 #| msgctxt "package type"
 #| msgid "runner"
 msgid "Runner"
-msgstr "pokretač"
+msgstr "Pokretač"
 
 #. +> trunk stable
 #: main.cpp:130
-#, fuzzy
 msgid "Theme"
 msgstr "Tema"
@@ -101 +96 @@
 #. +> trunk stable
 #: main.cpp:131
-#, fuzzy
 msgid "Wallpaper Images"
-msgstr "Sljedeća slika podloge"
+msgstr "Slike za pozadinu"
 
 #. +> trunk stable
 #: main.cpp:132
-#, fuzzy
 #| msgctxt "package type"
 #| msgid "wallpaperplugin"
 msgid "Wallpaper Plugin"
-msgstr "priključakpodloge"
+msgstr "Priključak za pozadinsku sliku"
 
 #. +> trunk stable
@@ -146 +139 @@
 #: main.cpp:184
 msgid "For install or remove, operates on packages installed for all users."
-msgstr "Za instalaciju ili uklanjanje, radi s paketima instaliranima za sve korisnike."
+msgstr ""
+"Za instalaciju ili uklanjanje, radi s paketima instaliranima za sve korisnike."
 
 #. +> trunk stable
 #: main.cpp:190
-msgctxt "theme, wallpaper, etc. are keywords, but they may be translated, as both versions are recognized by the application (if translated, should be same as messages with 'package type' context below)"
-msgid "The type of package, e.g. theme, wallpaper, plasmoid, dataengine, runner, layout-template, etc."
-msgstr "Vrsta paketa, npr. tema, podloga, plasmoid, podatkovni mehanizam (dataengine), pokretač, predloşak-izgleda itd."
+msgctxt ""
+"theme, wallpaper, etc. are keywords, but they may be translated, as both "
+"versions are recognized by the application (if translated, should be same as "
+"messages with 'package type' context below)"
+msgid ""
+"The type of package, e.g. theme, wallpaper, plasmoid, dataengine, runner, "
+"layout-template, etc."
+msgstr ""
+"Vrsta paketa, npr. tema, podloga, plasmoid, podatkovni mehanizam "
+"(dataengine), pokretač, predloşak-izgleda itd."
 
 #. +> trunk stable
@@ -184 +185 @@
 #. +> trunk stable
 #: main.cpp:203
-msgid "Absolute path to the package root. If not supplied, then the standard data directories for this KDE session will be searched instead."
-msgstr "Apsolutna putanja do korijena paketa. Ako nije zadana, tada će biti pretraÅŸeni standardni direktoriji podataka za trenutnu KDE sjednicu."
+msgid ""
+"Absolute path to the package root. If not supplied, then the standard data "
+"directories for this KDE session will be searched instead."
+msgstr ""
+"Apsolutna putanja do korijena paketa. Ako nije zadana, tada će biti "
+"pretraÅŸeni standardni direktoriji podataka za trenutnu KDE sjednicu."
 
 #. +> trunk stable
@@ -243 +248 @@
 #. +> trunk stable
 #: main.cpp:329
-msgctxt "The user entered conflicting options packageroot and global, this is the error message telling the user he can use only one"
-msgid "The packageroot and global options conflict each other, please select only one."
-msgstr "Korijen paketa i globalne opcije se međusobno sukobljavaju. Molim odaberite samo jedno."
+msgctxt ""
+"The user entered conflicting options packageroot and global, this is the "
+"error message telling the user he can use only one"
+msgid ""
+"The packageroot and global options conflict each other, please select only "
+"one."
+msgstr ""
+"Korijen paketa i globalne opcije se međusobno sukobljavaju. Molim odaberite "
+"samo jedno."
 
 #. +> trunk stable
@@ -279 +290 @@
 #. +> trunk stable
 #: main.cpp:374
-msgctxt "No option was given, this is the error message telling the user he needs at least one, do not translate install, remove, upgrade nor list"
+msgctxt ""
+"No option was given, this is the error message telling the user he needs at "
+"least one, do not translate install, remove, upgrade nor list"
 msgid "One of install, remove, upgrade or list is required."
 msgstr "Potrebno je jedno od install, remove, upgrade ili list."

kde-croatia/kde4/summit/hr/summit/messages/kdelibs/kdecalendarsystems.po

@@ -13 +13 @@
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-07-08 10:24+0200\n"
-"PO-Revision-Date: 2011-05-05 10:21+0200\n"
+"PO-Revision-Date: 2011-07-12 17:17+0200\n"
 "Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
@@ -20 +20 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Language: hr\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
+"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
 "X-Generator: Lokalize 1.2\n"
 "X-Poedit-Language: Croatian\n"
@@ -39 +40 @@
 msgctxt "@item Calendar system"
 msgid "Gregorian"
-msgstr "Gruzijski"
+msgstr "Gregorijanski"
 
 #. +> trunk stable
@@ -57 +58 @@
 msgctxt "@item Calendar system"
 msgid "Gregorian (Proleptic)"
-msgstr "Gruzijski (Proleptski)"
+msgstr "Gregorijanski (Proleptski)"
 
 #. +> trunk stable
@@ -138 +139 @@
 #: kcalendarsystemcoptic.cpp:52
 #, c-format
-msgctxt "(kdedt-format) Coptic, AM, full era year format used for %EY, e.g. 2000 AM"
+msgctxt ""
+"(kdedt-format) Coptic, AM, full era year format used for %EY, e.g. 2000 AM"
 msgid "%Ey %EC"
 msgstr "%Ey %EC"
@@ -900 +902 @@
 #: kcalendarsystemethiopian.cpp:56
 #, c-format
-msgctxt "(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM"
+msgctxt ""
+"(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM"
 msgid "%Ey %EC"
 msgstr "%Ey %EC"
@@ -1660 +1663 @@
 #: kcalendarsystemgregorian.cpp:66 kcalendarsystemqdate.cpp:96
 #, c-format
-msgctxt "(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC"
+msgctxt ""
+"(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC"
 msgid "%Ey %EC"
 msgstr "%Ey %EC"
@@ -1694 +1698 @@
 #: kcalendarsystemqdate.cpp:106
 #, c-format
-msgctxt "(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD"
+msgctxt ""
+"(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD"
 msgid "%Ey %EC"
 msgstr "%Ey %EC"
@@ -2354 +2359 @@
 #: kcalendarsystemhebrew.cpp:291
 #, c-format
-msgctxt "(kdedt-format) Hebrew, AM, full era year format used for %EY, e.g. 2000 AM"
+msgctxt ""
+"(kdedt-format) Hebrew, AM, full era year format used for %EY, e.g. 2000 AM"
 msgid "%Ey %EC"
 msgstr "%Ey %EC"
@@ -2917 +2923 @@
 #: kcalendarsystemindiannational.cpp:76
 #, c-format
-msgctxt "(kdedt-format) Indian National, SE, full era year format used for %EY, e.g. 2000 SE"
+msgctxt ""
+"(kdedt-format) Indian National, SE, full era year format used for %EY, e.g. "
+"2000 SE"
 msgid "%Ey %EC"
 msgstr "%Ey %EC"
@@ -3631 +3639 @@
 #: kcalendarsystemislamiccivil.cpp:74
 #, c-format
-msgctxt "(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH"
+msgctxt ""
+"(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH"
 msgid "%Ey %EC"
 msgstr "%Ey %EC"
@@ -4280 +4289 @@
 #: kcalendarsystemjalali.cpp:82
 #, c-format
-msgctxt "(kdedt-format) Jalali, AP, full era year format used for %EY, e.g. 2000 AP"
+msgctxt ""
+"(kdedt-format) Jalali, AP, full era year format used for %EY, e.g. 2000 AP"
 msgid "%Ey %EC"
 msgstr "%Ey %EC"
@@ -4955 +4965 @@
 #: kcalendarsystemjapanese.cpp:70
 #, c-format
-msgctxt "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year = 1, e.g. Meiji 1"
+msgctxt ""
+"(kdedt-format) Japanese, Meiji, full era year format used for %EY, year = 1, "
+"e.g. Meiji 1"
 msgid "%EC Gannen"
 msgstr "%EC Gannen"
@@ -4962 +4974 @@
 #: kcalendarsystemjapanese.cpp:72
 #, c-format
-msgctxt "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year > 1, e.g. Meiji 22"
+msgctxt ""
+"(kdedt-format) Japanese, Meiji, full era year format used for %EY, year > 1, "
+"e.g. Meiji 22"
 msgid "%EC %Ey"
 msgstr "%EC %Ey"
@@ -4975 +4989 @@
 #: kcalendarsystemjapanese.cpp:77
 #, c-format
-msgctxt "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year = 1, e.g. Taishō 1"
+msgctxt ""
+"(kdedt-format) Japanese, Taishō, full era year format used for %EY, year = 1, "
+"e.g. Taishō 1"
 msgid "%EC Gannen"
 msgstr "%EC Gannen"
@@ -4982 +4998 @@
 #: kcalendarsystemjapanese.cpp:79
 #, c-format
-msgctxt "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year > 1, e.g. Taishō 22"
+msgctxt ""
+"(kdedt-format) Japanese, Taishō, full era year format used for %EY, year > 1, "
+"e.g. Taishō 22"
 msgid "%EC %Ey"
 msgstr "%EC %Ey"
@@ -4995 +5013 @@
 #: kcalendarsystemjapanese.cpp:84
 #, c-format
-msgctxt "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year = 1, e.g. Shōwa 1"
+msgctxt ""
+"(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year = 1, "
+"e.g. Shōwa 1"
 msgid "%EC Gannen"
 msgstr "%EC Gannen"
@@ -5002 +5022 @@
 #: kcalendarsystemjapanese.cpp:86
 #, c-format
-msgctxt "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year > 1, e.g. Shōwa 22"
+msgctxt ""
+"(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year > 1, "
+"e.g. Shōwa 22"
 msgid "%EC %Ey"
 msgstr "%EC %Ey"
@@ -5015 +5037 @@
 #: kcalendarsystemjapanese.cpp:91
 #, c-format
-msgctxt "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year = 1, e.g. Heisei 1"
+msgctxt ""
+"(kdedt-format) Japanese, Heisei, full era year format used for %EY, year = 1, "
+"e.g. Heisei 1"
 msgid "%EC Gannen"
 msgstr "%EC Gannen"
@@ -5022 +5046 @@
 #: kcalendarsystemjapanese.cpp:93
 #, c-format
-msgctxt "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year > 1, e.g. Heisei 22"
+msgctxt ""
+"(kdedt-format) Japanese, Heisei, full era year format used for %EY, year > 1, "
+"e.g. Heisei 22"
 msgid "%EC %Ey"
 msgstr "%EC %Ey"
@@ -5059 +5085 @@
 #: kcalendarsystemjulian.cpp:88
 #, c-format
-msgctxt "(kdedt-format) Julian, BC, full era year format used for %EY, e.g. 2000 BC"
+msgctxt ""
+"(kdedt-format) Julian, BC, full era year format used for %EY, e.g. 2000 BC"
 msgid "%Ey %EC"
 msgstr "%Ey %EC"
@@ -5090 +5117 @@
 #: kcalendarsystemjulian.cpp:98
 #, c-format
-msgctxt "(kdedt-format) Julian, AD, full era year format used for %EY, e.g. 2000 AD"
+msgctxt ""
+"(kdedt-format) Julian, AD, full era year format used for %EY, e.g. 2000 AD"
 msgid "%Ey %EC"
 msgstr "%Ey %EC"
@@ -5729 +5757 @@
 #: kcalendarsystemminguo.cpp:63
 #, c-format
-msgctxt "(kdedt-format) Taiwan, ROC, full era year format used for %EY, e.g. ROC 99"
+msgctxt ""
+"(kdedt-format) Taiwan, ROC, full era year format used for %EY, e.g. ROC 99"
 msgid "%EC %Ey"
 msgstr "%EC %Ey"
@@ -5748 +5777 @@
 #: kcalendarsystemthai.cpp:64
 #, c-format
-msgctxt "(kdedt-format) Thai, BE, full era year format used for %EY, e.g. 2000 BE"
+msgctxt ""
+"(kdedt-format) Thai, BE, full era year format used for %EY, e.g. 2000 BE"
 msgid "%Ey %EC"
 msgstr "%Ey %EC"