Changeset 1129 for kde-croatia
- Timestamp:
- Jul 12, 2011, 6:07:34 PM (13 years ago)
- Location:
- kde-croatia/kde4/summit/hr/summit/messages
- Files:
-
- 26 edited
Legend:
- Unmodified
- Added
- Removed
-
kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcm_platform.po
r1128 r1129 9 9 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 10 10 "POT-Creation-Date: 2011-07-08 10:22+0200\n" 11 "PO-Revision-Date: 2011-07-1 1 22:07+0200\n"11 "PO-Revision-Date: 2011-07-12 16:36+0200\n" 12 12 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 13 13 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" … … 17 17 "Language: hr\n" 18 18 "X-Generator: Lokalize 1.2\n" 19 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 19 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 20 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 20 21 "X-Environment: kde\n" 21 22 "X-Accelerator-Marker: &\n" … … 54 55 #. +> trunk stable 55 56 #: platform.ui:41 56 #, fuzzy57 57 #| msgctxt "tooltip for option in switching Windows Desktop shells" 58 58 #| msgid "Native Windows Explorer shell" 59 59 msgid "Native Windows Explorer shell" 60 msgstr "Izvorna ljuska prozorskog preglednika"60 msgstr "Izvorna ljuska Windows Explorera" 61 61 62 62 #. i18n: whatsThis for option in switching Windows Desktop shells … … 67 67 #| msgctxt "whatsThis for option in switching Windows Desktop shells" 68 68 #| msgid "This is the standard Windows Desktop shell. Choose this if you want to return your system to the default desktop." 69 msgid "This is the standard Windows Desktop shell. Choose this if you want to return your system to the default desktop." 70 msgstr "Ovo je standardna ljuska radne povrÅ¡ine Windowsa. Izaberite ovo ukoliko ÅŸelite vratiti vaÅ¡ sustav na zadanu radnu povrÅ¡inu." 69 msgid "" 70 "This is the standard Windows Desktop shell. Choose this if you want to return " 71 "your system to the default desktop." 72 msgstr "" 73 "Ovo je standardna ljuska radne povrÅ¡ine Windowsa. Izaberite ovo ukoliko " 74 "ÅŸelite vratiti vaÅ¡ sustav na zadanu radnu povrÅ¡inu." 71 75 72 76 #. i18n: radio button to choose Windows Desktop shell … … 87 91 #. +> trunk stable 88 92 #: platform.ui:61 89 #, fuzzy90 93 #| msgctxt "tooltip for option in switching Windows Desktop shells" 91 94 #| msgid "Use the KDE desktop shell, as it is seen on Linux." 92 95 msgid "Use the KDE desktop shell, as it is seen on Linux." 93 msgstr "Koristi te KDE ljusku radne povrÅ¡ine kao Å¡to je viÄeno naLinuxu."96 msgstr "Koristi KDE-ovu ljusku radne povrÅ¡ine kakva je i u GNU/Linuxu." 94 97 95 98 #. i18n: whatsThis for option in switching Windows Desktop shells … … 100 103 #| msgctxt "whatsThis for option in switching Windows Desktop shells" 101 104 #| msgid "Choose this option if you would like to use the Plasma desktop shell for your Windows system." 102 msgid "Choose this option if you would like to use the Plasma desktop shell for your Windows system." 103 msgstr "Izaberite ovu opciju ako ÅŸelite koristiti ljusku radne povrÅ¡ine Plasma na vaÅ¡em Windows sustavu." 105 msgid "" 106 "Choose this option if you would like to use the Plasma desktop shell for your " 107 "Windows system." 108 msgstr "" 109 "Izaberite ovu opciju ako ÅŸelite koristiti ljusku radne povrÅ¡ine Plasma na " 110 "vaÅ¡em Windows sustavu." 104 111 105 112 #. i18n: radio button to choose Windows Desktop shell … … 120 127 #. +> trunk stable 121 128 #: platform.ui:81 122 #, fuzzy123 129 #| msgctxt "tooltip for option in switching Windows Desktop shells" 124 130 #| msgid "Your custom desktop shell" … … 133 139 #| msgctxt "whatsThis for option in switching Windows Desktop shells" 134 140 #| msgid "Choose this and press the <i>\"Setup...\"</i> button to configure you custom desktop shell. Not recommended for the average user." 135 msgid "Choose this and press the <i>\"Setup...\"</i> button to configure you custom desktop shell. Not recommended for the average user." 136 msgstr "Odaberite ovo i pritisnite gumb <i>\"Postavke...\"</i> za podeÅ¡avanje vaÅ¡e prilagoÄene ljuske radne povrÅ¡ine. Nije preporuÄljivo prosjeÄnim korisnicima." 141 msgid "" 142 "Choose this and press the <i>\"Setup...\"</i> button to configure you custom " 143 "desktop shell. Not recommended for the average user." 144 msgstr "" 145 "Odaberite ovo i pritisnite gumb <i>\"Postavke...\"</i> za podeÅ¡avanje vaÅ¡e " 146 "prilagoÄene ljuske radne povrÅ¡ine. Nije preporuÄljivo prosjeÄnim korisnicima." 137 147 138 148 #. i18n: radio button to chose Windows Desktop shell … … 146 156 #. +> trunk stable 147 157 #: platform.ui:94 148 msgid "This shell is reserved for the user's custom shell. Press the \"Setup\" button to setup your favorite shell." 149 msgstr "Ova ljuska je rezervirana za korisniÄki prilagoÄenu ljusku. Pritisnite gumb \"Postavke...\" da podesite vaÅ¡u omiljenu ljusku." 158 msgid "" 159 "This shell is reserved for the user's custom shell. Press the \"Setup\" " 160 "button to setup your favorite shell." 161 msgstr "" 162 "Ova ljuska je rezervirana za korisniÄki prilagoÄenu ljusku. Pritisnite gumb " 163 "\"Postavke...\" da podesite vaÅ¡u omiljenu ljusku." 150 164 151 165 #. i18n: tooltip for button to setup custom Desktop shell … … 153 167 #. +> trunk stable 154 168 #: platform.ui:109 155 #, fuzzy156 169 #| msgctxt "tooltip for button to setup custom Desktop shell" 157 170 #| msgid "Press to setup your custom desktop shell" … … 166 179 #| msgctxt "whatsThis for button to setup custom Desktop shells" 167 180 #| msgid "Press this and a configuration dialog will appear to allow you to configure your custom desktop shell." 168 msgid "Press this and a configuration dialog will appear to allow you to configure your custom desktop shell." 169 msgstr "Pritisnite ovo i pojavit Äe se konfiguracijski dijalog koji Äe vam dopustiti da podesite vaÅ¡u prilagoÄenu ljusku radne povrÅ¡ine." 181 msgid "" 182 "Press this and a configuration dialog will appear to allow you to configure " 183 "your custom desktop shell." 184 msgstr "" 185 "Pritisnite ovo i pojavit Äe se konfiguracijski dijalog koji Äe vam dopustiti " 186 "da podesite vaÅ¡u prilagoÄenu ljusku radne povrÅ¡ine." 170 187 171 188 #. i18n: ectx: property (text), widget (QPushButton, btnShellSetup) … … 185 202 #. +> trunk stable 186 203 #: platform.ui:161 187 #, fuzzy188 204 #| msgctxt "tooltip for checkbox" 189 205 #| msgid "This will enable automatic regeneration of Windows' Start menu entries for KDE applications" 190 msgid "This will enable automatic regeneration of Windows' Start menu entries for KDE applications" 191 msgstr "Ovo Äe omoguÄiti automatsku regeneraciju stavki Windows Start izbornika sa KDE aplikacijama " 206 msgid "" 207 "This will enable automatic regeneration of Windows' Start menu entries for " 208 "KDE applications" 209 msgstr "" 210 "Ovo Äe omoguÄiti automatsko obnavljanje stavki u Start izborniku Windowsa za " 211 "aplikacije KDE-a" 192 212 193 213 #. i18n: whatsThis tooltip … … 198 218 #| msgctxt "whatsThis tooltip" 199 219 #| msgid "This option defines if Windows' Start menu entries should be regenerated or not. By default start menu entries are regenerated automatically, but you may wish to disable it if you have issues with that." 200 msgid "This option defines if Windows' Start menu entries should be regenerated or not. By default start menu entries are regenerated automatically, but you may wish to disable it if you have issues with that." 201 msgstr "Ova opcija odreÄuje da li Äe stavke Windowsovog Start izbornika biti regenerirane ili ne. Zadano je da se stavke izbornika regeneriraju automatski, ali moÅŸda to ÅŸelite iskljuÄiti ukoliko s time imate problema. " 220 msgid "" 221 "This option defines if Windows' Start menu entries should be regenerated or " 222 "not. By default start menu entries are regenerated automatically, but you may " 223 "wish to disable it if you have issues with that." 224 msgstr "" 225 "Ova opcija odreÄuje da li Äe stavke Windowsovog Start izbornika biti " 226 "regenerirane ili ne. Zadano je da se stavke izbornika regeneriraju " 227 "automatski, ali moÅŸda to ÅŸelite iskljuÄiti ukoliko s time imate problema. " 202 228 203 229 #. i18n: checkbox caption in System Integration options … … 212 238 #. +> trunk stable 213 239 #: platform.ui:177 214 #, fuzzy215 240 #| msgctxt "tooltip for checkbox" 216 241 #| msgid "Use native Windows file dialogs instead of KDE ones" … … 225 250 #| msgctxt "whatsThis tooltip" 226 251 #| msgid "Choose this option to make KDE applications use the standard Windows Open/Save file dialogs, instead of those normally used in KDE." 227 msgid "Choose this option to make KDE applications use the standard Windows Open/Save file dialogs, instead of those normally used in KDE." 228 msgstr "Izaberite ovu opciju kako bi KDE aplikacije koristile uobiÄajene Windows Otvori/Spemi datoteÄne dijaloge umjesto onih normalnih koriÅ¡tenih u KDE-u." 252 msgid "" 253 "Choose this option to make KDE applications use the standard Windows " 254 "Open/Save file dialogs, instead of those normally used in KDE." 255 msgstr "" 256 "Izaberite ovu opciju kako bi KDE aplikacije koristile uobiÄajene Windows " 257 "Otvori/Spemi datoteÄne dijaloge umjesto onih normalnih koriÅ¡tenih u KDE-u." 229 258 230 259 #. i18n: checkbox caption in System Integration options … … 239 268 #. +> trunk stable 240 269 #: platform.ui:199 241 #, fuzzy242 270 #| msgctxt "tooltip for checkbox" 243 271 #| msgid "Install System Settings into the Windows Control Panel." 244 272 msgid "Install System Settings into the Windows Control Panel." 245 msgstr "Instaliraj \"Postavke sustava\"u kontrolni panel Windowsa."273 msgstr "Instaliraj Postavke sustava u kontrolni panel Windowsa." 246 274 247 275 #. i18n: whatsThis tooltip … … 252 280 #| msgctxt "whatsThis tooltip" 253 281 #| msgid "This will install the KDE 'System Settings' as an element in the Windows Control Panel.<br><b>Caution: This option tweaks your Windows registry.</b>" 254 msgid "This will install the KDE 'System Settings' as an element in the Windows Control Panel.<br><b>Caution: This option tweaks your Windows registry.</b>" 255 msgstr "Ovo Äe instalirati KDE-ove 'Postavke sustava' kao element kontrolnog panela Windowsa.<br><b>Oprez: Ova opcija zadire u vaÅ¡ Windows registar.</b>" 282 msgid "" 283 "This will install the KDE 'System Settings' as an element in the Windows " 284 "Control Panel.<br><b>Caution: This option tweaks your Windows registry.</b>" 285 msgstr "" 286 "Ovo Äe instalirati KDE-ove 'Postavke sustava' kao element kontrolnog panela " 287 "Windowsa.<br><b>Oprez: Ova opcija zadire u vaÅ¡ Windows registar.</b>" 256 288 257 289 #. i18n: checkbox caption in System Integration options … … 266 298 #. +> trunk stable 267 299 #: platform.ui:212 268 #, fuzzy269 300 #| msgctxt "tooltip for checkbox" 270 301 #| msgid "Install Oxygen cursors as Windows cursor schemes" 271 302 msgid "Install Oxygen cursors as Windows cursor schemes" 272 msgstr "Instaliraj Oxygen pokazivaÄe kao Windows sheme pokazvaÄa."303 msgstr "Instaliraj Oxygen pokazivaÄe kao sheme pokazvaÄa u Windowsu." 273 304 274 305 #. i18n: whatsThis tooltip … … 279 310 #| msgctxt "whatsThis tooltip" 280 311 #| msgid "This will install the Oxygen cursors into your system and combine them as a cursor theme.<br><b>Caution: This option tweaks your Windows registry.</b>" 281 msgid "This will install the Oxygen cursors into your system and combine them as a cursor theme.<br><b>Caution: This option tweaks your Windows registry.</b>" 282 msgstr "Ovo Äe instalirati Oxygen pokazivaÄe u vaÅ¡ sustav i objediniti ih kao temu pokazivaÄa.<br><b>Oprez: Ova opcija zadire u vaÅ¡ Windows registar.</b>" 312 msgid "" 313 "This will install the Oxygen cursors into your system and combine them as a " 314 "cursor theme.<br><b>Caution: This option tweaks your Windows registry.</b>" 315 msgstr "" 316 "Ovo Äe instalirati Oxygen pokazivaÄe u vaÅ¡ sustav i objediniti ih kao temu " 317 "pokazivaÄa.<br><b>Oprez: Ova opcija zadire u vaÅ¡ Windows registar.</b>" 283 318 284 319 #. i18n: checkbox caption in System Integration options … … 293 328 #. +> trunk stable 294 329 #: platform.ui:225 295 #, fuzzy296 330 #| msgctxt "tooltip for checkbox" 297 331 #| msgid "This option installs KDE wallpapers into your \"My Pictures\" directory" 298 332 msgid "This option installs KDE wallpapers into your \"My Pictures\" directory" 299 msgstr "Ova opcija instalira KDE pozadinske slike u vaÅ¡ \"My Pictures\" direktorij" 333 msgstr "" 334 "Ova Äe opcija instalirati pozadinske slike KDE-a u vaÅ¡ direktorij \"My " 335 "Pictures\"" 300 336 301 337 #. i18n: whatsThis tooltip … … 306 342 #| msgctxt "whatsThis tooltip" 307 343 #| msgid "This will install KDE wallpapers into the <i>\"My Pictures\"</i> directory so they can be used as your Windows wallpaper. If the checkbox is set to half-checked then it means that there are new wallpapers available to update.<br> The wallpaper aspect ratio will be selected according to your current screen resolution." 308 msgid "This will install KDE wallpapers into the <i>\"My Pictures\"</i> directory so they can be used as your Windows wallpaper. If the checkbox is set to half-checked then it means that there are new wallpapers available to update.<br> The wallpaper aspect ratio will be selected according to your current screen resolution." 309 msgstr "Ovo Äe instalirati KDE-ove pozadinske slike u direktorij <i>\"Moje Slike\"</i> kako bi se mogle koristiti kao vaÅ¡e Windows pozadinske slike. Ako je odabirni okvir oznaÄen na pola, znaÄi da postoji novih pozadinskih slika dostupnih kod aÅŸuriranja.<br> Omjer Å¡irine i visine pozadinske slike biti Äe odabran prema vaÅ¡oj trenutnoj rezoluciji zaslona." 344 msgid "" 345 "This will install KDE wallpapers into the <i>\"My Pictures\"</i> directory so " 346 "they can be used as your Windows wallpaper. If the checkbox is set to " 347 "half-checked then it means that there are new wallpapers available to update." 348 "<br> The wallpaper aspect ratio will be selected according to your current " 349 "screen resolution." 350 msgstr "" 351 "Ovo Äe instalirati KDE-ove pozadinske slike u direktorij <i>\"Moje Slike\"</i>" 352 " kako bi se mogle koristiti kao vaÅ¡e Windows pozadinske slike. Ako je " 353 "odabirni okvir oznaÄen na pola, znaÄi da postoji novih pozadinskih slika " 354 "dostupnih kod aÅŸuriranja.<br> Omjer Å¡irine i visine pozadinske slike biti Äe " 355 "odabran prema vaÅ¡oj trenutnoj rezoluciji zaslona." 310 356 311 357 #. i18n: checkbox caption in System Integration options … … 320 366 #. +> trunk stable 321 367 #: platform.ui:238 322 #, fuzzy323 368 #| msgctxt "tooltip for checkbox" 324 369 #| msgid "This will make essential KDE processes run at user login" 325 370 msgid "This will make essential KDE processes run at user login" 326 msgstr "Ovo Äe pokrenuti bitne KDE proceseprilikom prijave u sustav"371 msgstr "Ovo Äe pokrenuti bitne procese KDE-a prilikom prijave u sustav" 327 372 328 373 #. i18n: whatsThis tooltip … … 333 378 #| msgctxt "whatsThis tooltip" 334 379 #| msgid "Enabling this option will start essential KDE processes at user login. Normally these processes are started when you first start a KDE application, thereby delaying the actual application launch.<br>It is recommended to enable this option to make your applications launch faster for the first time.<br><b>Caution: This option tweaks your Windows registry.</b>" 335 msgid "Enabling this option will start essential KDE processes at user login. Normally these processes are started when you first start a KDE application, thereby delaying the actual application launch.<br>It is recommended to enable this option to make your applications launch faster for the first time.<br><b>Caution: This option tweaks your Windows registry.</b>" 336 msgstr "OmoguÄavanjem ove opcije KDE procesi Äe se pokrenuti prilikom prijave u sutav. ObiÄno se ovi procesi pokeÄu kada pokrenete prvu KDE aplikaciju unutar korisniÄke sesije, Å¡to odugovlaÄi samo pokretanje aplikacije.<br>PreporuÄa se da ukljuÄite ovu opciju kako bi uÄinili pokretanje vaÅ¡ih aplikacija prvi put brÅŸim.<br><b>Oprez: Ova opcija zadire u vaÅ¡ Windows registar.</b>" 380 msgid "" 381 "Enabling this option will start essential KDE processes at user login. " 382 "Normally these processes are started when you first start a KDE application, " 383 "thereby delaying the actual application launch.<br>It is recommended to " 384 "enable this option to make your applications launch faster for the first time." 385 "<br><b>Caution: This option tweaks your Windows registry.</b>" 386 msgstr "" 387 "OmoguÄavanjem ove opcije KDE procesi Äe se pokrenuti prilikom prijave u sutav." 388 " ObiÄno se ovi procesi pokeÄu kada pokrenete prvu KDE aplikaciju unutar " 389 "korisniÄke sesije, Å¡to odugovlaÄi samo pokretanje aplikacije.<br>PreporuÄa se " 390 "da ukljuÄite ovu opciju kako bi uÄinili pokretanje vaÅ¡ih aplikacija prvi put " 391 "brÅŸim.<br><b>Oprez: Ova opcija zadire u vaÅ¡ Windows registar.</b>" 337 392 338 393 #. i18n: checkbox caption in System Integration options … … 355 410 #. +> trunk stable 356 411 #: shellEdit.cpp:24 357 #, fuzzy358 412 #| msgid "This shell is reserved for the user's custom shell. Press the \"Setup\" button to setup your favorite shell." 359 msgid "This shell is reserved for user's custom shell. Press \"Setup\" button to setup your favourite shell." 360 msgstr "Ova ljuska je rezervirana za korisniÄki prilagoÄenu ljusku. Pritisnite gumb \"Postavke...\" da podesite vaÅ¡u omiljenu ljusku." 413 msgid "" 414 "This shell is reserved for user's custom shell. Press \"Setup\" button to " 415 "setup your favourite shell." 416 msgstr "" 417 "Ova je ljuska rezervirana za korisniÄki prilagoÄenu ljusku. Pritisnite gumb " 418 "\"Postavke\" kako biste podesili vaÅ¡u omiljenu ljusku." 361 419 362 420 #. i18n: ectx: property (windowTitle), widget (QDialog, ShellEditDlg) -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmcolors.po
r1123 r1129 11 11 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 12 12 "POT-Creation-Date: 2011-07-08 10:22+0200\n" 13 "PO-Revision-Date: 2011-0 3-18 18:21+0100\n"13 "PO-Revision-Date: 2011-07-12 16:39+0200\n" 14 14 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 15 15 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" … … 18 18 "Content-Transfer-Encoding: 8bit\n" 19 19 "Language: hr\n" 20 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 20 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 21 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 21 22 "X-Generator: Lokalize 1.2\n" 22 23 "X-Environment: kde\n" … … 32 33 msgctxt "EMAIL OF TRANSLATORS" 33 34 msgid "Your emails" 34 msgstr "renato@translator-shop.org, DoDoEntertainment@gmail.com, adundovi@gmail.com" 35 msgstr "" 36 "renato@translator-shop.org, DoDoEntertainment@gmail.com, adundovi@gmail.com" 35 37 36 38 #. i18n: ectx: attribute (title), widget (QWidget, pageColors) … … 97 99 "The scheme you have selected appears to be a KDE3 scheme.\n" 98 100 "\n" 99 "KDE will attempt to import this scheme, however many color roles have been added since KDE3. Some manual work will likely be required.\n" 101 "KDE will attempt to import this scheme, however many color roles have been " 102 "added since KDE3. Some manual work will likely be required.\n" 100 103 "\n" 101 104 "This scheme will not be saved automatically." … … 103 106 "Shema koju ste uvezli Äini se kao KDE3 shema.\n" 104 107 "\n" 105 "KDE Äe pokuÅ¡ati uvesti ovu shemu, meÄutim od KDE3 dodane su nove uloge boja. Vjerojatno Äe biti potrebno dodatno ruÄno podeÅ¡avanje.\n" 108 "KDE Äe pokuÅ¡ati uvesti ovu shemu, meÄutim od KDE3 dodane su nove uloge boja. " 109 "Vjerojatno Äe biti potrebno dodatno ruÄno podeÅ¡avanje.\n" 106 110 "\n" 107 111 "Ova shema neÄe biti spremljena automatski." … … 523 527 #. +> trunk stable 524 528 #: colorsettings.ui:605 525 #, fuzzy526 529 #| msgid "Active Titlebar Text" 527 530 msgid "Active Titlebar Secondary" 528 msgstr " Tekst aktivne naslovne trake"531 msgstr "Druga aktivna naslovna traka" 529 532 530 533 #. i18n: ectx: property (text), item, widget (QTableWidget, commonColorTable) … … 543 546 #. +> trunk stable 544 547 #: colorsettings.ui:620 545 #, fuzzy546 548 #| msgid "Inactive Titlebar Text" 547 549 msgid "Inactive Titlebar Secondary" 548 msgstr " Tekst neaktivne naslovne trake"550 msgstr "Druga neaktivna naslovna traka" 549 551 550 552 #. i18n: ectx: attribute (title), widget (QWidget, pageInactice) … … 1113 1115 msgid "" 1114 1116 "Link Text on Link Background\n" 1115 "(Note: Link Background is derived from Link Text and cannot be separately configured at this time)" 1117 "(Note: Link Background is derived from Link Text and cannot be separately " 1118 "configured at this time)" 1116 1119 msgstr "" 1117 1120 "Tekst poveznice na pozadini poveznice\n" 1118 "(Napomena: Pozadina poveznice je izvedena iz teksta poveznice i ne moÅŸe biti odvojeno konfigurirana u ovom trenutku)" 1121 "(Napomena: Pozadina poveznice je izvedena iz teksta poveznice i ne moÅŸe biti " 1122 "odvojeno konfigurirana u ovom trenutku)" 1119 1123 1120 1124 #. i18n: ectx: property (toolTip), widget (QLabel, labelBack4) … … 1123 1127 msgid "" 1124 1128 "Visited Text on Visited Background\n" 1125 "(Note: Visited Background is derived from Visited Text and cannot be separately configured at this time)" 1129 "(Note: Visited Background is derived from Visited Text and cannot be " 1130 "separately configured at this time)" 1126 1131 msgstr "" 1127 1132 "Tekst posjeÄene poveznice na pozadini posjeÄene poveznice\n" 1128 "(Napomena: PosjeÄena poveznica je izvedena iz posjeÄenog teksta poveznice i trenutno ne moÅŸe biti odvojeno konfigurirana)" 1133 "(Napomena: PosjeÄena poveznica je izvedena iz posjeÄenog teksta poveznice i " 1134 "trenutno ne moÅŸe biti odvojeno konfigurirana)" 1129 1135 1130 1136 #. i18n: ectx: property (toolTip), widget (QLabel, labelBack2) … … 1133 1139 msgid "" 1134 1140 "Active Text on Active Background\n" 1135 "(Note: Active Background is derived from Active Text and cannot be separately configured at this time)" 1141 "(Note: Active Background is derived from Active Text and cannot be separately " 1142 "configured at this time)" 1136 1143 msgstr "" 1137 1144 "Aktivni tekst na aktivnoj pozadini\n" 1138 "(Napomena: Aktivna pozadina je izvedena iz aktivnog teksta i trenutno ne moÅŸe biti odvojeno konfigurirana)" 1145 "(Napomena: Aktivna pozadina je izvedena iz aktivnog teksta i trenutno ne moÅŸe " 1146 "biti odvojeno konfigurirana)" 1139 1147 1140 1148 #. i18n: ectx: property (toolTip), widget (QLabel, labelBack1) … … 1157 1165 msgid "" 1158 1166 "Negative Text on Negative Background\n" 1159 "(Note: Negative Background is derived from Negative Text and cannot be separately configured at this time)" 1167 "(Note: Negative Background is derived from Negative Text and cannot be " 1168 "separately configured at this time)" 1160 1169 msgstr "" 1161 1170 "Negativno tekst na negativnoj pozadini\n" 1162 "(Napomena: Negativna pozadina je izvedena iz negativnog teksta i trenutno ne moÅŸe biti odvojeno konfigurirana)" 1171 "(Napomena: Negativna pozadina je izvedena iz negativnog teksta i trenutno ne " 1172 "moÅŸe biti odvojeno konfigurirana)" 1163 1173 1164 1174 #. i18n: ectx: property (toolTip), widget (QLabel, labelBack6) … … 1167 1177 msgid "" 1168 1178 "Neutral Text on Neutral Background\n" 1169 "(Note: Neutral Background is derived from Neutral Text and cannot be separately configured at this time)" 1179 "(Note: Neutral Background is derived from Neutral Text and cannot be " 1180 "separately configured at this time)" 1170 1181 msgstr "" 1171 1182 "Neutralni tekst na neutralnoj pozadini\n" 1172 "(Napomena: Neutralna pozadina je izvedena iz neutralnog teksta i trenutno ne moÅŸe biti odvojeno konfigurirana)" 1183 "(Napomena: Neutralna pozadina je izvedena iz neutralnog teksta i trenutno ne " 1184 "moÅŸe biti odvojeno konfigurirana)" 1173 1185 1174 1186 #. i18n: ectx: property (toolTip), widget (QLabel, labelBack7) … … 1177 1189 msgid "" 1178 1190 "Positive Text on Positive Background\n" 1179 "(Note: Positive Background is derived from Positive Text and cannot be separately configured at this time)" 1191 "(Note: Positive Background is derived from Positive Text and cannot be " 1192 "separately configured at this time)" 1180 1193 msgstr "" 1181 1194 "Pozitivan tekst na pozitivnoj pozadini\n" 1182 "(Napomena: Pozitivna pozadina je izvedena iz pozitivnog teksta i trenutno ne moÅŸe biti odvojeno konfigurirana)" 1195 "(Napomena: Pozitivna pozadina je izvedena iz pozitivnog teksta i trenutno ne " 1196 "moÅŸe biti odvojeno konfigurirana)" 1183 1197 1184 1198 #. i18n: ectx: property (toolTip), widget (QLabel, labelFore9) -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcminput.po
r1123 r1129 4 4 # Andrej Dundovic <adundovi@gmail.com>, 2010. 5 5 # Marko Dimjasevic <marko@dimjasevic.net>, 2011. 6 # Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>, 2011. 6 7 msgid "" 7 8 msgstr "" … … 9 10 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 10 11 "POT-Creation-Date: 2011-07-08 10:22+0200\n" 11 "PO-Revision-Date: 2011-0 2-26 10:26+0100\n"12 "Last-Translator: Marko Dimja sevic<marko@dimjasevic.net>\n"12 "PO-Revision-Date: 2011-07-12 16:40+0200\n" 13 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 13 14 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" 14 15 "MIME-Version: 1.0\n" … … 16 17 "Content-Transfer-Encoding: 8bit\n" 17 18 "Language: hr\n" 18 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 19 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 20 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 19 21 "X-Generator: Lokalize 1.2\n" 20 22 "X-Poedit-Bookmarks: 42,-1,-1,-1,-1,-1,-1,-1,-1,-1\n" … … 134 136 #. +> trunk stable 135 137 #: kmousedlg.ui:72 136 msgid "Change the direction of scrolling for the mouse wheel or the 4th and 5th mouse buttons." 137 msgstr "Promjena smjera klizanja za kotaÄiÄ miÅ¡a ili za Äetvrtu ili petu tipku miÅ¡a." 138 msgid "" 139 "Change the direction of scrolling for the mouse wheel or the 4th and 5th " 140 "mouse buttons." 141 msgstr "" 142 "Promjena smjera klizanja za kotaÄiÄ miÅ¡a ili za Äetvrtu ili petu tipku miÅ¡a." 138 143 139 144 #. i18n: ectx: property (text), widget (QCheckBox, cbScrollPolarity) … … 195 200 #. +> trunk stable 196 201 #: logitechmouse.cpp:226 197 msgid "RF channel 1 has been set. Please press Connect button on mouse to re-establish link" 198 msgstr "RF kanal 1 je podeÅ¡en. Pritisnite tipku za povezivanje na vaÅ¡em miÅ¡u da biste ponovo uspostavili vezu." 202 msgid "" 203 "RF channel 1 has been set. Please press Connect button on mouse to " 204 "re-establish link" 205 msgstr "" 206 "RF kanal 1 je podeÅ¡en. Pritisnite tipku za povezivanje na vaÅ¡em miÅ¡u da biste " 207 "ponovo uspostavili vezu." 199 208 200 209 #. +> trunk stable … … 205 214 #. +> trunk stable 206 215 #: logitechmouse.cpp:230 207 msgid "RF channel 2 has been set. Please press Connect button on mouse to re-establish link" 208 msgstr "RF kanal 2 je podeÅ¡en. Pritisnite tipku za povezivanje na vaÅ¡em miÅ¡u da biste ponovo uspostavili vezu." 216 msgid "" 217 "RF channel 2 has been set. Please press Connect button on mouse to " 218 "re-establish link" 219 msgstr "" 220 "RF kanal 2 je podeÅ¡en. Pritisnite tipku za povezivanje na vaÅ¡em miÅ¡u da biste " 221 "ponovo uspostavili vezu." 209 222 210 223 #. +> trunk stable … … 340 353 #. +> trunk stable 341 354 #: logitechmouse_base.ui:107 342 msgid "You have a Logitech Mouse connected, and libusb was found at compile time, but it was not possible to access this mouse. This is probably caused by a permissions problem - you should consult the manual on how to fix this." 343 msgstr "PrikljuÄen je miÅ¡ Logitech Mouse i tijekom sastavljanja upravljaÄkih programa pronaÄena je datoteka libusb, ali pristupanje miÅ¡u nije bilo moguÄe. Vjerojatan uzrok je problem s dopuÅ¡tenjima. ProuÄite priruÄnik radi rjeÅ¡avanja ovog problema." 355 msgid "" 356 "You have a Logitech Mouse connected, and libusb was found at compile time, " 357 "but it was not possible to access this mouse. This is probably caused by a " 358 "permissions problem - you should consult the manual on how to fix this." 359 msgstr "" 360 "PrikljuÄen je miÅ¡ Logitech Mouse i tijekom sastavljanja upravljaÄkih programa " 361 "pronaÄena je datoteka libusb, ali pristupanje miÅ¡u nije bilo moguÄe. " 362 "Vjerojatan uzrok je problem s dopuÅ¡tenjima. ProuÄite priruÄnik radi " 363 "rjeÅ¡avanja ovog problema." 344 364 345 365 #. +> trunk stable 346 366 #: mouse.cpp:91 347 msgid "<h1>Mouse</h1> This module allows you to choose various options for the way in which your pointing device works. Your pointing device may be a mouse, trackball, or some other hardware that performs a similar function." 348 msgstr "<h1>MiÅ¡</h1> Ovaj vam modul omoguÄuje podeÅ¡avanje raznih opcija naÄina na koje vaÅ¡ pokazivaÄ funkcionira. UreÄaj pokazivaÄa moÅŸe biti miÅ¡, kugla za praÄenje ili bilo koji drugi hardver sliÄne namjene." 367 msgid "" 368 "<h1>Mouse</h1> This module allows you to choose various options for the way " 369 "in which your pointing device works. Your pointing device may be a mouse, " 370 "trackball, or some other hardware that performs a similar function." 371 msgstr "" 372 "<h1>MiÅ¡</h1> Ovaj vam modul omoguÄuje podeÅ¡avanje raznih opcija naÄina na " 373 "koje vaÅ¡ pokazivaÄ funkcionira. UreÄaj pokazivaÄa moÅŸe biti miÅ¡, kugla za " 374 "praÄenje ili bilo koji drugi hardver sliÄne namjene." 349 375 350 376 #. +> trunk stable … … 355 381 #. +> trunk stable 356 382 #: mouse.cpp:120 357 msgid "If you are left-handed, you may prefer to swap the functions of the left and right buttons on your pointing device by choosing the 'left-handed' option. If your pointing device has more than two buttons, only those that function as the left and right buttons are affected. For example, if you have a three-button mouse, the middle button is unaffected." 358 msgstr "Ako ste ljevoruki mogli biste ÅŸeljeti zamijeniti funkcije lijeve i desne tipke miÅ¡a pomoÄu odabira opcije \"Ljevoruk\". Ako vaÅ¡ miÅ¡ ima viÅ¡e od dvije tipke, ova Äe opcija utjecati samo na tipke koje funkcioniraju kao lijeva i desna. Na primjer, ako imate miÅ¡a s tri tipke, funkcioniranje srednje tipke neÄe biti izmijenjeno." 383 msgid "" 384 "If you are left-handed, you may prefer to swap the functions of the left and " 385 "right buttons on your pointing device by choosing the 'left-handed' option. " 386 "If your pointing device has more than two buttons, only those that function " 387 "as the left and right buttons are affected. For example, if you have a " 388 "three-button mouse, the middle button is unaffected." 389 msgstr "" 390 "Ako ste ljevoruki mogli biste ÅŸeljeti zamijeniti funkcije lijeve i desne " 391 "tipke miÅ¡a pomoÄu odabira opcije \"Ljevoruk\". Ako vaÅ¡ miÅ¡ ima viÅ¡e od dvije " 392 "tipke, ova Äe opcija utjecati samo na tipke koje funkcioniraju kao lijeva i " 393 "desna. Na primjer, ako imate miÅ¡a s tri tipke, funkcioniranje srednje tipke " 394 "neÄe biti izmijenjeno." 359 395 360 396 #. +> trunk stable 361 397 #: mouse.cpp:130 362 msgid "The default behavior in KDE is to select and activate icons with a single click of the left button on your pointing device. This behavior is consistent with what you would expect when you click links in most web browsers. If you would prefer to select with a single click, and activate with a double click, check this option." 363 msgstr "Zadano ponaÅ¡anje unutar KDE-a je odabir i aktiviranje ikona jednim klikom lijeve tipke vaÅ¡eg miÅ¡a, Å¡to je sliÄno onome u pretraÅŸivaÄima za internet. Ako ÅŸelite odabiranje s jednim, a aktiviranje s dva klika, oznaÄite ovu opciju." 398 msgid "" 399 "The default behavior in KDE is to select and activate icons with a single " 400 "click of the left button on your pointing device. This behavior is consistent " 401 "with what you would expect when you click links in most web browsers. If you " 402 "would prefer to select with a single click, and activate with a double click, " 403 "check this option." 404 msgstr "" 405 "Zadano ponaÅ¡anje unutar KDE-a je odabir i aktiviranje ikona jednim klikom " 406 "lijeve tipke vaÅ¡eg miÅ¡a, Å¡to je sliÄno onome u pretraÅŸivaÄima za internet. " 407 "Ako ÅŸelite odabiranje s jednim, a aktiviranje s dva klika, oznaÄite ovu " 408 "opciju." 364 409 365 410 #. +> trunk stable … … 370 415 #. +> trunk stable 371 416 #: mouse.cpp:144 372 msgid "If you check this option, pausing the mouse pointer over an icon on the screen will automatically select that icon. This may be useful when single clicks activate icons, and you want only to select the icon without activating it." 373 msgstr "Odabiranjem ove opcije, dulje zadrÅŸavanje pokazivaÄa iznad ikone automatski Äe odabrati ikonu. To je korisno ako upotrebljavate jedan klik za aktiviranje ikona, ali je ne ÅŸelite pokrenuti, nego samo odabrati." 417 msgid "" 418 "If you check this option, pausing the mouse pointer over an icon on the " 419 "screen will automatically select that icon. This may be useful when single " 420 "clicks activate icons, and you want only to select the icon without " 421 "activating it." 422 msgstr "" 423 "Odabiranjem ove opcije, dulje zadrÅŸavanje pokazivaÄa iznad ikone automatski " 424 "Äe odabrati ikonu. To je korisno ako upotrebljavate jedan klik za aktiviranje " 425 "ikona, ali je ne ÅŸelite pokrenuti, nego samo odabrati." 374 426 375 427 #. +> trunk stable 376 428 #: mouse.cpp:150 377 msgid "If you have checked the option to automatically select icons, this slider allows you to select how long the mouse pointer must be paused over the icon before it is selected." 378 msgstr "Odabiranjem opcije automatskog odabira ikona, ovaj klizaÄ omoguÄuje podeÅ¡avanje razdoblja tijekom kojeg pokazivaÄ miÅ¡a mora biti iznad ikone da bi ona bila odabrana." 429 msgid "" 430 "If you have checked the option to automatically select icons, this slider " 431 "allows you to select how long the mouse pointer must be paused over the icon " 432 "before it is selected." 433 msgstr "" 434 "Odabiranjem opcije automatskog odabira ikona, ovaj klizaÄ omoguÄuje " 435 "podeÅ¡avanje razdoblja tijekom kojeg pokazivaÄ miÅ¡a mora biti iznad ikone da " 436 "bi ona bila odabrana." 379 437 380 438 #. +> trunk stable … … 395 453 #. +> trunk stable 396 454 #: mouse.cpp:195 397 msgid "<p>This option allows you to change the relationship between the distance that the mouse pointer moves on the screen and the relative movement of the physical device itself (which may be a mouse, trackball, or some other pointing device.)</p><p> A high value for the acceleration will lead to large movements of the mouse pointer on the screen even when you only make a small movement with the physical device. Selecting very high values may result in the mouse pointer flying across the screen, making it hard to control.</p>" 398 msgstr "<p>Ova opcija omoguÄuje vam izmjenu omjera izmeÄu udaljenosti koju pokazivaÄ miÅ¡a prijeÄe na zaslonu i relativne kretnje samog miÅ¡a ili bilo kojeg ureÄaja za pokazivanje.</p><p>Velika vrijednost ubrzavanja prouzrokovat Äe velike pomake pokazivaÄa na zaslonu Äak i u sluÄaju malenih kretnji samog ureÄaja. Odabir jako velikih vrijednosti moÅŸe izazvati prebrzo kretanje pokazivaÄa kojim je teÅ¡ko upravljati.</p>" 455 msgid "" 456 "<p>This option allows you to change the relationship between the distance " 457 "that the mouse pointer moves on the screen and the relative movement of the " 458 "physical device itself (which may be a mouse, trackball, or some other " 459 "pointing device.)</p><p> A high value for the acceleration will lead to large " 460 "movements of the mouse pointer on the screen even when you only make a small " 461 "movement with the physical device. Selecting very high values may result in " 462 "the mouse pointer flying across the screen, making it hard to control.</p>" 463 msgstr "" 464 "<p>Ova opcija omoguÄuje vam izmjenu omjera izmeÄu udaljenosti koju pokazivaÄ " 465 "miÅ¡a prijeÄe na zaslonu i relativne kretnje samog miÅ¡a ili bilo kojeg ureÄaja " 466 "za pokazivanje.</p><p>Velika vrijednost ubrzavanja prouzrokovat Äe velike " 467 "pomake pokazivaÄa na zaslonu Äak i u sluÄaju malenih kretnji samog ureÄaja. " 468 "Odabir jako velikih vrijednosti moÅŸe izazvati prebrzo kretanje pokazivaÄa " 469 "kojim je teÅ¡ko upravljati.</p>" 399 470 400 471 #. +> trunk stable … … 405 476 #. +> trunk stable 406 477 #: mouse.cpp:215 407 msgid "<p>The threshold is the smallest distance that the mouse pointer must move on the screen before acceleration has any effect. If the movement is smaller than the threshold, the mouse pointer moves as if the acceleration was set to 1X;</p><p> thus, when you make small movements with the physical device, there is no acceleration at all, giving you a greater degree of control over the mouse pointer. With larger movements of the physical device, you can move the mouse pointer rapidly to different areas on the screen.</p>" 408 msgstr "<p>Prag je najmanja udaljenost koju pokazivaÄ miÅ¡a mora prijeÄi na zaslonu prije no Å¡to ubrzavanje dobije na uÄinku. Ako je pomak manji od praga, pokazivaÄ miÅ¡a pomicat Äe se kao da je ubrzavanje postavljeno na 1x.</p><p>Na taj naÄin, u sluÄaju manjih kretnji samim ureÄajem, ne postoji nikakvo ubrzavanje i postiÅŸete veÄu upravljivost nad pokazivaÄem. Uz velike kretnje samim ureÄajem pokazivaÄ moÅŸete brzo premjestiti u razliÄite dijelove zaslona.</p>" 478 msgid "" 479 "<p>The threshold is the smallest distance that the mouse pointer must move on " 480 "the screen before acceleration has any effect. If the movement is smaller " 481 "than the threshold, the mouse pointer moves as if the acceleration was set to " 482 "1X;</p><p> thus, when you make small movements with the physical device, " 483 "there is no acceleration at all, giving you a greater degree of control over " 484 "the mouse pointer. With larger movements of the physical device, you can move " 485 "the mouse pointer rapidly to different areas on the screen.</p>" 486 msgstr "" 487 "<p>Prag je najmanja udaljenost koju pokazivaÄ miÅ¡a mora prijeÄi na zaslonu " 488 "prije no Å¡to ubrzavanje dobije na uÄinku. Ako je pomak manji od praga, " 489 "pokazivaÄ miÅ¡a pomicat Äe se kao da je ubrzavanje postavljeno na 1x.</p><p>Na " 490 "taj naÄin, u sluÄaju manjih kretnji samim ureÄajem, ne postoji nikakvo " 491 "ubrzavanje i postiÅŸete veÄu upravljivost nad pokazivaÄem. Uz velike kretnje " 492 "samim ureÄajem pokazivaÄ moÅŸete brzo premjestiti u razliÄite dijelove zaslona." 493 "</p>" 409 494 410 495 #. +> trunk stable … … 420 505 #. +> trunk stable 421 506 #: mouse.cpp:235 422 msgid "The double click interval is the maximal time (in milliseconds) between two mouse clicks which turns them into a double click. If the second click happens later than this time interval after the first click, they are recognized as two separate clicks." 423 msgstr "Razdoblje za dvostruki klik je najdulje vrijeme koje moÅŸe proteÄi izmeÄu dva klika, a da se oni protumaÄe kao dvostruki klik. Ako drugi put kliknete nakon navedenog razdoblja, tad se klikovi prepoznaju kao dva zasebna klikanja." 507 msgid "" 508 "The double click interval is the maximal time (in milliseconds) between two " 509 "mouse clicks which turns them into a double click. If the second click " 510 "happens later than this time interval after the first click, they are " 511 "recognized as two separate clicks." 512 msgstr "" 513 "Razdoblje za dvostruki klik je najdulje vrijeme koje moÅŸe proteÄi izmeÄu dva " 514 "klika, a da se oni protumaÄe kao dvostruki klik. Ako drugi put kliknete nakon " 515 "navedenog razdoblja, tad se klikovi prepoznaju kao dva zasebna klikanja." 424 516 425 517 #. +> trunk stable … … 430 522 #. +> trunk stable 431 523 #: mouse.cpp:250 432 msgid "If you click with the mouse (e.g. in a multi-line editor) and begin to move the mouse within the drag start time, a drag operation will be initiated." 433 msgstr "Ako kliknete miÅ¡em i zapoÄnete ga prevlaÄiti unutar navedenog razdoblja, tad Äe zapoÄeti prevlaÄenje (npr. s premjeÅ¡tanjem odabranog teksta u ureÄivaÄu teksta)." 524 msgid "" 525 "If you click with the mouse (e.g. in a multi-line editor) and begin to move " 526 "the mouse within the drag start time, a drag operation will be initiated." 527 msgstr "" 528 "Ako kliknete miÅ¡em i zapoÄnete ga prevlaÄiti unutar navedenog razdoblja, tad " 529 "Äe zapoÄeti prevlaÄenje (npr. s premjeÅ¡tanjem odabranog teksta u ureÄivaÄu " 530 "teksta)." 434 531 435 532 #. +> trunk stable … … 440 537 #. +> trunk stable 441 538 #: mouse.cpp:263 442 msgid "If you click with the mouse and begin to move the mouse at least the drag start distance, a drag operation will be initiated." 443 msgstr "Ako kliknete i pomaknete miÅ¡a najmanje za navedeni broj toÄkica, zapoÄet Äe se s prevlaÄenjem." 539 msgid "" 540 "If you click with the mouse and begin to move the mouse at least the drag " 541 "start distance, a drag operation will be initiated." 542 msgstr "" 543 "Ako kliknete i pomaknete miÅ¡a najmanje za navedeni broj toÄkica, zapoÄet Äe " 544 "se s prevlaÄenjem." 444 545 445 546 #. +> trunk stable … … 450 551 #. +> trunk stable 451 552 #: mouse.cpp:276 452 msgid "If you use the wheel of a mouse, this value determines the number of lines to scroll for each wheel movement. Note that if this number exceeds the number of visible lines, it will be ignored and the wheel movement will be handled as a page up/down movement." 453 msgstr "Ako upotrebljavate kotaÄiÄ miÅ¡a ova vrijednost odreÄuje broj redaka koji Äe biti pomaknuti za svaki pomak kotaÄiÄa. Napomena: Ako je ovaj broj veÄi od broja vidljivih redaka, zadani broj Äe biti zanemaren, a pomak kotaÄiÄa izvodit Äe kretanje stranicu naprijed i natrag." 553 msgid "" 554 "If you use the wheel of a mouse, this value determines the number of lines to " 555 "scroll for each wheel movement. Note that if this number exceeds the number " 556 "of visible lines, it will be ignored and the wheel movement will be handled " 557 "as a page up/down movement." 558 msgstr "" 559 "Ako upotrebljavate kotaÄiÄ miÅ¡a ova vrijednost odreÄuje broj redaka koji Äe " 560 "biti pomaknuti za svaki pomak kotaÄiÄa. Napomena: Ako je ovaj broj veÄi od " 561 "broja vidljivih redaka, zadani broj Äe biti zanemaren, a pomak kotaÄiÄa " 562 "izvodit Äe kretanje stranicu naprijed i natrag." 454 563 455 564 #. +> trunk stable … … 583 692 #: xcursor/themepage.cpp:312 584 693 #, kde-format 585 msgid "Unable to download the cursor theme archive; please check that the address %1 is correct." 586 msgstr "Nije moguÄe pronaÄi arhivu teme pokazivaÄa. Provjerite je li adresa %1 ispravna." 694 msgid "" 695 "Unable to download the cursor theme archive; please check that the address %1 " 696 "is correct." 697 msgstr "" 698 "Nije moguÄe pronaÄi arhivu teme pokazivaÄa. Provjerite je li adresa %1 " 699 "ispravna." 587 700 588 701 #. +> trunk stable … … 594 707 #. +> trunk stable 595 708 #: xcursor/themepage.cpp:336 596 msgid "<qt>You cannot delete the theme you are currently using.<br />You have to switch to another theme first.</qt>" 597 msgstr "<qt>Ne moÅŸete izbrisati temu koju trenutno koristite.<br /> Prvo morate promijeniti na neku drugu temu.</qt>" 709 msgid "" 710 "<qt>You cannot delete the theme you are currently using.<br />You have to " 711 "switch to another theme first.</qt>" 712 msgstr "" 713 "<qt>Ne moÅŸete izbrisati temu koju trenutno koristite.<br /> Prvo morate " 714 "promijeniti na neku drugu temu.</qt>" 598 715 599 716 #. +> trunk stable 600 717 #: xcursor/themepage.cpp:342 601 718 #, kde-format 602 msgid "<qt>Are you sure you want to remove the <i>%1</i> cursor theme?<br />This will delete all the files installed by this theme.</qt>" 603 msgstr "<qt>Jeste li sigurni da ÅŸelite ukloniti temu pokazivaÄa <i>%1</i>?<br />Na ovaj Äete naÄin izbrisati sve datoteke koje je ova tema instalirala.</qt>" 719 msgid "" 720 "<qt>Are you sure you want to remove the <i>%1</i> cursor theme?<br />This " 721 "will delete all the files installed by this theme.</qt>" 722 msgstr "" 723 "<qt>Jeste li sigurni da ÅŸelite ukloniti temu pokazivaÄa <i>%1</i>?<br />Na " 724 "ovaj Äete naÄin izbrisati sve datoteke koje je ova tema instalirala.</qt>" 604 725 605 726 #. +> trunk stable … … 611 732 #: xcursor/themepage.cpp:405 612 733 #, kde-format 613 msgid "A theme named %1 already exists in your icon theme folder. Do you want replace it with this one?" 614 msgstr "Tema naziva %1 veÄ postoji u vaÅ¡oj mapi tema ikona. Åœelite li ju zamijeniti ovom temom?" 734 msgid "" 735 "A theme named %1 already exists in your icon theme folder. Do you want " 736 "replace it with this one?" 737 msgstr "" 738 "Tema naziva %1 veÄ postoji u vaÅ¡oj mapi tema ikona. Åœelite li ju zamijeniti " 739 "ovom temom?" 615 740 616 741 #. +> trunk stable … … 623 748 #: xcursor/themepage.ui:17 624 749 msgid "Select the cursor theme you want to use (hover preview to test cursor):" 625 msgstr "Odaberite temu pokazivaÄa koju ÅŸelite upotrebljavati (za pregled namjestite pokazivaÄ):" 750 msgstr "" 751 "Odaberite temu pokazivaÄa koju ÅŸelite upotrebljavati (za pregled namjestite " 752 "pokazivaÄ):" 626 753 627 754 #. i18n: ectx: property (toolTip), widget (KPushButton, installKnsButton) 628 755 #. +> trunk stable 629 756 #: xcursor/themepage.ui:56 630 #, fuzzy631 757 msgid "Get new color schemes from the Internet" 632 msgstr " Skini nove sheme boja s Interneta"758 msgstr "Dohvati nove sheme boja s Interneta" 633 759 634 760 #. i18n: ectx: property (text), widget (KPushButton, installKnsButton) 635 761 #. +> trunk stable 636 762 #: xcursor/themepage.ui:59 637 #, fuzzy638 763 msgid "Get New Theme..." 639 msgstr "Dohvati novu temu âŠ"764 msgstr "Dohvati novu temu..." 640 765 641 766 #. i18n: ectx: property (text), widget (KPushButton, installButton) 642 767 #. +> trunk stable 643 768 #: xcursor/themepage.ui:66 644 #, fuzzy645 769 msgid "Install From File..." 646 msgstr "I z datoteke âŠ"770 msgstr "Instaliraj iz datoteke..." 647 771 648 772 #. i18n: ectx: property (text), widget (KPushButton, removeButton) -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmkio.po
r1123 r1129 5 5 # Marko Dimjasevic <marko@dimjasevic.net>, 2010, 2011. 6 6 # Andrej Dundovic <adundovi@gmail.com>, 2010. 7 # Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>, 2011. 7 8 msgid "" 8 9 msgstr "" … … 10 11 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 11 12 "POT-Creation-Date: 2011-07-08 10:22+0200\n" 12 "PO-Revision-Date: 2011-0 3-04 18:46+0100\n"13 "Last-Translator: Marko Dimja sevic<marko@dimjasevic.net>\n"13 "PO-Revision-Date: 2011-07-12 16:53+0200\n" 14 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 14 15 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" 15 16 "MIME-Version: 1.0\n" … … 17 18 "Content-Transfer-Encoding: 8bit\n" 18 19 "Language: hr\n" 19 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 20 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 21 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 20 22 "X-Generator: Lokalize 1.2\n" 21 23 "X-Environment: kde\n" … … 25 27 #. +> trunk stable 26 28 #: bookmarks.cpp:108 27 msgid "<h1>My Bookmarks</h1><p>This module lets you configure the bookmarks home page.</p><p>The bookmarks home page is accessible at <a href=\"bookmarks:/\">bookmarks:/</a>.</p>" 28 msgstr "<h1>Moje oznake</h1> <p>Ovaj modul Vam omoguÄuje konfiguraciju naslovne strane oznaka</p> <p>Naslovna strana oznaka je dostubna na <a href=\"bookmarks:/\">bookmarks:/</a>.</p>" 29 msgid "" 30 "<h1>My Bookmarks</h1><p>This module lets you configure the bookmarks home " 31 "page.</p><p>The bookmarks home page is accessible at <a href=\"bookmarks:/\">" 32 "bookmarks:/</a>.</p>" 33 msgstr "" 34 "<h1>Moje oznake</h1> <p>Ovaj modul Vam omoguÄuje konfiguraciju naslovne " 35 "strane oznaka</p> <p>Naslovna strana oznaka je dostubna na <a " 36 "href=\"bookmarks:/\">bookmarks:/</a>.</p>" 29 37 30 38 #. i18n: ectx: property (title), widget (QGroupBox, groupBox) … … 38 46 #: bookmarks.ui:23 39 47 msgid "" 40 "If this option is unchecked, bookmarks at the root of the hierarchy (not in a folder) are not displayed.\n" 48 "If this option is unchecked, bookmarks at the root of the hierarchy (not in a " 49 "folder) are not displayed.\n" 41 50 "If checked, they are gathered in a \"root\" folder." 42 51 msgstr "" 43 "Ako je ova opcija iskljuÄena, oznake na vrhu hijerarhije (koje nisu ni u jednom direktoriju) neÄe biti prikazane.\n" 52 "Ako je ova opcija iskljuÄena, oznake na vrhu hijerarhije (koje nisu ni u " 53 "jednom direktoriju) neÄe biti prikazane.\n" 44 54 "Ako je ukljuÄena, one Äe biti prikazane u direktoriju \"korijen\" (\"root\")." 45 55 … … 54 64 #: bookmarks.ui:37 55 65 msgid "" 56 "Sub-folders are shown within their parent by default. If you activate this option, sub-folders are displayed on their own.\n" 57 "It looks less nice but it may help if you have a very big folder you want to spread in two columns." 58 msgstr "" 59 "Poddirektoriji su uobiÄajeno prikazani unutar svojih roditelja. Ako aktivirate ovu opciju, podfolderi Äe biti prikazani samostalno.\n" 60 "MoÅŸda Äe izgledati loÅ¡ije, ali moÅŸe Vam pomoÄi ako imate jako veliki direktorij koji ÅŸelite podijeliti u dva stupca." 66 "Sub-folders are shown within their parent by default. If you activate this " 67 "option, sub-folders are displayed on their own.\n" 68 "It looks less nice but it may help if you have a very big folder you want to " 69 "spread in two columns." 70 msgstr "" 71 "Poddirektoriji su uobiÄajeno prikazani unutar svojih roditelja. Ako " 72 "aktivirate ovu opciju, podfolderi Äe biti prikazani samostalno.\n" 73 "MoÅŸda Äe izgledati loÅ¡ije, ali moÅŸe Vam pomoÄi ako imate jako veliki " 74 "direktorij koji ÅŸelite podijeliti u dva stupca." 61 75 62 76 #. i18n: ectx: property (text), widget (QCheckBox, cbFlattenTree) … … 69 83 #. +> trunk stable 70 84 #: bookmarks.ui:47 71 msgid "Show a box with KDE places (Home, Network, ...). Useful if you use konqueror as a file manager." 72 msgstr "PrikaÅŸi kuÄicu sa KDE mjestima (Osobna mapa, MreÅŸa,âŠ). Korisno ako koristite konqueror kao upravitelj datoteka." 85 msgid "" 86 "Show a box with KDE places (Home, Network, ...). Useful if you use konqueror " 87 "as a file manager." 88 msgstr "" 89 "PrikaÅŸi kuÄicu sa KDE mjestima (Osobna mapa, MreÅŸa,âŠ). Korisno ako koristite " 90 "konqueror kao upravitelj datoteka." 73 91 74 92 #. i18n: ectx: property (text), widget (QCheckBox, cbShowPlaces) … … 87 105 #. +> trunk stable 88 106 #: bookmarks.ui:71 89 msgid "Folders are automatically distributed in several columns. The optimal number of columns depends on the width of the konqueror window and the number of bookmarks you have." 90 msgstr "Direktoriji se automatski rasporeÄuju u viÅ¡e stupaca. Optimalni broj stupaca ovisi o Å¡irini prozora Konquerora i broju oznaka koje imate." 107 msgid "" 108 "Folders are automatically distributed in several columns. The optimal number " 109 "of columns depends on the width of the konqueror window and the number of " 110 "bookmarks you have." 111 msgstr "" 112 "Direktoriji se automatski rasporeÄuju u viÅ¡e stupaca. Optimalni broj stupaca " 113 "ovisi o Å¡irini prozora Konquerora i broju oznaka koje imate." 91 114 92 115 #. i18n: ectx: property (text), widget (QLabel, label) … … 100 123 #: bookmarks.ui:109 101 124 msgid "Disable it on slow system to disable background images." 102 msgstr "OnemoguÄite ovo na sporim sustavima da biste onesposobili pozadinske slike." 125 msgstr "" 126 "OnemoguÄite ovo na sporim sustavima da biste onesposobili pozadinske slike." 103 127 104 128 #. i18n: ectx: property (text), widget (QCheckBox, cbShowBackgrounds) … … 146 170 #. +> trunk stable 147 171 #: cache.cpp:111 148 msgid "<h1>Cache</h1><p>This module lets you configure your cache settings.</p><p>The cache is an internal memory in Konqueror where recently read web pages are stored. If you want to retrieve a web page again that you have recently read, it will not be downloaded from the Internet, but rather retrieved from the cache, which is a lot faster.</p>" 149 msgstr "<h1>Predmemorija</h1> <p>Ovaj modul Vam omoguÄuje konfiguraciju postavki predmemorije</p> <p>Predmemorija je interna memorija u Konqueroru gdje su spremljene nedavno otvorene web stranice. Ako ÅŸelite ponovo kasnije otvoriti web stranicu koju ste nedavno otvarali, ona viÅ¡e neÄe biti skidana s Interneta, nego Äe biti izvuÄena iz prememorije, Å¡to je puno brÅŸe.</p>" 172 msgid "" 173 "<h1>Cache</h1><p>This module lets you configure your cache settings.</p><p>" 174 "The cache is an internal memory in Konqueror where recently read web pages " 175 "are stored. If you want to retrieve a web page again that you have recently " 176 "read, it will not be downloaded from the Internet, but rather retrieved from " 177 "the cache, which is a lot faster.</p>" 178 msgstr "" 179 "<h1>Predmemorija</h1> <p>Ovaj modul Vam omoguÄuje konfiguraciju postavki " 180 "predmemorije</p> <p>Predmemorija je interna memorija u Konqueroru gdje su " 181 "spremljene nedavno otvorene web stranice. Ako ÅŸelite ponovo kasnije otvoriti " 182 "web stranicu koju ste nedavno otvarali, ona viÅ¡e neÄe biti skidana s " 183 "Interneta, nego Äe biti izvuÄena iz prememorije, Å¡to je puno brÅŸe.</p>" 150 184 151 185 #. i18n: ectx: property (whatsThis), widget (QCheckBox, cbUseCache) 152 186 #. +> trunk stable 153 187 #: cache.ui:17 154 msgid "Check this box if you want the web pages you visit to be stored on your hard disk for quicker access. The stored pages will only be updated as needed instead of on every visit to that site. This is especially useful if you have a slow connection to the Internet." 155 msgstr "OznaÄite ovu kuÄicu ako ÅŸelite da web stranice koje gledate budu pohranjene na vaÅ¡em tvrdom disku za brÅŸi pristup istima. Tako Äe pristup njima biti neÅ¡to brÅŸi jer Äe se s mreÅŸe uÄitavati samo one koje nemate na disku, Å¡to je vrlo zgodno ako imate sporiju vezu prema internetu." 188 msgid "" 189 "Check this box if you want the web pages you visit to be stored on your hard " 190 "disk for quicker access. The stored pages will only be updated as needed " 191 "instead of on every visit to that site. This is especially useful if you have " 192 "a slow connection to the Internet." 193 msgstr "" 194 "OznaÄite ovu kuÄicu ako ÅŸelite da web stranice koje gledate budu pohranjene " 195 "na vaÅ¡em tvrdom disku za brÅŸi pristup istima. Tako Äe pristup njima biti " 196 "neÅ¡to brÅŸi jer Äe se s mreÅŸe uÄitavati samo one koje nemate na disku, Å¡to je " 197 "vrlo zgodno ako imate sporiju vezu prema internetu." 156 198 157 199 #. i18n: ectx: property (text), widget (QCheckBox, cbUseCache) … … 171 213 #. +> trunk stable 172 214 #: cache.ui:52 173 msgid "Verify whether the cached web page is valid before attempting to fetch the web page again." 174 msgstr "Provjeri je li spremljena web stranica ispravna prije nego je pokuÅ¡aÅ¡ dohvatiti ponovno." 215 msgid "" 216 "Verify whether the cached web page is valid before attempting to fetch the " 217 "web page again." 218 msgstr "" 219 "Provjeri je li spremljena web stranica ispravna prije nego je pokuÅ¡aÅ¡ " 220 "dohvatiti ponovno." 175 221 176 222 #. i18n: ectx: property (text), widget (QRadioButton, rbVerifyCache) … … 183 229 #. +> trunk stable 184 230 #: cache.ui:62 185 msgid "Always use documents from the cache when available. You can still use the reload button to synchronize the cache with the remote host." 186 msgstr "Ova opcija omoguÄuje da dokumenti uvijek budu uÄitani iz priruÄne memorije ukoliko omoguÄeno.Uvijek moÅŸete upotrijebiti gumb za ponovno uÄitavanje stranice sa udaljenog raÄunala." 231 msgid "" 232 "Always use documents from the cache when available. You can still use the " 233 "reload button to synchronize the cache with the remote host." 234 msgstr "" 235 "Ova opcija omoguÄuje da dokumenti uvijek budu uÄitani iz priruÄne memorije " 236 "ukoliko omoguÄeno.Uvijek moÅŸete upotrijebiti gumb za ponovno uÄitavanje " 237 "stranice sa udaljenog raÄunala." 187 238 188 239 #. i18n: ectx: property (text), widget (QRadioButton, rbCacheIfPossible) … … 195 246 #. +> trunk stable 196 247 #: cache.ui:72 197 msgid "Do not fetch web pages that are not already stored in the cache. Offline mode prevents you from viewing pages that you have not previously visited." 198 msgstr "Ne dohvaÄaj web stranice koje veÄ nisu pohranjene u meÄuspremniku. NeumreÅŸeni naÄin rada spreÄava spreÄava vas u gledanjustranica koje niste prethodno posjetili." 248 msgid "" 249 "Do not fetch web pages that are not already stored in the cache. Offline mode " 250 "prevents you from viewing pages that you have not previously visited." 251 msgstr "" 252 "Ne dohvaÄaj web stranice koje veÄ nisu pohranjene u meÄuspremniku. NeumreÅŸeni " 253 "naÄin rada spreÄava spreÄava vas u gledanjustranica koje niste prethodno " 254 "posjetili." 199 255 200 256 #. i18n: ectx: property (text), widget (QRadioButton, rbOfflineMode) … … 234 290 msgid "" 235 291 "<qt>\n" 236 "Enter the name of the environment variable, e.g. <b>HTTP_PROXY</b>, used to store the address of the HTTP proxy server.<p>\n" 237 "Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt automatic discovery of this variable.</p>\n" 238 "</qt>" 239 msgstr "" 240 "<qt>\n" 241 "Unesite ime varijable okoline, npr. <b>HTTP_PROXY</b>, koja Äe se koristiti za spremanje adrese HTTP posredniÄkog posluÅŸitelja. <p>\n" 242 "Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da biste pokrenuli automatsko otkrivanje te varijable.\n" 292 "Enter the name of the environment variable, e.g. <b>HTTP_PROXY</b>, used to " 293 "store the address of the HTTP proxy server.<p>\n" 294 "Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt " 295 "automatic discovery of this variable.</p>\n" 296 "</qt>" 297 msgstr "" 298 "<qt>\n" 299 "Unesite ime varijable okoline, npr. <b>HTTP_PROXY</b>, koja Äe se koristiti " 300 "za spremanje adrese HTTP posredniÄkog posluÅŸitelja. <p>\n" 301 "Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da " 302 "biste pokrenuli automatsko otkrivanje te varijable.\n" 243 303 "</qt>" 244 304 … … 261 321 msgid "" 262 322 "<qt>\n" 263 "Enter the name of the environment variable, e.g. <b>HTTPS_PROXY</b>, used to store the address of the HTTPS proxy server.<p>\n" 264 "Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt an automatic discovery of this variable.</p>\n" 265 "</qt>" 266 msgstr "" 267 "<qt>\n" 268 "Unesite ime varijable okoline, npr. <b>HTTP_PROXY</b>, koja Äe se koristiti za spremanje adrese HTTP posredniÄkog posluÅŸitelja. <p>\n" 269 "Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da biste pokrenuli automatsko otkrivanje te varijable.\n" 323 "Enter the name of the environment variable, e.g. <b>HTTPS_PROXY</b>, used to " 324 "store the address of the HTTPS proxy server.<p>\n" 325 "Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt " 326 "an automatic discovery of this variable.</p>\n" 327 "</qt>" 328 msgstr "" 329 "<qt>\n" 330 "Unesite ime varijable okoline, npr. <b>HTTP_PROXY</b>, koja Äe se koristiti " 331 "za spremanje adrese HTTP posredniÄkog posluÅŸitelja. <p>\n" 332 "Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da " 333 "biste pokrenuli automatsko otkrivanje te varijable.\n" 270 334 "</qt>" 271 335 … … 288 352 msgid "" 289 353 "<qt>\n" 290 "Enter the name of the environment variable, e.g. <b>FTP_PROXY</b>, used to store the address of the FTP proxy server.<p>\n" 291 "Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt an automatic discovery of this variable.</p>\n" 292 "</qt>" 293 msgstr "" 294 "<qt>\n" 295 "Unesite ime varijable okoline, npr. <b>FTP_PROXY</b>, koja Äe se koristiti za spremanje adrese FTP posredniÄkog posluÅŸitelja. <p>\n" 296 "Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da biste pokrenuli automatsko otkrivanje te varijable.\n" 354 "Enter the name of the environment variable, e.g. <b>FTP_PROXY</b>, used to " 355 "store the address of the FTP proxy server.<p>\n" 356 "Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt " 357 "an automatic discovery of this variable.</p>\n" 358 "</qt>" 359 msgstr "" 360 "<qt>\n" 361 "Unesite ime varijable okoline, npr. <b>FTP_PROXY</b>, koja Äe se koristiti za " 362 "spremanje adrese FTP posredniÄkog posluÅŸitelja. <p>\n" 363 "Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da " 364 "biste pokrenuli automatsko otkrivanje te varijable.\n" 297 365 "</qt>" 298 366 … … 309 377 msgid "" 310 378 "<qt>\n" 311 "Enter the environment variable, e.g. <b>NO_PROXY</b>, used to store the addresses of sites for which the proxy server should not be used.<p>\n" 312 "Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt an automatic discovery of this variable.\n" 313 "</qt>" 314 msgstr "" 315 "<qt>\n" 316 "Unesite ime varijable okoline, npr. <b>NO_PROXY</b>, koja Äe se koristiti za spremanje adrese web stranica za koje neÄe biti koriÅ¡ten posredniÄki posluÅŸitelj. <p>\n" 317 "Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da biste pokrenuli automatsko otkrivanje te varijable.\n" 379 "Enter the environment variable, e.g. <b>NO_PROXY</b>, used to store the " 380 "addresses of sites for which the proxy server should not be used.<p>\n" 381 "Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt " 382 "an automatic discovery of this variable.\n" 383 "</qt>" 384 msgstr "" 385 "<qt>\n" 386 "Unesite ime varijable okoline, npr. <b>NO_PROXY</b>, koja Äe se koristiti za " 387 "spremanje adrese web stranica za koje neÄe biti koriÅ¡ten posredniÄki " 388 "posluÅŸitelj. <p>\n" 389 "Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da " 390 "biste pokrenuli automatsko otkrivanje te varijable.\n" 318 391 "</qt>" 319 392 … … 333 406 #. +> trunk stable 334 407 #: envvarproxy.ui:181 335 msgid "<qt>Verify whether or not the environment variable names you supplied are valid. If an environment variable is not found, the associated labels will be <b>highlighted</b> to indicate that they are invalid.</qt>" 336 msgstr "<qt>Kliknite na ovaj gumb za brzu provjeru jesu li okoliÅ¡ne varijable koje ste napisali ispravne. Ako to nije sluÄaj, odnosno ako neka varijabla nije naÄena onda Äe ona biti osvjetljena, kako bi znali gdje je greÅ¡ka.</qt>" 408 msgid "" 409 "<qt>Verify whether or not the environment variable names you supplied are " 410 "valid. If an environment variable is not found, the associated labels will be " 411 "<b>highlighted</b> to indicate that they are invalid.</qt>" 412 msgstr "" 413 "<qt>Kliknite na ovaj gumb za brzu provjeru jesu li okoliÅ¡ne varijable koje " 414 "ste napisali ispravne. Ako to nije sluÄaj, odnosno ako neka varijabla nije " 415 "naÄena onda Äe ona biti osvjetljena, kako bi znali gdje je greÅ¡ka.</qt>" 337 416 338 417 #. i18n: ectx: property (text), widget (QPushButton, pbVerify) … … 345 424 #. +> trunk stable 346 425 #: envvarproxy.ui:191 347 msgid "<qt>Attempt automatic discovery of the environment variables used for setting system wide proxy information.<p> This feature works by searching for commonly used variable names such as HTTP_PROXY, FTP_PROXY and NO_PROXY.</qt>" 348 msgstr "<qt>PokuÅ¡aj automatskog otkrivanja varijabli okoline koje se koriste za postavljanje sustavskih informacija o posrednicima. <p>Ova moguÄnost radi za pretragu Äesto koriÅ¡tenih varijabli poput HTTP_PROXY, FTP_PROXY i NO_PROXY.</qt>" 426 msgid "" 427 "<qt>Attempt automatic discovery of the environment variables used for setting " 428 "system wide proxy information.<p> This feature works by searching for " 429 "commonly used variable names such as HTTP_PROXY, FTP_PROXY and NO_PROXY.</qt>" 430 msgstr "" 431 "<qt>PokuÅ¡aj automatskog otkrivanja varijabli okoline koje se koriste za " 432 "postavljanje sustavskih informacija o posrednicima. <p>Ova moguÄnost radi za " 433 "pretragu Äesto koriÅ¡tenih varijabli poput HTTP_PROXY, FTP_PROXY i NO_PROXY.<" 434 "/qt>" 349 435 350 436 #. i18n: ectx: property (text), widget (QPushButton, pbDetect) … … 375 461 #. +> trunk stable 376 462 #: kcookiesmain.cpp:88 377 msgid "<p><h1>Cookies</h1> Cookies contain information that Konqueror (or other KDE applications using the HTTP protocol) stores on your computer, initiated by a remote Internet server. This means that a web server can store information about you and your browsing activities on your machine for later use. You might consider this an invasion of privacy.</p><p> However, cookies are useful in certain situations. For example, they are often used by Internet shops, so you can 'put things into a shopping basket'. Some sites require you have a browser that supports cookies.</p><p> Because most people want a compromise between privacy and the benefits cookies offer, KDE offers you the ability to customize the way it handles cookies. So you might want to set KDE's default policy to ask you whenever a server wants to set a cookie, allowing you to decide. For your favorite shopping web sites that you trust, you might want to set the policy to accept, then you can access the web sites without being prompted every time KDE receives a cookie.</p>" 378 msgstr "<p> <h1>KolaÄiÄi</h1> KolaÄiÄi sadrÅŸe informacije koje Konqueror (ili druga KDE aplikacija koja koristi HTTP protokol) spremi na VaÅ¡e raÄunalo, a poslane su od udaljenog Internet posluÅŸitelja. To znaÄi da web posluÅŸitelj moÅŸe spremiti informacije o Vama i vaÅ¡im aktivnostima na Internetu na VaÅ¡e raÄunalo za kasniju upotrebu. Ovo moÅŸete smatrati naruÅ¡avanjem privatnosti.</p> <p>MeÄutim, kolaÄiÄi su korisni u nekim situacijama. Na primjer, Äesto se koriste u Internet duÄanima, gdje moÅŸete 'staviti stvari u koÅ¡aricu'. Neke web stranice zahtijevaju pregledavanje preglednikom koji podrÅŸava kolaÄiÄe.</p> <p>BuduÄi da veÄina ljudi ÅŸeli kompromis izmeÄu privatnosti i prednosti koje kolaÄiÄi nude, KDE Vam nudi moguÄnost da odredite naÄin upravljanja kolaÄiÄima. Tako moÅŸda ÅŸelite postaviti KDE-ovu uobiÄajenu politiku da Vas se pita svaki put kad posluÅŸitelj ÅŸeli postaviti kolaÄiÄ, Å¡to Vam omoguÄuje odluÄivanje. Za VaÅ¡e omiljene Internet duÄane kojima vjerujete, moÅŸda ÅŸelite postaviti politiku da se prihvaÄaju svi kolaÄiÄi, pa Äete tada moÄi pristupati tim web stranicama bez da Vas se svaki put pita kada KDE primi kolaÄiÄ-</p>" 463 msgid "" 464 "<p><h1>Cookies</h1> Cookies contain information that Konqueror (or other KDE " 465 "applications using the HTTP protocol) stores on your computer, initiated by a " 466 "remote Internet server. This means that a web server can store information " 467 "about you and your browsing activities on your machine for later use. You " 468 "might consider this an invasion of privacy.</p><p> However, cookies are " 469 "useful in certain situations. For example, they are often used by Internet " 470 "shops, so you can 'put things into a shopping basket'. Some sites require you " 471 "have a browser that supports cookies.</p><p> Because most people want a " 472 "compromise between privacy and the benefits cookies offer, KDE offers you the " 473 "ability to customize the way it handles cookies. So you might want to set " 474 "KDE's default policy to ask you whenever a server wants to set a cookie, " 475 "allowing you to decide. For your favorite shopping web sites that you trust, " 476 "you might want to set the policy to accept, then you can access the web sites " 477 "without being prompted every time KDE receives a cookie.</p>" 478 msgstr "" 479 "<p> <h1>KolaÄiÄi</h1> KolaÄiÄi sadrÅŸe informacije koje Konqueror (ili druga " 480 "KDE aplikacija koja koristi HTTP protokol) spremi na VaÅ¡e raÄunalo, a poslane " 481 "su od udaljenog Internet posluÅŸitelja. To znaÄi da web posluÅŸitelj moÅŸe " 482 "spremiti informacije o Vama i vaÅ¡im aktivnostima na Internetu na VaÅ¡e " 483 "raÄunalo za kasniju upotrebu. Ovo moÅŸete smatrati naruÅ¡avanjem privatnosti.<" 484 "/p> <p>MeÄutim, kolaÄiÄi su korisni u nekim situacijama. Na primjer, Äesto se " 485 "koriste u Internet duÄanima, gdje moÅŸete 'staviti stvari u koÅ¡aricu'. Neke " 486 "web stranice zahtijevaju pregledavanje preglednikom koji podrÅŸava kolaÄiÄe.<" 487 "/p> <p>BuduÄi da veÄina ljudi ÅŸeli kompromis izmeÄu privatnosti i prednosti " 488 "koje kolaÄiÄi nude, KDE Vam nudi moguÄnost da odredite naÄin upravljanja " 489 "kolaÄiÄima. Tako moÅŸda ÅŸelite postaviti KDE-ovu uobiÄajenu politiku da Vas se " 490 "pita svaki put kad posluÅŸitelj ÅŸeli postaviti kolaÄiÄ, Å¡to Vam omoguÄuje " 491 "odluÄivanje. Za VaÅ¡e omiljene Internet duÄane kojima vjerujete, moÅŸda ÅŸelite " 492 "postaviti politiku da se prihvaÄaju svi kolaÄiÄi, pa Äete tada moÄi " 493 "pristupati tim web stranicama bez da Vas se svaki put pita kada KDE primi " 494 "kolaÄiÄ-</p>" 379 495 380 496 #. +> trunk stable … … 405 521 #. +> trunk stable 406 522 #: kcookiesmanagement.cpp:242 407 msgid "Unable to retrieve information about the cookies stored on your computer." 408 msgstr "DohvaÄanje informacija o cookie-ima spremljenim na vaÅ¡em raÄunalu nije uspjelo." 523 msgid "" 524 "Unable to retrieve information about the cookies stored on your computer." 525 msgstr "" 526 "DohvaÄanje informacija o cookie-ima spremljenim na vaÅ¡em raÄunalu nije " 527 "uspjelo." 409 528 410 529 #. +> trunk stable … … 515 634 #. +> trunk stable 516 635 #: kcookiespolicies.cpp:178 517 #, fuzzy518 636 #| msgid "New Cookie Policy" 519 637 msgctxt "@title:window" … … 523 641 #. +> trunk stable 524 642 #: kcookiespolicies.cpp:217 525 #, fuzzy526 643 #| msgid "Change Cookie Policy" 527 644 msgctxt "@title:window" 528 645 msgid "Change Cookie Policy" 529 msgstr "Prom jeni pravila za kolaÄiÄe"646 msgstr "Promijeni pravila za kolaÄiÄe" 530 647 531 648 #. +> trunk stable 532 649 #: kcookiespolicies.cpp:242 533 650 #, kde-format 534 msgid "<qt>A policy already exists for<center><b>%1</b></center>Do you want to replace it?</qt>" 535 msgstr "<qt>Politika veÄ postoji za <center><b>%1</b></center> Åœelite li ju zamijeniti?</qt>" 651 msgid "" 652 "<qt>A policy already exists for<center><b>%1</b></center>Do you want to " 653 "replace it?</qt>" 654 msgstr "" 655 "<qt>Politika veÄ postoji za <center><b>%1</b></center> Åœelite li ju " 656 "zamijeniti?</qt>" 536 657 537 658 #. +> trunk stable 538 659 #: kcookiespolicies.cpp:246 539 #, fuzzy540 660 #| msgid "Duplicate Policy" 541 661 msgctxt "@title:window" 542 662 msgid "Duplicate Policy" 543 msgstr " PodvostruÄi pravilo"663 msgstr "Duplikat pravila" 544 664 545 665 #. +> trunk stable … … 559 679 #. +> trunk stable 560 680 #: kcookiespolicies.cpp:464 561 msgid "<p><h1>Cookies</h1> Cookies contain information that Konqueror (or any other KDE application using the HTTP protocol) stores on your computer from a remote Internet server. This means that a web server can store information about you and your browsing activities on your machine for later use. You might consider this an invasion of privacy.</p><p>However, cookies are useful in certain situations. For example, they are often used by Internet shops, so you can 'put things into a shopping basket'. Some sites require you have a browser that supports cookies.</p><p>Because most people want a compromise between privacy and the benefits cookies offer, KDE offers you the ability to customize the way it handles cookies. You might, for example want to set KDE's default policy to ask you whenever a server wants to set a cookie or simply reject or accept everything. For example, you might choose to accept all cookies from your favorite shopping web site. For this all you have to do is either browse to that particular site and when you are presented with the cookie dialog box, click on <i> This domain </i> under the 'apply to' tab and choose accept or simply specify the name of the site in the <i> Domain Specific Policy </i> tab and set it to accept. This enables you to receive cookies from trusted web sites without being asked every time KDE receives a cookie.</p>" 562 msgstr "<p> <h1>KolaÄiÄi</h1> KolaÄiÄi sadrÅŸe informacije koje Konqueror (ili druga KDE aplikacija koja koristi HTTP protokol) spremi na VaÅ¡e raÄunalo, a poslane su od udaljenog Internet posluÅŸitelja. To znaÄi da web posluÅŸitelj moÅŸe spremiti informacije o Vama i vaÅ¡im aktivnostima na Internetu na VaÅ¡e raÄunalo za kasniju upotrebu. Ovo moÅŸete smatrati naruÅ¡avanjem privatnosti.</p> <p>MeÄutim, kolaÄiÄi su korisni u nekim situacijama. Na primjer, Äesto se koriste u Internet duÄanima, gdje moÅŸete 'staviti stvari u koÅ¡aricu'. Neke web stranice zahtijevaju pregledavanje preglednikom koji podrÅŸava kolaÄiÄe.</p> <p>BuduÄi da veÄina ljudi ÅŸeli kompromis izmeÄu privatnosti i prednosti koje kolaÄiÄi nude, KDE Vam nudi moguÄnost da odredite naÄin upravljanja kolaÄiÄima. MoÅŸete, na primjer postaviti KDE-ovu uobiÄajenu politiku da Vas se pita svaki put kad KDE primi kolaÄiÄ ili da se jednostavno svi kolaÄiÄi prihvate ili odbiju. Na primjer, moÅŸete odrediti da se uvijek prihvate svi kolaÄiÄi sa vaÅ¡eg omiljenog Internet duÄana. Da biste to postavili, sve Å¡to moate uÄiniti jest ili otiÄi na ÅŸeljenu stranicu i kad Vas se pita za kolaÄiÄ, kliknite na <i>Ovu domenu</i> u kartici 'primijeni na' i odaberite 'prihvati' ili jednostavno definirajte ime web stranice u kartici <i>Politika odreÄene domene</i> i postavite da se prihvaÄa. To Äe omoguÄiti prihvaÄanje kolaÄiÄa iz povjerenih web stranica bez da Vas se pita svaki put kad KDE primi kolaÄiÄ.</p>" 681 msgid "" 682 "<p><h1>Cookies</h1> Cookies contain information that Konqueror (or any other " 683 "KDE application using the HTTP protocol) stores on your computer from a " 684 "remote Internet server. This means that a web server can store information " 685 "about you and your browsing activities on your machine for later use. You " 686 "might consider this an invasion of privacy.</p><p>However, cookies are useful " 687 "in certain situations. For example, they are often used by Internet shops, so " 688 "you can 'put things into a shopping basket'. Some sites require you have a " 689 "browser that supports cookies.</p><p>Because most people want a compromise " 690 "between privacy and the benefits cookies offer, KDE offers you the ability to " 691 "customize the way it handles cookies. You might, for example want to set " 692 "KDE's default policy to ask you whenever a server wants to set a cookie or " 693 "simply reject or accept everything. For example, you might choose to accept " 694 "all cookies from your favorite shopping web site. For this all you have to do " 695 "is either browse to that particular site and when you are presented with the " 696 "cookie dialog box, click on <i> This domain </i> under the 'apply to' tab and " 697 "choose accept or simply specify the name of the site in the <i> Domain " 698 "Specific Policy </i> tab and set it to accept. This enables you to receive " 699 "cookies from trusted web sites without being asked every time KDE receives a " 700 "cookie.</p>" 701 msgstr "" 702 "<p> <h1>KolaÄiÄi</h1> KolaÄiÄi sadrÅŸe informacije koje Konqueror (ili druga " 703 "KDE aplikacija koja koristi HTTP protokol) spremi na VaÅ¡e raÄunalo, a poslane " 704 "su od udaljenog Internet posluÅŸitelja. To znaÄi da web posluÅŸitelj moÅŸe " 705 "spremiti informacije o Vama i vaÅ¡im aktivnostima na Internetu na VaÅ¡e " 706 "raÄunalo za kasniju upotrebu. Ovo moÅŸete smatrati naruÅ¡avanjem privatnosti.<" 707 "/p> <p>MeÄutim, kolaÄiÄi su korisni u nekim situacijama. Na primjer, Äesto se " 708 "koriste u Internet duÄanima, gdje moÅŸete 'staviti stvari u koÅ¡aricu'. Neke " 709 "web stranice zahtijevaju pregledavanje preglednikom koji podrÅŸava kolaÄiÄe.<" 710 "/p> <p>BuduÄi da veÄina ljudi ÅŸeli kompromis izmeÄu privatnosti i prednosti " 711 "koje kolaÄiÄi nude, KDE Vam nudi moguÄnost da odredite naÄin upravljanja " 712 "kolaÄiÄima. MoÅŸete, na primjer postaviti KDE-ovu uobiÄajenu politiku da Vas " 713 "se pita svaki put kad KDE primi kolaÄiÄ ili da se jednostavno svi kolaÄiÄi " 714 "prihvate ili odbiju. Na primjer, moÅŸete odrediti da se uvijek prihvate svi " 715 "kolaÄiÄi sa vaÅ¡eg omiljenog Internet duÄana. Da biste to postavili, sve Å¡to " 716 "moate uÄiniti jest ili otiÄi na ÅŸeljenu stranicu i kad Vas se pita za " 717 "kolaÄiÄ, kliknite na <i>Ovu domenu</i> u kartici 'primijeni na' i odaberite " 718 "'prihvati' ili jednostavno definirajte ime web stranice u kartici <i>Politika " 719 "odreÄene domene</i> i postavite da se prihvaÄa. To Äe omoguÄiti prihvaÄanje " 720 "kolaÄiÄa iz povjerenih web stranica bez da Vas se pita svaki put kad KDE " 721 "primi kolaÄiÄ.</p>" 563 722 564 723 #. i18n: ectx: property (whatsThis), widget (QCheckBox, cbEnableCookies) … … 567 726 msgid "" 568 727 "<qt>\n" 569 "<p>Enable cookie support. Normally you will want to have cookie support enabled and customize it to suit your privacy needs.</p><p>\n" 570 "Please note that disabling cookie support might make many web sites unbrowsable.</p>\n" 571 "</qt>" 572 msgstr "" 573 "<qt>\n" 574 "<p>UkljuÄi podrÅ¡ku za kolaÄiÄe. ObiÄno se ÅŸeli imati podrÅ¡ku za kolaÄiÄe koja se moÅŸe namjestiti potrebama korisnika.</p><p>\n" 575 "Imajte na umu da iskljuÄivanje podrÅ¡ke za kolaÄiÄe Äini mnoge web stranice neupotrebljivim.</p>\n" 728 "<p>Enable cookie support. Normally you will want to have cookie support " 729 "enabled and customize it to suit your privacy needs.</p><p>\n" 730 "Please note that disabling cookie support might make many web sites " 731 "unbrowsable.</p>\n" 732 "</qt>" 733 msgstr "" 734 "<qt>\n" 735 "<p>UkljuÄi podrÅ¡ku za kolaÄiÄe. ObiÄno se ÅŸeli imati podrÅ¡ku za kolaÄiÄe koja " 736 "se moÅŸe namjestiti potrebama korisnika.</p><p>\n" 737 "Imajte na umu da iskljuÄivanje podrÅ¡ke za kolaÄiÄe Äini mnoge web stranice " 738 "neupotrebljivim.</p>\n" 576 739 " </qt>" 577 740 … … 587 750 msgid "" 588 751 "<qt>\n" 589 "Reject the so called third-party cookies. These are cookies that originate from a site other than the one you are currently browsing. For example, if you visit <b>www.foobar.com</b> while this option is on, only cookies that originate from www.foobar.com will be processed per your settings. Cookies from any other site will be rejected. This reduces the chances of site operators compiling a profile about your daily browsing habits.\n" 590 "</qt>" 591 msgstr "" 592 "<qt>\n" 593 "Odbijanje tzv. \"third-party\" kolaÄiÄa. Ovi kolaÄiÄi stiÅŸu sa drugih stranica od onih koje trenutno pregledavate. Na primjer, ako posjetite <b>www.klik.hr</b>, a ova opcija je ukljuÄena, samo kolaÄiÄi koji stiÅŸu sa tih stranica bit Äe obraÄeni prema vaÅ¡im postavkama. KolaÄiÄi s bilo koje druge adrese bit Äe odbijeni. Ova opcija smanjuje moguÄnost vlasnika stranica da izrade profil vaÅ¡ih dnevnih navika pregledavanja web stranica.\n" 752 "Reject the so called third-party cookies. These are cookies that originate " 753 "from a site other than the one you are currently browsing. For example, if " 754 "you visit <b>www.foobar.com</b> while this option is on, only cookies that " 755 "originate from www.foobar.com will be processed per your settings. Cookies " 756 "from any other site will be rejected. This reduces the chances of site " 757 "operators compiling a profile about your daily browsing habits.\n" 758 "</qt>" 759 msgstr "" 760 "<qt>\n" 761 "Odbijanje tzv. \"third-party\" kolaÄiÄa. Ovi kolaÄiÄi stiÅŸu sa drugih " 762 "stranica od onih koje trenutno pregledavate. Na primjer, ako posjetite <b>www." 763 "klik.hr</b>, a ova opcija je ukljuÄena, samo kolaÄiÄi koji stiÅŸu sa tih " 764 "stranica bit Äe obraÄeni prema vaÅ¡im postavkama. KolaÄiÄi s bilo koje druge " 765 "adrese bit Äe odbijeni. Ova opcija smanjuje moguÄnost vlasnika stranica da " 766 "izrade profil vaÅ¡ih dnevnih navika pregledavanja web stranica.\n" 594 767 "</qt>" 595 768 … … 605 778 msgid "" 606 779 "<qt>\n" 607 "<p>Automatically accept temporary cookies meant to expire at the end of the current session. Such cookies will not be stored in your computer's hard drive or storage device. Instead, they are deleted when you close all applications (e.g. your browser) that use them.</p><p>\n" 608 "<u>NOTE:</u> Checking this option along with the next one will override your default as well as site specific cookie policies. However, doing so also increases your privacy since all cookies will be removed when the current session ends.</p>\n" 609 "</qt>" 610 msgstr "" 611 "<qt>\n" 612 "<p>Automatski prihvati privremene kolaÄiÄe koji su odreÄeni da isteknu na kraju trenutne sjednice. Takvi kolaÄiÄi neÄe biti spremljeni na disk VaÅ¡eg raÄunala. Umjesto toga, oni Äe biti izbrisani kad pozatvorite sve aplikacije (npr. VaÅ¡ web preglednik) koje ih koriste.</p> <p>\n" 613 "<u>NAPOMENA:</u>UkljuÄivanje ove opcije zajedno sa sljedeÄom Äe nadvladati vaÅ¡u uobiÄajenu kao i politiku specifiÄnih web stranica. MeÄutim, to Äe takoÄer i poveÄati razinu privatnosti jer Äe svi kolaÄiÄi biti izbrisani kad trenutna sjednica zavrÅ¡i.</p> \n" 780 "<p>Automatically accept temporary cookies meant to expire at the end of the " 781 "current session. Such cookies will not be stored in your computer's hard " 782 "drive or storage device. Instead, they are deleted when you close all " 783 "applications (e.g. your browser) that use them.</p><p>\n" 784 "<u>NOTE:</u> Checking this option along with the next one will override your " 785 "default as well as site specific cookie policies. However, doing so also " 786 "increases your privacy since all cookies will be removed when the current " 787 "session ends.</p>\n" 788 "</qt>" 789 msgstr "" 790 "<qt>\n" 791 "<p>Automatski prihvati privremene kolaÄiÄe koji su odreÄeni da isteknu na " 792 "kraju trenutne sjednice. Takvi kolaÄiÄi neÄe biti spremljeni na disk VaÅ¡eg " 793 "raÄunala. Umjesto toga, oni Äe biti izbrisani kad pozatvorite sve aplikacije " 794 "(npr. VaÅ¡ web preglednik) koje ih koriste.</p> <p>\n" 795 "<u>NAPOMENA:</u>UkljuÄivanje ove opcije zajedno sa sljedeÄom Äe nadvladati " 796 "vaÅ¡u uobiÄajenu kao i politiku specifiÄnih web stranica. MeÄutim, to Äe " 797 "takoÄer i poveÄati razinu privatnosti jer Äe svi kolaÄiÄi biti izbrisani kad " 798 "trenutna sjednica zavrÅ¡i.</p> \n" 614 799 "</qt>" 615 800 … … 625 810 msgid "" 626 811 "<qt>\n" 627 "<p>Treat all cookies as session cookies. Session cookies are small pieces of data that are temporarily stored in your computer's memory until you quit or close all applications (e.g. your browser) that use them. Unlike regular cookies, session cookies are never stored on your hard drive or other storage medium.</p><p>\n" 628 "<u>NOTE:</u> Checking this option along with the previous one will override your default as well as site specific cookie policies. However, doing so also increases your privacy since all cookies will be removed when the current session ends.</p>\n" 629 "</qt>" 630 msgstr "" 631 "<qt>\n" 632 "<p>Tretiraj sve kolaÄiÄe kao kolaÄiÄe sjednice. KolaÄiÄi sjednice su mali komadiÄi podataka koji su privremeno spremljeni na vaÅ¡em raÄunalu dok god ne zatvorite sve aplikacije koje ih koriste (npr. web preglednik). Za razliku od obiÄnih kolaÄiÄa, kolaÄiÄi sesije se nikad ne spremaju na vaÅ¡ tvrdi disk ili bilo koji drugi medij.</p><p>\n" 633 "<u>NAPOMENA:</u> Zajedno s prethodnom opcijom, ova opcija zanemaruje vaÅ¡u uobiÄajenu politiku manipuliranja kolaÄiÄima, kao i sve politike specifiÄne za odreÄene stranice. MeÄutim, to takoÄer poveÄava nivo vaÅ¡e privatnosti, obzirom da Äe svi kolaÄiÄi biti izbrisani kada prekinete trenutnu sesiju.</p></qt>" 812 "<p>Treat all cookies as session cookies. Session cookies are small pieces of " 813 "data that are temporarily stored in your computer's memory until you quit or " 814 "close all applications (e.g. your browser) that use them. Unlike regular " 815 "cookies, session cookies are never stored on your hard drive or other storage " 816 "medium.</p><p>\n" 817 "<u>NOTE:</u> Checking this option along with the previous one will override " 818 "your default as well as site specific cookie policies. However, doing so also " 819 "increases your privacy since all cookies will be removed when the current " 820 "session ends.</p>\n" 821 "</qt>" 822 msgstr "" 823 "<qt>\n" 824 "<p>Tretiraj sve kolaÄiÄe kao kolaÄiÄe sjednice. KolaÄiÄi sjednice su mali " 825 "komadiÄi podataka koji su privremeno spremljeni na vaÅ¡em raÄunalu dok god ne " 826 "zatvorite sve aplikacije koje ih koriste (npr. web preglednik). Za razliku od " 827 "obiÄnih kolaÄiÄa, kolaÄiÄi sesije se nikad ne spremaju na vaÅ¡ tvrdi disk ili " 828 "bilo koji drugi medij.</p><p>\n" 829 "<u>NAPOMENA:</u> Zajedno s prethodnom opcijom, ova opcija zanemaruje vaÅ¡u " 830 "uobiÄajenu politiku manipuliranja kolaÄiÄima, kao i sve politike specifiÄne " 831 "za odreÄene stranice. MeÄutim, to takoÄer poveÄava nivo vaÅ¡e privatnosti, " 832 "obzirom da Äe svi kolaÄiÄi biti izbrisani kada prekinete trenutnu sesiju.</p>" 833 "</qt>" 634 834 635 835 #. i18n: ectx: property (text), widget (QCheckBox, cbIgnoreCookieExpirationDate) … … 646 846 "Determines how cookies received from a remote machine will be handled: \n" 647 847 "<ul>\n" 648 "<li><b>Ask</b> will cause KDE to ask for your confirmation whenever a server wants to set a cookie.</li>\n" 649 "<li><b>Accept</b> will cause cookies to be accepted without prompting you.</li>\n" 650 "<li><b>Reject</b> will cause the cookiejar to refuse all cookies it receives.</li>\n" 848 "<li><b>Ask</b> will cause KDE to ask for your confirmation whenever a server " 849 "wants to set a cookie.</li>\n" 850 "<li><b>Accept</b> will cause cookies to be accepted without prompting you.<" 851 "/li>\n" 852 "<li><b>Reject</b> will cause the cookiejar to refuse all cookies it receives." 853 "</li>\n" 651 854 "</ul><p>\n" 652 "<u>NOTE:</u> Domain specific policies, which can be set below, always take precedence over the default policy.</p>\n" 855 "<u>NOTE:</u> Domain specific policies, which can be set below, always take " 856 "precedence over the default policy.</p>\n" 653 857 "</qt>" 654 858 msgstr "" … … 656 860 "OdreÄuje kako Äe se postupati s kolaÄiÄima koji su primljeni:\n" 657 861 "<ul>\n" 658 "<li><b>Pitaj</b> opcija Äe uÄiniti da Vas KDE svaki put pita Å¡to uÄiniti s kolaÄiÄem kada ga se primi</li> \n" 659 "<li><b>Prihvati</b> opcija Äe uÄiniti da se svi kolaÄiÄi prihvate bez pitanja</li> \n" 660 "<li><b>Odbih</b> opcija Äe uÄiniti da se svi kolaÄiÄi odbiju bez pitanja</li> \n" 862 "<li><b>Pitaj</b> opcija Äe uÄiniti da Vas KDE svaki put pita Å¡to uÄiniti s " 863 "kolaÄiÄem kada ga se primi</li> \n" 864 "<li><b>Prihvati</b> opcija Äe uÄiniti da se svi kolaÄiÄi prihvate bez " 865 "pitanja</li> \n" 866 "<li><b>Odbih</b> opcija Äe uÄiniti da se svi kolaÄiÄi odbiju bez pitanja</li> " 867 "\n" 661 868 "</ul> <p>\n" 662 "<u>NAPOMENA:</u> Politike specifiÄnih domena, koje mogu biti postavljene dolje, uvijek imaju prednost pred uobiÄajenim postavkama.</p>\n" 869 "<u>NAPOMENA:</u> Politike specifiÄnih domena, koje mogu biti postavljene " 870 "dolje, uvijek imaju prednost pred uobiÄajenim postavkama.</p>\n" 663 871 "</qt>" 664 872 … … 692 900 msgid "" 693 901 "<qt>\n" 694 "To add a new policy, simply click on the <b>Add...</b> button and supply the necessary information. To change an existing policy, use the <b>Change...</b> button and choose the new policy from the policy dialog box. Clicking on the <b>Delete</b> button will remove the currently selected policy causing the default policy setting to be used for that domain, whereas <b>Delete All</b> will remove all the site specific policies.\n" 695 "</qt>" 696 msgstr "" 697 "<qt>\n" 698 "Za dodavanje nove politike, jednostavno kliknite na gumb <b>DodajâŠ</b> i dajte potrebne informacije. Da biste promijenili trenutnu politiku, jednostavno koristite gumb <b>Promijeni</b> i odaberite novu politiku iz dialoga sa politikama. Ako kliknete na gumb <b>IzbriÅ¡i</b>, onda Äete izbrisati trenutno postavljenu politiku pa Äe za tu domenu biti koriÅ¡tena uobiÄajena politika, dok Äe <b>IzbriÅ¡i sve</b> gumb izbrisati sve specifiÄne politike.\n" 902 "To add a new policy, simply click on the <b>Add...</b> button and supply the " 903 "necessary information. To change an existing policy, use the <b>Change...</b> " 904 "button and choose the new policy from the policy dialog box. Clicking on the " 905 "<b>Delete</b> button will remove the currently selected policy causing the " 906 "default policy setting to be used for that domain, whereas <b>Delete All</b> " 907 "will remove all the site specific policies.\n" 908 "</qt>" 909 msgstr "" 910 "<qt>\n" 911 "Za dodavanje nove politike, jednostavno kliknite na gumb <b>DodajâŠ</b> i " 912 "dajte potrebne informacije. Da biste promijenili trenutnu politiku, " 913 "jednostavno koristite gumb <b>Promijeni</b> i odaberite novu politiku iz " 914 "dialoga sa politikama. Ako kliknete na gumb <b>IzbriÅ¡i</b>, onda Äete " 915 "izbrisati trenutno postavljenu politiku pa Äe za tu domenu biti koriÅ¡tena " 916 "uobiÄajena politika, dok Äe <b>IzbriÅ¡i sve</b> gumb izbrisati sve specifiÄne " 917 "politike.\n" 699 918 "</qt>" 700 919 … … 725 944 msgid "" 726 945 "<qt>\n" 727 "List of sites for which you have set a specific cookie policy. Specific policies override the default policy setting for these sites.\n" 728 "</qt>" 729 msgstr "" 730 "<qt>\n" 731 "Popis stranica za koje ste postavili odreÄenu politiku upravljanja kolaÄiÄima. Ove postavke vrijedit Äe umjesto podrazumijevanih za ove stranice.\n" 946 "List of sites for which you have set a specific cookie policy. Specific " 947 "policies override the default policy setting for these sites.\n" 948 "</qt>" 949 msgstr "" 950 "<qt>\n" 951 "Popis stranica za koje ste postavili odreÄenu politiku upravljanja kolaÄiÄima." 952 " Ove postavke vrijedit Äe umjesto podrazumijevanih za ove stranice.\n" 732 953 "</qt>" 733 954 … … 746 967 #. +> trunk stable 747 968 #: kenvvarproxydlg.cpp:49 748 #, fuzzy749 969 #| msgid "Variable Proxy Configuration" 750 970 msgctxt "@title:window" 751 971 msgid "Variable Proxy Configuration" 752 msgstr "Postavke promjenjivog posrednika (proxy)"972 msgstr "Postavke promjenjivog posrednika" 753 973 754 974 #. +> trunk stable … … 759 979 #. +> trunk stable 760 980 #: kenvvarproxydlg.cpp:133 kenvvarproxydlg.cpp:295 761 msgid "<qt>Make sure you entered the actual environment variable name rather than its value. For example, if the environment variable is <br /><b>HTTP_PROXY=http://localhost:3128</b><br /> you need to enter <b>HTTP_PROXY</b> here instead of the actual value http://localhost:3128.</qt>" 762 msgstr "<qt>Osigurajte da ste unijeli ime varijable okoline, a ne njenu vrijednost. Na primjer, ako je varijabla okoline <br /> <b>HTTP_PROXY=http://localhost:3128</b><br /> morate unijeti <b>HTTP_PROXY</b>, a ne vrijednost http://localhost:3128.</qt>" 981 msgid "" 982 "<qt>Make sure you entered the actual environment variable name rather than " 983 "its value. For example, if the environment variable is <br /><b>" 984 "HTTP_PROXY=http://localhost:3128</b><br /> you need to enter <b>HTTP_PROXY</b>" 985 " here instead of the actual value http://localhost:3128.</qt>" 986 msgstr "" 987 "<qt>Osigurajte da ste unijeli ime varijable okoline, a ne njenu vrijednost. " 988 "Na primjer, ako je varijabla okoline <br /> <b>" 989 "HTTP_PROXY=http://localhost:3128</b><br /> morate unijeti <b>HTTP_PROXY</b>, " 990 "a ne vrijednost http://localhost:3128.</qt>" 763 991 764 992 #. +> trunk stable 765 993 #: kenvvarproxydlg.cpp:141 kenvvarproxydlg.cpp:303 kproxydlg.cpp:311 766 #, fuzzy767 994 #| msgid "Invalid Proxy Setup" 768 995 msgctxt "@title:window" … … 777 1004 #. +> trunk stable 778 1005 #: kenvvarproxydlg.cpp:146 779 #, fuzzy780 1006 #| msgid "Proxy Setup" 781 1007 msgctxt "@title:window" 782 1008 msgid "Proxy Setup" 783 msgstr "Po deÅ¡avanje proxy-a"1009 msgstr "Postavljanje posrednika" 784 1010 785 1011 #. +> trunk stable 786 1012 #: kenvvarproxydlg.cpp:222 787 msgid "Did not detect any environment variables commonly used to set system wide proxy information." 788 msgstr "Nije bilo moguÄe pronaÄi nijednu od varijabli okoline koje se obiÄno koriste za podeÅ¡avanje proxy-a!" 1013 msgid "" 1014 "Did not detect any environment variables commonly used to set system wide " 1015 "proxy information." 1016 msgstr "" 1017 "Nije bilo moguÄe pronaÄi nijednu od varijabli okoline koje se obiÄno koriste " 1018 "za podeÅ¡avanje proxy-a!" 789 1019 790 1020 #. +> trunk stable 791 1021 #: kenvvarproxydlg.cpp:226 792 msgid "<qt>To learn about the variable names the automatic detection process searches for, press OK, click on the quick help button on the window title bar of the previous dialog and then click on the \"<b>Auto Detect</b>\" button.</qt>" 793 msgstr "<qt>Ako ÅŸelite saznati viÅ¡e o varijablama okruÅŸja koje ispituje automatsko pronalaÅŸenje, kliknite OK, u traci naslova prethodnog prozora kliknite gumb za brzu pomoÄ, te zatim kliknite gumb \"<b>Automatsko pronalaÅŸenje</b>\".</qt>" 1022 msgid "" 1023 "<qt>To learn about the variable names the automatic detection process " 1024 "searches for, press OK, click on the quick help button on the window title " 1025 "bar of the previous dialog and then click on the \"<b>Auto Detect</b>\" " 1026 "button.</qt>" 1027 msgstr "" 1028 "<qt>Ako ÅŸelite saznati viÅ¡e o varijablama okruÅŸja koje ispituje automatsko " 1029 "pronalaÅŸenje, kliknite OK, u traci naslova prethodnog prozora kliknite gumb " 1030 "za brzu pomoÄ, te zatim kliknite gumb \"<b>Automatsko pronalaÅŸenje</b>\".</qt>" 794 1031 795 1032 #. +> trunk stable 796 1033 #: kenvvarproxydlg.cpp:234 797 #, fuzzy798 1034 #| msgid "Automatic Proxy Variable Detection" 799 1035 msgctxt "@title:window" 800 1036 msgid "Automatic Proxy Variable Detection" 801 msgstr "Automatska detekcija Proxyvarijabli"1037 msgstr "Automatska detekcija posredniÄkih varijabli" 802 1038 803 1039 #. i18n: ectx: label, entry (DisablePassiveMode), group (DesktopIcons) … … 810 1046 #. +> trunk stable 811 1047 #: kio_ftprc.kcfg:11 812 msgid "When FTP connections are passive the client connects to the server, instead of the other way round, so firewalls do not block the connection; old FTP servers may not support Passive FTP though." 813 msgstr "Kada su FTP veze pasivne, klijent se povezuje na posluÅŸitelj, umjesto obrnuto, tako da vatrozidi ne blokiraju vezu; stariji FTP posluÅŸitelji moÅŸda ne podrÅŸavaju pasivni FTP." 1048 msgid "" 1049 "When FTP connections are passive the client connects to the server, instead " 1050 "of the other way round, so firewalls do not block the connection; old FTP " 1051 "servers may not support Passive FTP though." 1052 msgstr "" 1053 "Kada su FTP veze pasivne, klijent se povezuje na posluÅŸitelj, umjesto " 1054 "obrnuto, tako da vatrozidi ne blokiraju vezu; stariji FTP posluÅŸitelji moÅŸda " 1055 "ne podrÅŸavaju pasivni FTP." 814 1056 815 1057 #. i18n: ectx: label, entry (MarkPartial), group (DesktopIcons) … … 822 1064 #. +> trunk stable 823 1065 #: kio_ftprc.kcfg:17 824 msgid "While a file is being uploaded its extension is \".part\". When fully uploaded it is renamed to its real name." 825 msgstr "Dok se datoteka uploada njezina ekstenzija je \".part\". Kad upload zavrÅ¡i, datoteka se preimenuje u njeno pravo ime." 1066 msgid "" 1067 "While a file is being uploaded its extension is \".part\". When fully " 1068 "uploaded it is renamed to its real name." 1069 msgstr "" 1070 "Dok se datoteka uploada njezina ekstenzija je \".part\". Kad upload zavrÅ¡i, " 1071 "datoteka se preimenuje u njeno pravo ime." 826 1072 827 1073 #. +> trunk stable 828 1074 #: kmanualproxydlg.cpp:48 829 #, fuzzy830 1075 #| msgid "Manual Proxy Configuration" 831 1076 msgctxt "@title:window" 832 1077 msgid "Manual Proxy Configuration" 833 msgstr "RuÄno podeÅ¡avanje p roxy-a"1078 msgstr "RuÄno podeÅ¡avanje posrednika" 834 1079 835 1080 #. +> trunk stable 836 1081 #: kmanualproxydlg.cpp:273 837 #, fuzzy838 1082 #| msgid "Invalid Proxy Setting" 839 1083 msgctxt "@title:window" … … 843 1087 #. +> trunk stable 844 1088 #: kmanualproxydlg.cpp:274 845 msgid "One or more of the specified proxy settings are invalid. The incorrect entries are highlighted." 846 msgstr "Jedna ili viÅ¡e definiranih postavki posrednika su nevaljane. NetoÄne vrijednosti su oznaÄene." 1089 msgid "" 1090 "One or more of the specified proxy settings are invalid. The incorrect " 1091 "entries are highlighted." 1092 msgstr "" 1093 "Jedna ili viÅ¡e definiranih postavki posrednika su nevaljane. NetoÄne " 1094 "vrijednosti su oznaÄene." 847 1095 848 1096 #. +> trunk stable … … 859 1107 #. +> trunk stable 860 1108 #: kmanualproxydlg.cpp:346 861 #, fuzzy862 1109 #| msgid "Duplicate Entry" 863 1110 msgctxt "@title:window" 864 1111 msgid "Duplicate Entry" 865 msgstr "Dupli unost"1112 msgstr "Duplikat unosa" 866 1113 867 1114 #. +> trunk stable 868 1115 #: kmanualproxydlg.cpp:356 869 #, fuzzy870 1116 #| msgid "New Exception" 871 1117 msgctxt "@title:window" 872 1118 msgid "New Exception" 873 msgstr "Nov i izuzetak"1119 msgstr "Nova iznimka" 874 1120 875 1121 #. +> trunk stable 876 1122 #: kmanualproxydlg.cpp:363 877 #, fuzzy878 1123 #| msgid "Change Exception" 879 1124 msgctxt "@title:window" 880 1125 msgid "Change Exception" 881 msgstr "Prom jeni izuzetak"1126 msgstr "Promijeni iznimku" 882 1127 883 1128 #. +> trunk stable 884 1129 #: kmanualproxydlg.cpp:440 885 #, fuzzy886 1130 #| msgid "Invalid Entry" 887 1131 msgctxt "@title:window" … … 896 1140 #. +> trunk stable 897 1141 #: kmanualproxydlg.cpp:445 898 msgid "<qt>Make sure none of the addresses or URLs you specified contain invalid or wildcard characters such as spaces, asterisks (*), or question marks(?).<br /><br /><u>Examples of VALID entries:</u><br /><code>http://mycompany.com, 192.168.10.1, mycompany.com, localhost, http://localhost</code><br /><br /><u>Examples of INVALID entries:</u><br /><code>http://my company.com, http:/mycompany,com file:/localhost</code></qt>" 899 msgstr "<qt>Osigurajte da ni jedna od definiranih adresa ili URL-ova ne sadrÅŸi nevaljane znakove poput razmaka, zvjezdice (*) ili upitnika (?).<br /> <br /> <u>Primjeri VALJANIH unosa:</u><br /> <code>http://mycompany.com, 192.168.10.1, mycompany.com, localhost, http://localhost</code><br /><br /><u>Primjeri NEVALJANIH unosa:</u><br /> <code>http://my company.com, http:/mycompany,com file:/localhost</code></qt>" 1142 msgid "" 1143 "<qt>Make sure none of the addresses or URLs you specified contain invalid or " 1144 "wildcard characters such as spaces, asterisks (*), or question marks(?).<br />" 1145 "<br /><u>Examples of VALID entries:</u><br /><code>http://mycompany.com, 192." 1146 "168.10.1, mycompany.com, localhost, http://localhost</code><br /><br /><u>" 1147 "Examples of INVALID entries:</u><br /><code>http://my company.com, " 1148 "http:/mycompany,com file:/localhost</code></qt>" 1149 msgstr "" 1150 "<qt>Osigurajte da ni jedna od definiranih adresa ili URL-ova ne sadrÅŸi " 1151 "nevaljane znakove poput razmaka, zvjezdice (*) ili upitnika (?).<br /> <br /> " 1152 "<u>Primjeri VALJANIH unosa:</u><br /> <code>http://mycompany.com, 192.168.10." 1153 "1, mycompany.com, localhost, http://localhost</code><br /><br /><u>Primjeri " 1154 "NEVALJANIH unosa:</u><br /> <code>http://my company.com, http:/mycompany,com " 1155 "file:/localhost</code></qt>" 900 1156 901 1157 #. +> trunk stable 902 1158 #: kmanualproxydlg.cpp:466 903 1159 msgid "Enter the URL or address that should use the above proxy settings:" 904 msgstr "Unesite adresu ili URL za koji treba koristiti gornje postavke posrednika:" 1160 msgstr "" 1161 "Unesite adresu ili URL za koji treba koristiti gornje postavke posrednika:" 905 1162 906 1163 #. +> trunk stable 907 1164 #: kmanualproxydlg.cpp:469 908 msgid "Enter the address or URL that should be excluded from using the above proxy settings:" 909 msgstr "Unesite adresu ili URL za koji ne treba koristiti gornje postavke posrednika:" 1165 msgid "" 1166 "Enter the address or URL that should be excluded from using the above proxy " 1167 "settings:" 1168 msgstr "" 1169 "Unesite adresu ili URL za koji ne treba koristiti gornje postavke posrednika:" 910 1170 911 1171 #. +> trunk stable 912 1172 #: kmanualproxydlg.cpp:472 913 msgid "<qt>Enter a valid address or URL.<br /><br /><b><u>NOTE:</u></b> Wildcard matching such as <code>*.kde.org</code> is not supported. If you want to match any host in the <code>.kde.org</code> domain, e.g. <code>printing.kde.org</code>, then simply enter <code>.kde.org</code>.</qt>" 914 msgstr "<qt>Unesite valjanu adresu ili URL.<br/> <br /> <b><u>NAPOMENA:</u></b>KoriÅ¡tenje viÅ¡eznaÄnika poput <code>*.kde.org</code> nije podrÅŸano. Ako ÅŸelite podudarnost s bilo kojim posluÅŸiteljem u domeni <code>.kde.org</code>, npr. <code>printing.kde.org</code>, tada jednostavno unesite <code>.kde.org</code>.</qt>" 1173 msgid "" 1174 "<qt>Enter a valid address or URL.<br /><br /><b><u>NOTE:</u></b> Wildcard " 1175 "matching such as <code>*.kde.org</code> is not supported. If you want to " 1176 "match any host in the <code>.kde.org</code> domain, e.g. <code>printing.kde." 1177 "org</code>, then simply enter <code>.kde.org</code>.</qt>" 1178 msgstr "" 1179 "<qt>Unesite valjanu adresu ili URL.<br/> <br /> <b><u>NAPOMENA:</u></b>" 1180 "KoriÅ¡tenje viÅ¡eznaÄnika poput <code>*.kde.org</code> nije podrÅŸano. Ako " 1181 "ÅŸelite podudarnost s bilo kojim posluÅŸiteljem u domeni <code>.kde.org</code>, " 1182 "npr. <code>printing.kde.org</code>, tada jednostavno unesite <code>.kde.org<" 1183 "/code>.</qt>" 915 1184 916 1185 #. +> trunk stable 917 1186 #: kproxydlg.cpp:160 918 msgid "The address of the automatic proxy configuration script is invalid. Please correct this problem before proceeding. Otherwise, your changes will be ignored." 919 msgstr "<qt>Adresa automatskog podeÅ¡avanja posrednika nije ispravna! Molim vas ispravite greÅ¡ku prije daljnjeg rada. U suprotnom Äe sve izmjene biti zanemarene!</qt>" 1187 msgid "" 1188 "The address of the automatic proxy configuration script is invalid. Please " 1189 "correct this problem before proceeding. Otherwise, your changes will be " 1190 "ignored." 1191 msgstr "" 1192 "<qt>Adresa automatskog podeÅ¡avanja posrednika nije ispravna! Molim vas " 1193 "ispravite greÅ¡ku prije daljnjeg rada. U suprotnom Äe sve izmjene biti " 1194 "zanemarene!</qt>" 920 1195 921 1196 #. +> trunk stable 922 1197 #: kproxydlg.cpp:287 923 msgid "<h1>Proxy</h1><p>A proxy server is an intermediate program that sits between your machine and the Internet and provides services such as web page caching and/or filtering.</p><p>Caching proxy servers give you faster access to sites you have already visited by locally storing or caching the content of those pages; filtering proxy servers, on the other hand, provide the ability to block out requests for ads, spam, or anything else you want to block.</p><p><u>Note:</u> Some proxy servers provide both services.</p>" 924 msgstr "<h1>Posrednik</h1><p>PosluÅŸitelj-posrednik je posredovni program koji stoji izmeÄu vaÅ¡eg raÄunala i Interneta, te pruÅŸa usluge poput predmemoriranja web stranica ili filtriranja.</p><p>PosluÅŸitelji-posrednici za predmemoriranje Vam omoguÄuju brÅŸi pristup stranicama koje ste veÄ posjetili tako da lokalno spreme ili predmemoriraju sadrÅŸaj tih stranica; s druge strane, filtrirajuÄi posluÅŸitelji-posrednici Vam pruÅŸaju moguÄnost blokiranja reklama ili bilo Äega Å¡to Vas nervira.</p> <p><u>Napomena:</u>Neki posluÅŸitelji-posrednici pruÅŸaju obje usluge.</p>" 1198 msgid "" 1199 "<h1>Proxy</h1><p>A proxy server is an intermediate program that sits between " 1200 "your machine and the Internet and provides services such as web page caching " 1201 "and/or filtering.</p><p>Caching proxy servers give you faster access to sites " 1202 "you have already visited by locally storing or caching the content of those " 1203 "pages; filtering proxy servers, on the other hand, provide the ability to " 1204 "block out requests for ads, spam, or anything else you want to block.</p><p><" 1205 "u>Note:</u> Some proxy servers provide both services.</p>" 1206 msgstr "" 1207 "<h1>Posrednik</h1><p>PosluÅŸitelj-posrednik je posredovni program koji stoji " 1208 "izmeÄu vaÅ¡eg raÄunala i Interneta, te pruÅŸa usluge poput predmemoriranja web " 1209 "stranica ili filtriranja.</p><p>PosluÅŸitelji-posrednici za predmemoriranje " 1210 "Vam omoguÄuju brÅŸi pristup stranicama koje ste veÄ posjetili tako da lokalno " 1211 "spreme ili predmemoriraju sadrÅŸaj tih stranica; s druge strane, filtrirajuÄi " 1212 "posluÅŸitelji-posrednici Vam pruÅŸaju moguÄnost blokiranja reklama ili bilo " 1213 "Äega Å¡to Vas nervira.</p> <p><u>Napomena:</u>Neki posluÅŸitelji-posrednici " 1214 "pruÅŸaju obje usluge.</p>" 925 1215 926 1216 #. +> trunk stable 927 1217 #: kproxydlg.cpp:306 928 msgid "<qt>The proxy settings you specified are invalid.<br /><br />Please click on the <b>Setup...</b> button and correct the problem before proceeding; otherwise your changes will be ignored.</qt>" 929 msgstr "<qt>Posrednici nisu ispravno podeÅ¡eni! Molim kliknite na <b>PodeÅ¡avanjeâŠ</b> kako bi ste ispravili greÅ¡ke prije nastavka rada; u suprotnom Äe sve ostale promjene zanemarene!</qt>" 1218 msgid "" 1219 "<qt>The proxy settings you specified are invalid.<br /><br />Please click on " 1220 "the <b>Setup...</b> button and correct the problem before proceeding; " 1221 "otherwise your changes will be ignored.</qt>" 1222 msgstr "" 1223 "<qt>Posrednici nisu ispravno podeÅ¡eni! Molim kliknite na <b>PodeÅ¡avanjeâŠ</b> " 1224 "kako bi ste ispravili greÅ¡ke prije nastavka rada; u suprotnom Äe sve ostale " 1225 "promjene zanemarene!</qt>" 930 1226 931 1227 #. i18n: ectx: property (whatsThis), widget (QWidget, KProxyDialogUI) … … 936 1232 "Setup proxy configuration.\n" 937 1233 "<p>\n" 938 "A proxy server is an intermediate machine that sits between your computer and the Internet and provides services such as web page caching and filtering. Caching proxy servers give you faster access to web sites you have already visited by locally storing or caching those pages; filtering proxy servers usually provide the ability to block out requests for ads, spam, or anything else you want to block.\n" 1234 "A proxy server is an intermediate machine that sits between your computer and " 1235 "the Internet and provides services such as web page caching and filtering. " 1236 "Caching proxy servers give you faster access to web sites you have already " 1237 "visited by locally storing or caching those pages; filtering proxy servers " 1238 "usually provide the ability to block out requests for ads, spam, or anything " 1239 "else you want to block.\n" 939 1240 "<p>\n" 940 "If you are uncertain whether or not you need to use a proxy server to connect to the Internet, consult your Internet service provider's setup guide or your system administrator.\n" 1241 "If you are uncertain whether or not you need to use a proxy server to connect " 1242 "to the Internet, consult your Internet service provider's setup guide or your " 1243 "system administrator.\n" 941 1244 "</qt>" 942 1245 msgstr "" … … 944 1247 "PodeÅ¡avanje posluÅŸitelja-posrednika.\n" 945 1248 "<p>\n" 946 "PosluÅŸitelj-posrednik je posredovno raÄunalo koje stoji izmeÄu VaÅ¡eg raÄunala i Interneta, te pruÅŸa usluge poput predmemoriranja web stranica ili filtriranja. PosluÅŸitelji-posrednici za predmemoriranje Vam omoguÄuju brÅŸi pristup veÄ posjeÄenim web stranicama tako da ih lokalno spremi ili predmemorira; filtrirajuÄi posluÅŸitelji-posrednici obiÄno omoguÄuju blokiranje reklama ili bilo Äega Å¡to Vas nervira.\n" 1249 "PosluÅŸitelj-posrednik je posredovno raÄunalo koje stoji izmeÄu VaÅ¡eg raÄunala " 1250 "i Interneta, te pruÅŸa usluge poput predmemoriranja web stranica ili " 1251 "filtriranja. PosluÅŸitelji-posrednici za predmemoriranje Vam omoguÄuju brÅŸi " 1252 "pristup veÄ posjeÄenim web stranicama tako da ih lokalno spremi ili " 1253 "predmemorira; filtrirajuÄi posluÅŸitelji-posrednici obiÄno omoguÄuju " 1254 "blokiranje reklama ili bilo Äega Å¡to Vas nervira.\n" 947 1255 "<p>\n" 948 "Ako niste sigurni treba li vam posluÅŸitelj-posrednik za pristup Internetu, provjerite upute vaÅ¡eg pruÅŸatelja Internet usluga ili potraÅŸite savjet vaÅ¡eg upravitelja sustava.\n" 1256 "Ako niste sigurni treba li vam posluÅŸitelj-posrednik za pristup Internetu, " 1257 "provjerite upute vaÅ¡eg pruÅŸatelja Internet usluga ili potraÅŸite savjet vaÅ¡eg " 1258 "upravitelja sustava.\n" 949 1259 "</qt>" 950 1260 … … 967 1277 "<qt>\n" 968 1278 "Automatically detect and configure the proxy settings.<p>\n" 969 "Automatic detection is performed using the <b>Web Proxy Auto-Discovery Protocol (WPAD)</b>.<p>\n" 970 "<b>NOTE:</b> This option might not work properly or not work at all in some UNIX/Linux distributions. If you encounter a problem when using this option, please check the FAQ section at http://konqueror.kde.org.\n" 1279 "Automatic detection is performed using the <b>Web Proxy Auto-Discovery " 1280 "Protocol (WPAD)</b>.<p>\n" 1281 "<b>NOTE:</b> This option might not work properly or not work at all in some " 1282 "UNIX/Linux distributions. If you encounter a problem when using this option, " 1283 "please check the FAQ section at http://konqueror.kde.org.\n" 971 1284 "</qt>" 972 1285 msgstr "" 973 1286 "<qt>\n" 974 1287 "Automatski otkrij i postavi postavke posrednika. <p>\n" 975 "Automatsko otkrivanje se izvodi pomoÄu <b>Protokola za automatsko otkrivanje web posrednika (WPAD â Web Proxy Auto-Discovery Protocol)</b>. <p>\n" 976 "<b>NAPOMENA:</b>Ova opcija moÅŸda neÄe pravilno ili u potpunosti raditi na nekim UNIX/Linux distribucijama. Ako naiÄete na problem prilikom koriÅ¡tenja ove opcije, molim provjerite FAQ dio na http://konqueror.kde.org\n" 1288 "Automatsko otkrivanje se izvodi pomoÄu <b>Protokola za automatsko otkrivanje " 1289 "web posrednika (WPAD â Web Proxy Auto-Discovery Protocol)</b>. <p>\n" 1290 "<b>NAPOMENA:</b>Ova opcija moÅŸda neÄe pravilno ili u potpunosti raditi na " 1291 "nekim UNIX/Linux distribucijama. Ako naiÄete na problem prilikom koriÅ¡tenja " 1292 "ove opcije, molim provjerite FAQ dio na http://konqueror.kde.org\n" 977 1293 "</qt>" 978 1294 … … 987 1303 #: kproxydlg.ui:75 988 1304 msgid "Use the specified proxy script URL to configure the proxy settings." 989 msgstr "Koristi navedenu skriptu za podeÅ¡avanje postavki posluÅŸitelja-posrednika." 1305 msgstr "" 1306 "Koristi navedenu skriptu za podeÅ¡avanje postavki posluÅŸitelja-posrednika." 990 1307 991 1308 #. i18n: ectx: property (text), widget (QRadioButton, rbAutoScript) … … 1007 1324 "<qt>\n" 1008 1325 "Use environment variables to configure the proxy settings.<p>\n" 1009 "Environment variables such as <b>HTTP_PROXY</b> and <b>NO_PROXY</b> are usually used in multi-user UNIX installations, where both graphical and non-graphical applications need to share the same proxy configuration information.\n" 1326 "Environment variables such as <b>HTTP_PROXY</b> and <b>NO_PROXY</b> are " 1327 "usually used in multi-user UNIX installations, where both graphical and " 1328 "non-graphical applications need to share the same proxy configuration " 1329 "information.\n" 1010 1330 "</qt>" 1011 1331 msgstr "" 1012 1332 "<qt>\n" 1013 1333 "Koristi varijable okoline za podeÅ¡avanje postavki posrednika.<p>\n" 1014 "Varijable okoline poput <b>HTTP_PROXY</b> i <b>NO_PROXY</b> su Äesto koriÅ¡tene u viÅ¡ekorisniÄkim instalacijama UNIX-a, gdje grafiÄke i negrafiÄke aplikacije trebaju dijeliti iste postavke posrednika.\n" 1334 "Varijable okoline poput <b>HTTP_PROXY</b> i <b>NO_PROXY</b> su Äesto " 1335 "koriÅ¡tene u viÅ¡ekorisniÄkim instalacijama UNIX-a, gdje grafiÄke i negrafiÄke " 1336 "aplikacije trebaju dijeliti iste postavke posrednika.\n" 1015 1337 "</qt>" 1016 1338 … … 1080 1402 #: kproxydlg.ui:220 1081 1403 msgid "Use information specified here to login into proxy servers as needed." 1082 msgstr "Koristi informacije definirane ovdje za prijavu na posluÅŸitelje-posrednike po potrebi." 1404 msgstr "" 1405 "Koristi informacije definirane ovdje za prijavu na posluÅŸitelje-posrednike po " 1406 "potrebi." 1083 1407 1084 1408 #. i18n: ectx: property (text), widget (QRadioButton, rbPresetLogin) … … 1119 1443 "<qt>\n" 1120 1444 "Use persistent proxy connection.<p>\n" 1121 "Although a persistent proxy connection is faster, note that it only works correctly with proxies that are fully HTTP 1.1 compliant. Do <b>not</b> use this option in combination with non-HTTP 1.1 compliant proxy servers such as JunkBuster and WWWOfle.\n" 1122 "</qt>" 1123 msgstr "KoriÅ¡tenje stalnih (persistent) Proxy konekcija je brÅŸe, ali radi sam sa ProxyposluÅŸiteljima koji su u potpunosti usklaÄeni sa HTTP 1.1 protokolom. <b>Nemojte</b> koristiti ovu opciju sa programima kao Å¡to su JunkBuster ili WWWOfle." 1445 "Although a persistent proxy connection is faster, note that it only works " 1446 "correctly with proxies that are fully HTTP 1.1 compliant. Do <b>not</b> use " 1447 "this option in combination with non-HTTP 1.1 compliant proxy servers such as " 1448 "JunkBuster and WWWOfle.\n" 1449 "</qt>" 1450 msgstr "" 1451 "KoriÅ¡tenje stalnih (persistent) Proxy konekcija je brÅŸe, ali radi sam sa " 1452 "ProxyposluÅŸiteljima koji su u potpunosti usklaÄeni sa HTTP 1.1 protokolom. <b>" 1453 "Nemojte</b> koristiti ovu opciju sa programima kao Å¡to su JunkBuster ili " 1454 "WWWOfle." 1124 1455 1125 1456 #. i18n: ectx: property (text), widget (QCheckBox, cbPersConn) … … 1131 1462 #. +> trunk stable 1132 1463 #: ksaveioconfig.cpp:224 ksaveioconfig.cpp:240 1133 #, fuzzy1134 1464 #| msgid "Update Failed" 1135 1465 msgctxt "@title:window" 1136 1466 msgid "Update Failed" 1137 msgstr "Neuspjelo osvjeÅŸavanje"1467 msgstr "Neuspjelo aÅŸuriranje" 1138 1468 1139 1469 #. +> trunk stable 1140 1470 #: ksaveioconfig.cpp:225 1141 msgid "You have to restart the running applications for these changes to take effect." 1471 msgid "" 1472 "You have to restart the running applications for these changes to take effect." 1142 1473 msgstr "Morate restartati pokrenute programe da bi ove izmjene bile vidljive." 1143 1474 … … 1174 1505 #. +> trunk stable 1175 1506 #: manualproxy.ui:100 1176 msgid "Enter the port number of the FTP proxy server. Default 8080. Another common value is 3128." 1177 msgstr "Unesite broj priljuÄka (port-a) vaÅ¡eg HTTP posrednika. ObiÄno se koristi 8080." 1507 msgid "" 1508 "Enter the port number of the FTP proxy server. Default 8080. Another common " 1509 "value is 3128." 1510 msgstr "" 1511 "Unesite broj priljuÄka (port-a) vaÅ¡eg HTTP posrednika. ObiÄno se koristi 8080." 1178 1512 1179 1513 #. i18n: ectx: property (whatsThis), widget (KIntSpinBox, sbHttps) … … 1181 1515 #. +> trunk stable 1182 1516 #: manualproxy.ui:110 manualproxy.ui:126 1183 msgid "Enter the port number of the HTTP proxy server. Default is 8080. Another common value is 3128." 1184 msgstr "Unesite broj priljuÄka (port-a) vaÅ¡eg HTTP posrednika (proxy). ObiÄno se koristi 8080." 1517 msgid "" 1518 "Enter the port number of the HTTP proxy server. Default is 8080. Another " 1519 "common value is 3128." 1520 msgstr "" 1521 "Unesite broj priljuÄka (port-a) vaÅ¡eg HTTP posrednika (proxy). ObiÄno se " 1522 "koristi 8080." 1185 1523 1186 1524 #. i18n: ectx: property (text), widget (QCheckBox, cbSameProxy) … … 1201 1539 msgid "" 1202 1540 "<qt>\n" 1203 "Reverse the use of the exception list. Checking this box will result in the proxy servers being used only when the requested URL matches one of the addresses listed here.<p>This feature is useful if all you want or need is to use a proxy server for a few specific sites.<p>If you have more complex requirements you might want to use a configuration script.\n" 1204 "</qt>" 1205 msgstr "" 1206 "<qt>\n" 1207 "KoriÅ¡tenje popisa iznimaka unatrag. Ako ukljuÄite ovu opciju, onda Äe se posrednici koristiti samo kad Äe se zahtijevani URL-ovi podudarati s ovdje popisanim adresama. <p>Ova moguÄnost je korisna ako samo ÅŸelite koristiti posrednika za nekoliko specifiÄnih stranica. <p>Ako imate kompliciranije potrebe, moÅŸda Äete htjeti koristiti konfiguracijsku skriptu.\n" 1541 "Reverse the use of the exception list. Checking this box will result in the " 1542 "proxy servers being used only when the requested URL matches one of the " 1543 "addresses listed here.<p>This feature is useful if all you want or need is to " 1544 "use a proxy server for a few specific sites.<p>If you have more complex " 1545 "requirements you might want to use a configuration script.\n" 1546 "</qt>" 1547 msgstr "" 1548 "<qt>\n" 1549 "KoriÅ¡tenje popisa iznimaka unatrag. Ako ukljuÄite ovu opciju, onda Äe se " 1550 "posrednici koristiti samo kad Äe se zahtijevani URL-ovi podudarati s ovdje " 1551 "popisanim adresama. <p>Ova moguÄnost je korisna ako samo ÅŸelite koristiti " 1552 "posrednika za nekoliko specifiÄnih stranica. <p>Ako imate kompliciranije " 1553 "potrebe, moÅŸda Äete htjeti koristiti konfiguracijsku skriptu.\n" 1208 1554 "</qt>" 1209 1555 … … 1218 1564 #: manualproxy.ui:188 1219 1565 msgid "Remove all proxy exception addresses from the list." 1220 msgstr "Ukloni sve adrese koje se ne dohvaÄaju preko proxy posluÅŸitelja sa popisa." 1566 msgstr "" 1567 "Ukloni sve adrese koje se ne dohvaÄaju preko proxy posluÅŸitelja sa popisa." 1221 1568 1222 1569 #. i18n: ectx: property (text), widget (QPushButton, pbDeleteAll) … … 1230 1577 #: manualproxy.ui:201 1231 1578 msgid "Remove the selected proxy exception address from the list." 1232 msgstr "Ukloni odabrane adrese koje se ne dohvaÄaju preko proxy posluÅŸitelja sa popisa." 1579 msgstr "" 1580 "Ukloni odabrane adrese koje se ne dohvaÄaju preko proxy posluÅŸitelja sa " 1581 "popisa." 1233 1582 1234 1583 #. i18n: ectx: property (text), widget (QPushButton, pbDelete) … … 1248 1597 #: manualproxy.ui:224 1249 1598 msgid "Change the selected proxy exception address." 1250 msgstr "Kliknite na ovaj gumb ako ÅŸelite izmjeniti odabrane adrese koje Äe biti iznimke." 1599 msgstr "" 1600 "Kliknite na ovaj gumb ako ÅŸelite izmjeniti odabrane adrese koje Äe biti " 1601 "iznimke." 1251 1602 1252 1603 #. i18n: ectx: property (text), widget (QPushButton, pbChange) … … 1264 1615 #: netpref.cpp:33 1265 1616 #, kde-format 1266 msgid "Here you can set timeout values. You might want to tweak them if your connection is very slow. The maximum allowed value is 1 second." 1267 msgid_plural "Here you can set timeout values. You might want to tweak them if your connection is very slow. The maximum allowed value is %1 seconds." 1268 msgstr[0] "Ovdje moÅŸete podesiti vrijeme valjanosti, koje moÅŸda trebate podesiti ako vam je veza spora. NajveÄa dozvoljena vrijednost je %1 sekunda." 1269 msgstr[1] "Ovdje moÅŸete podesiti vrijeme valjanosti, koje moÅŸda trebate podesiti ako vam je veza spora. NajveÄa dozvoljena vrijednost je %1 sekunde." 1270 msgstr[2] "Ovdje moÅŸete podesiti vrijeme valjanosti, koje moÅŸda trebate podesiti ako vam je veza spora. NajveÄa dozvoljena vrijednost je %1 sekundi." 1617 msgid "" 1618 "Here you can set timeout values. You might want to tweak them if your " 1619 "connection is very slow. The maximum allowed value is 1 second." 1620 msgid_plural "" 1621 "Here you can set timeout values. You might want to tweak them if your " 1622 "connection is very slow. The maximum allowed value is %1 seconds." 1623 msgstr[0] "" 1624 "Ovdje moÅŸete podesiti vrijeme valjanosti, koje moÅŸda trebate podesiti ako vam " 1625 "je veza spora. NajveÄa dozvoljena vrijednost je %1 sekunda." 1626 msgstr[1] "" 1627 "Ovdje moÅŸete podesiti vrijeme valjanosti, koje moÅŸda trebate podesiti ako vam " 1628 "je veza spora. NajveÄa dozvoljena vrijednost je %1 sekunde." 1629 msgstr[2] "" 1630 "Ovdje moÅŸete podesiti vrijeme valjanosti, koje moÅŸda trebate podesiti ako vam " 1631 "je veza spora. NajveÄa dozvoljena vrijednost je %1 sekundi." 1271 1632 1272 1633 #. +> trunk stable … … 1310 1671 #. +> trunk stable 1311 1672 #: netpref.cpp:69 1312 msgid "Enables FTP's \"passive\" mode. This is required to allow FTP to work from behind firewalls." 1313 msgstr "OmoguÄi FTP passive mode. Ovo je potrebno da bi koristili FTP iza vatrozida (firewalla)." 1673 msgid "" 1674 "Enables FTP's \"passive\" mode. This is required to allow FTP to work from " 1675 "behind firewalls." 1676 msgstr "" 1677 "OmoguÄi FTP passive mode. Ovo je potrebno da bi koristili FTP iza vatrozida " 1678 "(firewalla)." 1314 1679 1315 1680 #. +> trunk stable … … 1320 1685 #. +> trunk stable 1321 1686 #: netpref.cpp:76 1322 msgid "<p>Marks partially uploaded FTP files.</p><p>When this option is enabled, partially uploaded files will have a \".part\" extension. This extension will be removed once the transfer is complete.</p>" 1323 msgstr "<p>OznaÄi djelomiÄno uploadane FTP datoteke</p> <p>Ako je ova opcija omoguÄena, djelomiÄno uploadane datoteke Äe imati ekstenziju \".part\". Ekstenzija Äe biti maknuta kad prijenos zavrÅ¡i.</p>" 1687 msgid "" 1688 "<p>Marks partially uploaded FTP files.</p><p>When this option is enabled, " 1689 "partially uploaded files will have a \".part\" extension. This extension will " 1690 "be removed once the transfer is complete.</p>" 1691 msgstr "" 1692 "<p>OznaÄi djelomiÄno uploadane FTP datoteke</p> <p>Ako je ova opcija " 1693 "omoguÄena, djelomiÄno uploadane datoteke Äe imati ekstenziju \".part\". " 1694 "Ekstenzija Äe biti maknuta kad prijenos zavrÅ¡i.</p>" 1324 1695 1325 1696 #. +> trunk stable 1326 1697 #: netpref.cpp:144 1327 msgid "<h1>Network Preferences</h1>Here you can define the behavior of KDE programs when using Internet and network connections. If you experience timeouts or use a modem to connect to the Internet, you might want to adjust these settings." 1328 msgstr "<h1>Postavke mreÅŸe</h1> Ovdje moÅŸete definirati ponaÅ¡anje KDE programa dok korite Internet i mreÅŸne veze. Ako koristite modem za spajanje na Internet ili Vam mreÅŸa ne radi kako ÅŸelite, ovdje moÅŸete promijeniti te postavke." 1698 msgid "" 1699 "<h1>Network Preferences</h1>Here you can define the behavior of KDE programs " 1700 "when using Internet and network connections. If you experience timeouts or " 1701 "use a modem to connect to the Internet, you might want to adjust these " 1702 "settings." 1703 msgstr "" 1704 "<h1>Postavke mreÅŸe</h1> Ovdje moÅŸete definirati ponaÅ¡anje KDE programa dok " 1705 "korite Internet i mreÅŸne veze. Ako koristite modem za spajanje na Internet " 1706 "ili Vam mreÅŸa ne radi kako ÅŸelite, ovdje moÅŸete promijeniti te postavke." 1329 1707 1330 1708 #. i18n: ectx: property (whatsThis), widget (QLabel, lbDomain) … … 1334 1712 msgid "" 1335 1713 "<qt>\n" 1336 "Enter the host or domain to which this policy applies, e.g. <b>www.kde.org</b> or <b>.kde.org</b>.\n" 1337 "</qt>" 1338 msgstr "" 1339 "<qt>\n" 1340 "Unesite domaÄina ili domenu na koju se ovo pravilo odnosi, npr. <b>www.kde.org</b> ili <b>.kde.org</b>\n" 1714 "Enter the host or domain to which this policy applies, e.g. <b>www.kde.org</b>" 1715 " or <b>.kde.org</b>.\n" 1716 "</qt>" 1717 msgstr "" 1718 "<qt>\n" 1719 "Unesite domaÄina ili domenu na koju se ovo pravilo odnosi, npr. <b>www.kde." 1720 "org</b> ili <b>.kde.org</b>\n" 1341 1721 "</qt>" 1342 1722 … … 1366 1746 "<li><b>Prihvati</b> â Ove stranice smiju slati kolaÄiÄe</li>\n" 1367 1747 "<li><b>Odbij</b> â Ove stranice ne smiju slati kolaÄiÄe</li>\n" 1368 "<li><b>Pitaj</b> â TraÅŸi se potvrda kad god ove stranice pokuÅ¡aju poslati kolaÄiÄ</li>\n" 1748 "<li><b>Pitaj</b> â TraÅŸi se potvrda kad god ove stranice pokuÅ¡aju poslati " 1749 "kolaÄiÄ</li>\n" 1369 1750 "</ul>\n" 1370 1751 "</qt>" … … 1411 1792 #. +> trunk stable 1412 1793 #: smbrodlg.cpp:177 1413 msgid "<p><h1>Windows Shares</h1>Konqueror is able to access shared Microsoft Windows file systems, if properly configured. If there is a specific computer from which you want to browse, fill in the <em>Browse server</em> field. This is mandatory if you are not running Samba locally. The <em>Broadcast address</em> and <em>WINS address</em> fields will also be available, if you use the native code, or the location of the 'smb.conf' file from which the options are read, when using Samba. In any case, the broadcast address (interfaces in smb.conf) must be set up if it is guessed incorrectly or you have multiple cards. A WINS server usually improves performance, and reduces the network load a lot.</p><p>The bindings are used to assign a default user for a given server, possibly with the corresponding password, or for accessing specific shares. If you choose to, new bindings will be created for logins and shares accessed during browsing. You can edit all of them from here. Passwords will be stored locally, and scrambled so as to render them unreadable to the human eye. For security reasons, you may not want to do that, as entries with passwords are clearly indicated as such.</p>" 1414 msgstr "<p> <h1>Windows dijeljenja</h1> Konqueror moÅŸe pristupati dijeljenim datoteÄnim sustavima operacijskog sustava Microsoft Windows, ako je pravilno postavljen. Ako postoji specifiÄno raÄunalo koje ÅŸelite pregledati, popunite polje <em>Pregledaj posluÅŸitelja</em>. To je obavezno ako nemate lokalno pokrenutu Sambu. Polja <em>Adresa emitiranja</em> i <em>WINS adresa</em> Äe takoÄer biti dostupna, ako koristite Äisti kod, ili lokacija'smb.conf' datoteke iz koje Äe biti proÄitane opcije, ako koristite Sambu. U oba sluÄaja, adresa emitiranja (suÄelja u smb.conf) mora biti postavljena ako je pogreÅ¡no pogoÄena ili ako imate viÅ¡e mreÅŸnih kartica. WINS posluÅŸitelj obiÄno poboljÅ¡a brzinu i uvelike smanji optereÄenje mreÅŸe.</p> <p>Veze se koriste za dodjeljivanje uobiÄajenog korisnika zadanom posluÅŸitelju, moguÄe s odgovarajuÄom lozinkom, ili za pristup specifiÄnim lokacijama. Ako tako odaberete, nove veze Äe se stvoriti za prijave i dijeljenja kojima se pristupa prilikom pregledavanja. Sve ih moÅŸete urediti odavde. Lozinke Äe biti spremljene lokalno, ali ispremijeÅ¡ane kako bi bile neÄitljive ljudima (iz sigurnosnih razloga).</p>" 1794 msgid "" 1795 "<p><h1>Windows Shares</h1>Konqueror is able to access shared Microsoft " 1796 "Windows file systems, if properly configured. If there is a specific computer " 1797 "from which you want to browse, fill in the <em>Browse server</em> field. This " 1798 "is mandatory if you are not running Samba locally. The <em>Broadcast address<" 1799 "/em> and <em>WINS address</em> fields will also be available, if you use the " 1800 "native code, or the location of the 'smb.conf' file from which the options " 1801 "are read, when using Samba. In any case, the broadcast address (interfaces in " 1802 "smb.conf) must be set up if it is guessed incorrectly or you have multiple " 1803 "cards. A WINS server usually improves performance, and reduces the network " 1804 "load a lot.</p><p>The bindings are used to assign a default user for a given " 1805 "server, possibly with the corresponding password, or for accessing specific " 1806 "shares. If you choose to, new bindings will be created for logins and shares " 1807 "accessed during browsing. You can edit all of them from here. Passwords will " 1808 "be stored locally, and scrambled so as to render them unreadable to the human " 1809 "eye. For security reasons, you may not want to do that, as entries with " 1810 "passwords are clearly indicated as such.</p>" 1811 msgstr "" 1812 "<p> <h1>Windows dijeljenja</h1> Konqueror moÅŸe pristupati dijeljenim " 1813 "datoteÄnim sustavima operacijskog sustava Microsoft Windows, ako je pravilno " 1814 "postavljen. Ako postoji specifiÄno raÄunalo koje ÅŸelite pregledati, popunite " 1815 "polje <em>Pregledaj posluÅŸitelja</em>. To je obavezno ako nemate lokalno " 1816 "pokrenutu Sambu. Polja <em>Adresa emitiranja</em> i <em>WINS adresa</em> Äe " 1817 "takoÄer biti dostupna, ako koristite Äisti kod, ili lokacija'smb.conf' " 1818 "datoteke iz koje Äe biti proÄitane opcije, ako koristite Sambu. U oba " 1819 "sluÄaja, adresa emitiranja (suÄelja u smb.conf) mora biti postavljena ako je " 1820 "pogreÅ¡no pogoÄena ili ako imate viÅ¡e mreÅŸnih kartica. WINS posluÅŸitelj obiÄno " 1821 "poboljÅ¡a brzinu i uvelike smanji optereÄenje mreÅŸe.</p> <p>Veze se koriste za " 1822 "dodjeljivanje uobiÄajenog korisnika zadanom posluÅŸitelju, moguÄe s " 1823 "odgovarajuÄom lozinkom, ili za pristup specifiÄnim lokacijama. Ako tako " 1824 "odaberete, nove veze Äe se stvoriti za prijave i dijeljenja kojima se " 1825 "pristupa prilikom pregledavanja. Sve ih moÅŸete urediti odavde. Lozinke Äe " 1826 "biti spremljene lokalno, ali ispremijeÅ¡ane kako bi bile neÄitljive ljudima " 1827 "(iz sigurnosnih razloga).</p>" 1415 1828 1416 1829 #. +> trunk stable 1417 1830 #: useragentdlg.cpp:80 1418 #, fuzzy1419 1831 #| msgid "Add Identification" 1420 1832 msgctxt "@title:window" … … 1424 1836 #. +> trunk stable 1425 1837 #: useragentdlg.cpp:149 1426 #, fuzzy1427 1838 #| msgid "Modify Identification" 1428 1839 msgctxt "@title:window" 1429 1840 msgid "Modify Identification" 1430 msgstr "Izm jeni identifikaciju"1841 msgstr "Izmijeni identifikaciju" 1431 1842 1432 1843 #. +> trunk stable 1433 1844 #: useragentdlg.cpp:201 1434 1845 #, kde-format 1435 msgid "<qt><center>Found an existing identification for<br/><b>%1</b><br/>Do you want to replace it?</center></qt>" 1436 msgstr "<qt> <center>PronaÄena postojeÄa identifikacija za<br/> <b>%1</b><br/> Åœelite li je zamijeniti?</center> </qt>" 1846 msgid "" 1847 "<qt><center>Found an existing identification for<br/><b>%1</b><br/>Do you " 1848 "want to replace it?</center></qt>" 1849 msgstr "" 1850 "<qt> <center>PronaÄena postojeÄa identifikacija za<br/> <b>%1</b><br/> Åœelite " 1851 "li je zamijeniti?</center> </qt>" 1437 1852 1438 1853 #. +> trunk stable 1439 1854 #: useragentdlg.cpp:206 1440 #, fuzzy1441 1855 #| msgid "Duplicate Identification" 1442 1856 msgctxt "@title:window" 1443 1857 msgid "Duplicate Identification" 1444 msgstr "D vostruka identifikacija"1858 msgstr "Duplikat identifikacije" 1445 1859 1446 1860 #. +> trunk stable 1447 1861 #: useragentdlg.cpp:386 1448 msgid "<p><h1>Browser Identification</h1> The browser-identification module allows you to have full control over how Konqueror will identify itself to web sites you browse.</p><p>This ability to fake identification is necessary because some web sites do not display properly when they detect that they are not talking to current versions of either Netscape Navigator or Internet Explorer, even if the browser actually supports all the necessary features to render those pages properly. For such sites, you can use this feature to try to browse them. Please understand that this might not always work, since such sites might be using non-standard web protocols and or specifications.</p><p><u>NOTE:</u> To obtain specific help on a particular section of the dialog box, simply click on the quick help button on the window title bar, then click on the section for which you are seeking help.</p>" 1449 msgstr "<p> <h1>Indentifikacija preglednikay</h1> Modul za identifikaciju preglednika Vam omoguÄuje punu kontrolu nad tim kako Äe se Konqueror identificirati web stranicama koje pregledavate.</p> <p>Ova moguÄnost laÅŸne identifikacije je potrebna jer se neke web stranice ne ÅŸele pravilno iscrtati ako otkriju da ih se ne pregledava sa najzadnjim verzijama Mozilla Firefoxa ili Internet Explorera, makar taj preglednik imao sve moguÄnosti potrebne za pravilno iscrtavanje tih stranica. Za takve stranice, moÅŸete iskoristiti ovu moguÄnost dok ih pregledavate. Molimo za razumijevanje da taj trik moÅŸda neÄe uvijek upaliti, jer takve stranice moÅŸda koriste nestandardne web protokole i/ili specifikacije.</p> <p><u>NAPOMENA:</u>Da biste dobili specifiÄnu pomoÄ za odreÄeni dio dialoga, jednostavno kliknite na gumb za brzu pomoÄ u naslovnoj traci prozora, a zatim kliknite na dio za koji traÅŸite pomoÄ.</p>" 1862 msgid "" 1863 "<p><h1>Browser Identification</h1> The browser-identification module allows " 1864 "you to have full control over how Konqueror will identify itself to web sites " 1865 "you browse.</p><p>This ability to fake identification is necessary because " 1866 "some web sites do not display properly when they detect that they are not " 1867 "talking to current versions of either Netscape Navigator or Internet " 1868 "Explorer, even if the browser actually supports all the necessary features to " 1869 "render those pages properly. For such sites, you can use this feature to try " 1870 "to browse them. Please understand that this might not always work, since such " 1871 "sites might be using non-standard web protocols and or specifications.</p><p>" 1872 "<u>NOTE:</u> To obtain specific help on a particular section of the dialog " 1873 "box, simply click on the quick help button on the window title bar, then " 1874 "click on the section for which you are seeking help.</p>" 1875 msgstr "" 1876 "<p> <h1>Indentifikacija preglednikay</h1> Modul za identifikaciju " 1877 "preglednika Vam omoguÄuje punu kontrolu nad tim kako Äe se Konqueror " 1878 "identificirati web stranicama koje pregledavate.</p> <p>Ova moguÄnost laÅŸne " 1879 "identifikacije je potrebna jer se neke web stranice ne ÅŸele pravilno iscrtati " 1880 "ako otkriju da ih se ne pregledava sa najzadnjim verzijama Mozilla Firefoxa " 1881 "ili Internet Explorera, makar taj preglednik imao sve moguÄnosti potrebne za " 1882 "pravilno iscrtavanje tih stranica. Za takve stranice, moÅŸete iskoristiti ovu " 1883 "moguÄnost dok ih pregledavate. Molimo za razumijevanje da taj trik moÅŸda neÄe " 1884 "uvijek upaliti, jer takve stranice moÅŸda koriste nestandardne web protokole " 1885 "i/ili specifikacije.</p> <p><u>NAPOMENA:</u>Da biste dobili specifiÄnu pomoÄ " 1886 "za odreÄeni dio dialoga, jednostavno kliknite na gumb za brzu pomoÄ u " 1887 "naslovnoj traci prozora, a zatim kliknite na dio za koji traÅŸite pomoÄ.</p>" 1450 1888 1451 1889 #. i18n: ectx: property (whatsThis), widget (QWidget, UserAgentUI) … … 1454 1892 msgid "" 1455 1893 "<qt>\n" 1456 "Here you can modify the default browser-identification text or set a site <code>(eg. www.kde.org)</code> or a domain <code>(eg. kde.org)</code> specific identification text.<p>\n" 1457 "To add a new site-specific identification text, click the <code>New</code> button and supply the necessary information. To change an existing site-specific entry, click on the <code>Change</code> button. The <code>Delete</code> button will remove the selected site-specific identification text, causing the default setting to be used for that site or domain.\n" 1458 "</qt>" 1459 msgstr "" 1460 "<qt>\n" 1461 "Ovdje moÅŸete promijeniti uobiÄajeni tekst identifikacije preglednika ili postaviti specifiÄni tekst identifikacije za odreÄene stranice ili domene (npr. <code>www.kde.org</code> ili <code>.kde.org</code>). <p>\n" 1462 "Da biste dodali novi tekst identifikacije za specifiÄnu stranicu, kliknite na gumb <code>Novo</code> i dajte potrebne informacije. Da biste promijenili unos za specifiÄnu stranicu, kliknite na gumb <code>Promijeni</code>. Gumb <code>IzbriÅ¡i</code> Äe izbrisati identifikacijske tekstove za odabrane specifiÄne stranice. Za te stranice bit Äe koriÅ¡tene uobiÄajene postavke.\n" 1894 "Here you can modify the default browser-identification text or set a site <" 1895 "code>(eg. www.kde.org)</code> or a domain <code>(eg. kde.org)</code> specific " 1896 "identification text.<p>\n" 1897 "To add a new site-specific identification text, click the <code>New</code> " 1898 "button and supply the necessary information. To change an existing " 1899 "site-specific entry, click on the <code>Change</code> button. The <code>" 1900 "Delete</code> button will remove the selected site-specific identification " 1901 "text, causing the default setting to be used for that site or domain.\n" 1902 "</qt>" 1903 msgstr "" 1904 "<qt>\n" 1905 "Ovdje moÅŸete promijeniti uobiÄajeni tekst identifikacije preglednika ili " 1906 "postaviti specifiÄni tekst identifikacije za odreÄene stranice ili domene " 1907 "(npr. <code>www.kde.org</code> ili <code>.kde.org</code>). <p>\n" 1908 "Da biste dodali novi tekst identifikacije za specifiÄnu stranicu, kliknite na " 1909 "gumb <code>Novo</code> i dajte potrebne informacije. Da biste promijenili " 1910 "unos za specifiÄnu stranicu, kliknite na gumb <code>Promijeni</code>. Gumb <" 1911 "code>IzbriÅ¡i</code> Äe izbrisati identifikacijske tekstove za odabrane " 1912 "specifiÄne stranice. Za te stranice bit Äe koriÅ¡tene uobiÄajene postavke.\n" 1463 1913 "</qt>" 1464 1914 … … 1469 1919 "<qt>\n" 1470 1920 "Send the browser identification to web sites.<p>\n" 1471 "<u>NOTE:</u> Many sites rely on this information to display pages properly, hence, it is highly recommended that you do not totally disable this feature but rather customize it.<p>\n" 1472 "By default, only minimal identification information is sent to remote sites. The identification text that will be sent is shown below.\n" 1921 "<u>NOTE:</u> Many sites rely on this information to display pages properly, " 1922 "hence, it is highly recommended that you do not totally disable this feature " 1923 "but rather customize it.<p>\n" 1924 "By default, only minimal identification information is sent to remote sites. " 1925 "The identification text that will be sent is shown below.\n" 1473 1926 "</qt>" 1474 1927 msgstr "" 1475 1928 "<qt>\n" 1476 1929 "Å alji identifikaciju preglednika web stranicama.<p>\n" 1477 "<u>NAPOMENA:</u> Mnoge stranice oslanjaju se na ovaj podatak kako bi ispravno prikazale sadrÅŸaj. Stoga je preporuÄljivo da ne iskljuÄujete ovu moguÄnost potpuno, veÄ da je samo prilagodite.<p>\n" 1478 "UobiÄajeno se Å¡alju samo najnuÅŸniji podaci. Tekst koji se Å¡alje prikazan je dolje.\n" 1930 "<u>NAPOMENA:</u> Mnoge stranice oslanjaju se na ovaj podatak kako bi ispravno " 1931 "prikazale sadrÅŸaj. Stoga je preporuÄljivo da ne iskljuÄujete ovu moguÄnost " 1932 "potpuno, veÄ da je samo prilagodite.<p>\n" 1933 "UobiÄajeno se Å¡alju samo najnuÅŸniji podaci. Tekst koji se Å¡alje prikazan je " 1934 "dolje.\n" 1479 1935 "</qt>" 1480 1936 … … 1488 1944 #. +> trunk stable 1489 1945 #: useragentdlg.ui:43 1490 msgid "The browser identification text sent to the sites you visit. Use the provided options to customize it." 1491 msgstr "Identifikacijski tekst preglednika koji se Å¡alje web stranicama koje posjetite. MoÅŸete ga prilagoditi ponuÄenim opcijama." 1946 msgid "" 1947 "The browser identification text sent to the sites you visit. Use the provided " 1948 "options to customize it." 1949 msgstr "" 1950 "Identifikacijski tekst preglednika koji se Å¡alje web stranicama koje " 1951 "posjetite. MoÅŸete ga prilagoditi ponuÄenim opcijama." 1492 1952 1493 1953 #. i18n: ectx: property (title), widget (QGroupBox, defaultIdGroupBox) … … 1500 1960 #. +> trunk stable 1501 1961 #: useragentdlg.ui:58 1502 msgid "The browser identification text sent to the sites you visit. You can customize it using the options provided below." 1503 msgstr "Ovo je uobiÄajena identifikacija koja se Å¡alje posluÅŸiteljima tokom pretraÅŸivanja stranica na internetu. Odabiranjem u kuÄicama ispod moÅŸete ju prilagoditi svojim ÅŸeljama." 1962 msgid "" 1963 "The browser identification text sent to the sites you visit. You can " 1964 "customize it using the options provided below." 1965 msgstr "" 1966 "Ovo je uobiÄajena identifikacija koja se Å¡alje posluÅŸiteljima tokom " 1967 "pretraÅŸivanja stranica na internetu. Odabiranjem u kuÄicama ispod moÅŸete ju " 1968 "prilagoditi svojim ÅŸeljama." 1504 1969 1505 1970 #. i18n: ectx: property (whatsThis), widget (QCheckBox, osNameCheckBox) 1506 1971 #. +> trunk stable 1507 1972 #: useragentdlg.ui:71 1508 msgid "Includes your operating system's name in the browser identification text." 1509 msgstr "Ovdje odabirete dodavanje <code>inaÄice vaÅ¡eg operacijskog sustava</code> u uobiÄajenu identifikacijsku poruku." 1973 msgid "" 1974 "Includes your operating system's name in the browser identification text." 1975 msgstr "" 1976 "Ovdje odabirete dodavanje <code>inaÄice vaÅ¡eg operacijskog sustava</code> u " 1977 "uobiÄajenu identifikacijsku poruku." 1510 1978 1511 1979 #. i18n: ectx: property (text), widget (QCheckBox, osNameCheckBox) … … 1518 1986 #. +> trunk stable 1519 1987 #: useragentdlg.ui:102 1520 msgid "Includes your operating system's version number in the browser identification text." 1521 msgstr "Ovdje odabirete dodavanje <code>inaÄice vaÅ¡eg operacijskog sustava</code> u uobiÄajenu identifikacijsku poruku." 1988 msgid "" 1989 "Includes your operating system's version number in the browser identification " 1990 "text." 1991 msgstr "" 1992 "Ovdje odabirete dodavanje <code>inaÄice vaÅ¡eg operacijskog sustava</code> u " 1993 "uobiÄajenu identifikacijsku poruku." 1522 1994 1523 1995 #. i18n: ectx: property (text), widget (QCheckBox, osVersionCheckBox) … … 1542 2014 #. +> trunk stable 1543 2015 #: useragentdlg.ui:127 1544 msgid "Includes your language settings in the browser identification text to obtain localized versions of the page." 1545 msgstr "UkljuÄuje vaÅ¡e jeziÄne postavke u identifikacijskom tekstu preglednika kako bi se dohvatila lokalizirana verzija stranice." 2016 msgid "" 2017 "Includes your language settings in the browser identification text to obtain " 2018 "localized versions of the page." 2019 msgstr "" 2020 "UkljuÄuje vaÅ¡e jeziÄne postavke u identifikacijskom tekstu preglednika kako " 2021 "bi se dohvatila lokalizirana verzija stranice." 1546 2022 1547 2023 #. i18n: ectx: property (text), widget (QCheckBox, languageCheckBox) … … 1611 2087 msgid "" 1612 2088 "<qt>\n" 1613 "Enter the site or domain name where a fake browser identification should be used.<p>\n" 1614 "<u>NOTE:</u> Wildcard syntax such as \\\"*,?\\\" is NOT allowed: instead, use the top level address of a site to make generic matches; for example, if you want all KDE sites to receive a fake browser identification, you would enter <code>kde.org</code> - the fake identity would then be sent to any KDE site that ends with <code>kde.org</code>.</p>\n" 1615 "</qt>" 1616 msgstr "" 1617 "<qt>\n" 1618 "Unesite web stranicu ili domenu gdje bi treba biti koriÅ¡tena laÅŸna identifikacija pretraÅŸivaÄa. <p>\n" 1619 "<u>NAPOMENA:</u>ViÅ¡eznaÄna sintaksa poput \\\"*, ?\\\" NIJE dozvoljena: umjesto toga, koristite gornji nivo adrese web stranice da biste dobili opÄenite podudarnosti; na primjer, ako ÅŸelite da sve KDE stranice dobe laÅŸnu identifikaciju preglednika, unijeli biste <code>.kde.org</code> â laÅŸni identitet Äe tada biti poslan svim stranicama Äija adresa zavrÅ¡ava na <code>kde.org</code>.\n" 2089 "Enter the site or domain name where a fake browser identification should be " 2090 "used.<p>\n" 2091 "<u>NOTE:</u> Wildcard syntax such as \\\"*,?\\\" is NOT allowed: instead, use " 2092 "the top level address of a site to make generic matches; for example, if you " 2093 "want all KDE sites to receive a fake browser identification, you would enter " 2094 "<code>kde.org</code> - the fake identity would then be sent to any KDE site " 2095 "that ends with <code>kde.org</code>.</p>\n" 2096 "</qt>" 2097 msgstr "" 2098 "<qt>\n" 2099 "Unesite web stranicu ili domenu gdje bi treba biti koriÅ¡tena laÅŸna " 2100 "identifikacija pretraÅŸivaÄa. <p>\n" 2101 "<u>NAPOMENA:</u>ViÅ¡eznaÄna sintaksa poput \\\"*, ?\\\" NIJE dozvoljena: " 2102 "umjesto toga, koristite gornji nivo adrese web stranice da biste dobili " 2103 "opÄenite podudarnosti; na primjer, ako ÅŸelite da sve KDE stranice dobe laÅŸnu " 2104 "identifikaciju preglednika, unijeli biste <code>.kde.org</code> â laÅŸni " 2105 "identitet Äe tada biti poslan svim stranicama Äija adresa zavrÅ¡ava na <code>" 2106 "kde.org</code>.\n" 1620 2107 "</qt>" 1621 2108 … … 1632 2119 msgid "" 1633 2120 "<qt>\n" 1634 "Select the browser identification to use whenever contacting the site you specified above.\n" 1635 "</qt>" 1636 msgstr "" 1637 "<qt>\n" 1638 "Odaberite identifikaciju preglednika koju Äete koristiti kad pristupate stranicama navedenim gore.\n" 2121 "Select the browser identification to use whenever contacting the site you " 2122 "specified above.\n" 2123 "</qt>" 2124 msgstr "" 2125 "<qt>\n" 2126 "Odaberite identifikaciju preglednika koju Äete koristiti kad pristupate " 2127 "stranicama navedenim gore.\n" 1639 2128 "</qt>" 1640 2129 … … 1651 2140 msgid "" 1652 2141 "<qt>\n" 1653 "The actual browser identification text that will be sent to the remote machine.\n" 1654 "</qt>" 1655 msgstr "" 1656 "<qt>\n" 1657 "Stvarni tekst identifikacije preglednika koji Äe biti poslan udaljenom raÄunalu.\n" 2142 "The actual browser identification text that will be sent to the remote " 2143 "machine.\n" 2144 "</qt>" 2145 msgstr "" 2146 "<qt>\n" 2147 "Stvarni tekst identifikacije preglednika koji Äe biti poslan udaljenom " 2148 "raÄunalu.\n" 1658 2149 "</qt>" 1659 2150 -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmkonq.po
r1123 r1129 5 5 # Andrej Dundovic <adundovi@gmail.com>, 2009. 6 6 # Marko Dimjasevic <marko@dimjasevic.net>, 2011. 7 # Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>, 2011. 7 8 msgid "" 8 9 msgstr "" … … 10 11 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 11 12 "POT-Creation-Date: 2011-07-08 10:22+0200\n" 12 "PO-Revision-Date: 2011-0 3-04 19:03+0100\n"13 "Last-Translator: Marko Dimja sevic<marko@dimjasevic.net>\n"13 "PO-Revision-Date: 2011-07-12 16:54+0200\n" 14 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 14 15 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" 15 16 "MIME-Version: 1.0\n" … … 17 18 "Content-Transfer-Encoding: 8bit\n" 18 19 "Language: hr\n" 19 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 20 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 21 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 20 22 "X-Generator: Lokalize 1.2\n" 21 23 "X-Environment: kde\n" … … 25 27 #. +> trunk stable 26 28 #: behaviour.cpp:45 27 msgid "<h1>Konqueror Behavior</h1> You can configure how Konqueror behaves as a file manager here." 28 msgstr "<h1>PonaÅ¡anje Konquerora</h1>Ovdje moÅŸete podesiti ponaÅ¡anje Konquerora kao upravitelja datoteka. " 29 msgid "" 30 "<h1>Konqueror Behavior</h1> You can configure how Konqueror behaves as a file " 31 "manager here." 32 msgstr "" 33 "<h1>PonaÅ¡anje Konquerora</h1>Ovdje moÅŸete podesiti ponaÅ¡anje Konquerora kao " 34 "upravitelja datoteka. " 29 35 30 36 #. +> trunk stable … … 40 46 #. +> trunk stable 41 47 #: behaviour.cpp:59 42 msgid "If this option is checked, Konqueror will open a new window when you open a folder, rather than showing that folder's contents in the current window." 43 msgstr "Ako je ovo odabrano, Konqueror Äe otvoriti direktorij koji otvorite i pokazati ga u novom prozoru, umjesto da pokaÅŸe sadrÅŸaj direktorija u trenutnom prozoru." 48 msgid "" 49 "If this option is checked, Konqueror will open a new window when you open a " 50 "folder, rather than showing that folder's contents in the current window." 51 msgstr "" 52 "Ako je ovo odabrano, Konqueror Äe otvoriti direktorij koji otvorite i " 53 "pokazati ga u novom prozoru, umjesto da pokaÅŸe sadrÅŸaj direktorija u " 54 "trenutnom prozoru." 44 55 45 56 #. +> trunk stable … … 52 63 #, fuzzy 53 64 #| msgid "Check this if you want 'Delete' menu commands to be displayed on the desktop and in the file manager's context menus. You can always delete files by holding the Shift key while calling 'Move to Trash'." 54 msgid "Check this if you want 'Delete' menu commands to be displayed on the desktop and in the file manager's menus and context menus. You can always delete files by holding the Shift key while calling 'Move to Trash'." 55 msgstr "UkljuÄite ovo ako ÅŸelite da naredbe brisanja budu prikazane na radnoj povrÅ¡ini i u kontekstnim izbornicima upravitelja daotekama. Uvijek moÅŸete izbrisati datoteke tako da drÅŸite tipku Shift dok pozivate naredbu 'Baci u smeÄe'." 65 msgid "" 66 "Check this if you want 'Delete' menu commands to be displayed on the desktop " 67 "and in the file manager's menus and context menus. You can always delete " 68 "files by holding the Shift key while calling 'Move to Trash'." 69 msgstr "" 70 "UkljuÄite ovo ako ÅŸelite da naredbe brisanja budu prikazane na radnoj " 71 "povrÅ¡ini i u kontekstnim izbornicima upravitelja daotekama. Uvijek moÅŸete " 72 "izbrisati datoteke tako da drÅŸite tipku Shift dok pozivate naredbu 'Baci u " 73 "smeÄe'." 56 74 57 75 #. +> trunk stable 58 76 #: kcustommenueditor.cpp:96 59 #, fuzzy60 77 #| msgid "Menu Editor" 61 78 msgctxt "@title:window" -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmkwincompositing.po
r1123 r1129 10 10 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 11 11 "POT-Creation-Date: 2011-07-08 10:22+0200\n" 12 "PO-Revision-Date: 2011-0 5-04 21:53+0200\n"12 "PO-Revision-Date: 2011-07-12 16:57+0200\n" 13 13 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 14 14 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" … … 17 17 "Content-Transfer-Encoding: 8bit\n" 18 18 "Language: hr\n" 19 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 19 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 20 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 20 21 "X-Generator: Lokalize 1.2\n" 21 22 "X-Environment: kde\n" … … 101 102 #: main.cpp:213 102 103 msgid "" 103 "Failed to activate desktop effects using the given configuration options. Settings will be reverted to their previous values.\n" 104 "\n" 105 "Check your X configuration. You may also consider changing advanced options, especially changing the compositing type." 106 msgstr "" 107 "Ne mogu aktivirati efekte radne povrÅ¡ine sa zadanim konfiguracijskim opcijama. Postavke Äe biti vraÄene na stare vrijednosti.\n" 108 "\n" 109 "Provjerite vaÅ¡u X konfiguraciju. TakoÄer moÅŸete razmotriti izmjenu naprednih opcija, posebno promjenu tipa 3D efekata." 104 "Failed to activate desktop effects using the given configuration options. " 105 "Settings will be reverted to their previous values.\n" 106 "\n" 107 "Check your X configuration. You may also consider changing advanced options, " 108 "especially changing the compositing type." 109 msgstr "" 110 "Ne mogu aktivirati efekte radne povrÅ¡ine sa zadanim konfiguracijskim opcijama." 111 " Postavke Äe biti vraÄene na stare vrijednosti.\n" 112 "\n" 113 "Provjerite vaÅ¡u X konfiguraciju. TakoÄer moÅŸete razmotriti izmjenu naprednih " 114 "opcija, posebno promjenu tipa 3D efekata." 110 115 111 116 #. +> trunk stable … … 151 156 #. +> trunk stable 152 157 #: main.cpp:417 153 msgid "Desktop effects are not available on this system due to the following technical issues:" 154 msgstr "3D efekti nisu dostupni na ovom sustavu zbog sljedeÄih tehniÄkih predmeta:" 158 msgid "" 159 "Desktop effects are not available on this system due to the following " 160 "technical issues:" 161 msgstr "" 162 "3D efekti nisu dostupni na ovom sustavu zbog sljedeÄih tehniÄkih predmeta:" 155 163 156 164 #. +> trunk stable 157 165 #: main.cpp:630 158 166 msgid "" 159 "Your settings have been saved but as KDE is currently running in failsafe mode desktop effects cannot be enabled at this time.\n" 167 "Your settings have been saved but as KDE is currently running in failsafe " 168 "mode desktop effects cannot be enabled at this time.\n" 160 169 "\n" 161 170 "Please exit failsafe mode to enable desktop effects." 162 171 msgstr "" 163 "VaÅ¡e postavke biti Äe spremljene ali kako KDE trenutno radi u sigurnosnom naÄinu, efekti radne povrÅ¡ine ne mogu biti omoguÄeni u ovom trenutku.\n" 172 "VaÅ¡e postavke biti Äe spremljene ali kako KDE trenutno radi u sigurnosnom " 173 "naÄinu, efekti radne povrÅ¡ine ne mogu biti omoguÄeni u ovom trenutku.\n" 164 174 "\n" 165 175 "Molim vas da izaÄite iz sigurnosnog naÄina rada kako bi ste omoguÄili efekte." … … 184 194 #. +> trunk stable 185 195 #: main.ui:82 186 #, fuzzy187 196 msgid "Pressing this button can crash the desktop." 188 msgstr "Prit nisnite gumb za brisanje osjetila."197 msgstr "Pritiskanje ovog gumba moÅŸe uzrokovati ruÅ¡enje radne povrÅ¡ine." 189 198 190 199 #. i18n: ectx: property (text), widget (QCheckBox, rearmSafetyCheck) … … 192 201 #: main.ui:105 193 202 msgid "I have saved my data." 194 msgstr " "203 msgstr "Spremio sam svoje podatke." 195 204 196 205 #. i18n: ectx: property (text), widget (QPushButton, rearmGlSupportButton) 197 206 #. +> trunk stable 198 207 #: main.ui:128 199 #, fuzzy200 208 msgid "Re-enable OpenGL detection" 201 msgstr " OmoguÄi otkrivanje mrtvog istorazinca"209 msgstr "Ponovno omoguÄi otkrivanje OpenGL-a" 202 210 203 211 #. i18n: ectx: property (title), widget (QGroupBox, groupBox_2) … … 218 226 #: main.ui:199 219 227 msgid "Desktop effects can be toggled anytime using this shortcut:" 220 msgstr "Efekti radne povrÅ¡ine moÅŸete bilo kada ukljuÄiti i iskljuÄiti koristeÄi ovaj preÄac:" 228 msgstr "" 229 "Efekti radne povrÅ¡ine moÅŸete bilo kada ukljuÄiti i iskljuÄiti koristeÄi ovaj " 230 "preÄac:" 221 231 222 232 #. i18n: ectx: property (title), widget (QGroupBox, groupBox) … … 301 311 #. +> trunk stable 302 312 #: main.ui:418 303 msgid "You can find more effects, as well as effect-specific settings, in the \"All Effects\" tab above." 304 msgstr "MoÅŸete pronaÄi joÅ¡ efekata, kao i postavke vezane uz efekte u \"Svi efekti\" kartici iznad." 313 msgid "" 314 "You can find more effects, as well as effect-specific settings, in the \"All " 315 "Effects\" tab above." 316 msgstr "" 317 "MoÅŸete pronaÄi joÅ¡ efekata, kao i postavke vezane uz efekte u \"Svi efekti\" " 318 "kartici iznad." 305 319 306 320 #. i18n: ectx: attribute (title), widget (QWidget, tab_2) … … 313 327 #. +> trunk stable 314 328 #: main.ui:472 315 msgid "Hint: To find out or configure how to activate an effect, look at the effect's settings." 316 msgstr "Savjet: Za pronaÄi gdje ili kako konfigurirati, odnosno aktivirati efekt, pogledajte na postavke efekta." 329 msgid "" 330 "Hint: To find out or configure how to activate an effect, look at the " 331 "effect's settings." 332 msgstr "" 333 "Savjet: Za pronaÄi gdje ili kako konfigurirati, odnosno aktivirati efekt, " 334 "pogledajte na postavke efekta." 317 335 318 336 #. i18n: ectx: attribute (title), widget (QWidget, tab_4) … … 361 379 #. +> trunk stable 362 380 #: main.ui:615 363 msgctxt "A window thumbnail requires to have the corresponding window mapped. To have thumbnails at all time, windows are not unmapped. This can break window minimization as it is modelled as unmapping of windows." 381 msgctxt "" 382 "A window thumbnail requires to have the corresponding window mapped. To have " 383 "thumbnails at all time, windows are not unmapped. This can break window " 384 "minimization as it is modelled as unmapping of windows." 364 385 msgid "Always (Breaks minimization)" 365 386 msgstr "Uvijek (uniÅ¡tava minimizaciju)" … … 368 389 #. +> trunk stable 369 390 #: main.ui:620 370 msgctxt "Windows are not unmapped if the window is somewhere visible on any of the virtual desktops." 391 msgctxt "" 392 "Windows are not unmapped if the window is somewhere visible on any of the " 393 "virtual desktops." 371 394 msgid "Only for Shown Windows" 372 395 msgstr "Samo za prikazane prozore" … … 375 398 #. +> trunk stable 376 399 #: main.ui:625 377 msgctxt "Windows are unmapped as they are requested. This can lead to not having updated thumbnials for windows on other desktops." 400 msgctxt "" 401 "Windows are unmapped as they are requested. This can lead to not having " 402 "updated thumbnials for windows on other desktops." 378 403 msgid "Never" 379 404 msgstr "Nikada" … … 389 414 #: main.ui:666 390 415 msgid "" 391 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n" 392 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n" 416 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3." 417 "org/TR/REC-html40/strict.dtd\">\n" 418 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">" 419 "\n" 393 420 "p, li { white-space: pre-wrap; }\n" 394 "</style></head><body style=\" font-family:'Segoe'; font-size:8pt; font-weight:400; font-style:normal;\">\n" 395 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Crisp:</span></p>\n" 396 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">XRenderSetPictureFilter(\"fast\")</span> - Pretty fast on all GPUs but looks bricky</p>\n" 397 "<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>\n" 398 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Smooth:</span></p>\n" 399 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">XRenderSetPictureFilter(\"good\") </span>- linear blending.</p>\n" 400 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Fast enough on newer nvidia GPUs and maybe others but also can be <span style=\" text-decoration: underline;\">very</span> slow, you will have to try it.</p></body></html>" 401 msgstr "" 402 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n" 403 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n" 421 "</style></head><body style=\" font-family:'Segoe'; font-size:8pt; " 422 "font-weight:400; font-style:normal;\">\n" 423 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 424 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" " 425 "font-weight:600;\">Crisp:</span></p>\n" 426 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 427 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" " 428 "font-style:italic;\">XRenderSetPictureFilter(\"fast\")</span> - Pretty fast " 429 "on all GPUs but looks bricky</p>\n" 430 "<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; " 431 "margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>" 432 "\n" 433 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 434 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" " 435 "font-weight:600;\">Smooth:</span></p>\n" 436 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 437 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" " 438 "font-style:italic;\">XRenderSetPictureFilter(\"good\") </span>- linear " 439 "blending.</p>\n" 440 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 441 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Fast enough on newer " 442 "nvidia GPUs and maybe others but also can be <span style=\" text-decoration: " 443 "underline;\">very</span> slow, you will have to try it.</p></body></html>" 444 msgstr "" 445 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3." 446 "org/TR/REC-html40/strict.dtd\">\n" 447 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">" 448 "\n" 404 449 "p, li { white-space: pre-wrap; }\n" 405 "</style></head><body style=\" font-family:'Segoe'; font-size:8pt; font-weight:400; font-style:normal;\">\n" 406 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Krto:</span></p>\n" 407 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">XRenderSetPictureFilter(\"fast\")</span> â PopriliÄno brzo na svim GPU-ovima, no izgleda kockasto</p>\n" 408 "<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>\n" 409 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">UglaÄeno:</span></p>\n" 410 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">XRenderSetPictureFilter(\"good\") </span>- linearno stapanje.</p>\n" 411 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Dovoljno brzo na novijim nvidijinim GPU-ovima i moÅŸda i na ostali, no takoÄer moÅŸe biti <span style=\" text-decoration: underline;\">vrlo</span> sporo; morat Äete isprobati.</p></body></html>" 450 "</style></head><body style=\" font-family:'Segoe'; font-size:8pt; " 451 "font-weight:400; font-style:normal;\">\n" 452 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 453 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" " 454 "font-weight:600;\">Krto:</span></p>\n" 455 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 456 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" " 457 "font-style:italic;\">XRenderSetPictureFilter(\"fast\")</span> â PopriliÄno " 458 "brzo na svim GPU-ovima, no izgleda kockasto</p>\n" 459 "<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; " 460 "margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>" 461 "\n" 462 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 463 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" " 464 "font-weight:600;\">UglaÄeno:</span></p>\n" 465 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 466 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" " 467 "font-style:italic;\">XRenderSetPictureFilter(\"good\") </span>- linearno " 468 "stapanje.</p>\n" 469 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 470 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Dovoljno brzo na " 471 "novijim nvidijinim GPU-ovima i moÅŸda i na ostali, no takoÄer moÅŸe biti <span " 472 "style=\" text-decoration: underline;\">vrlo</span> sporo; morat Äete " 473 "isprobati.</p></body></html>" 412 474 413 475 #. i18n: ectx: property (text), item, widget (QComboBox, xrScaleFilter) … … 428 490 #: main.ui:699 429 491 msgid "" 430 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n" 431 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n" 492 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3." 493 "org/TR/REC-html40/strict.dtd\">\n" 494 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">" 495 "\n" 432 496 "p, li { white-space: pre-wrap; }\n" 433 "</style></head><body style=\" font-family:'Segoe'; font-size:8pt; font-weight:400; font-style:normal;\">\n" 434 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Crisp:</span></p>\n" 435 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">GL_NEAREST</span> - (very) fast on all GPUs but looks bricky</p>\n" 436 "<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>\n" 437 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Smooth:</span></p>\n" 438 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">GL_LINEAR</span> - fast on most GPUs but a little blurry</p>\n" 439 "<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>\n" 440 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Accurate:</span></p>\n" 441 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Lanczos filter, requires shader support (glsl or arb).</p>\n" 442 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Might be slow on weaker GPUs and even cause various troubles with broken drivers (from overbrightening to segfaults.)</p>\n" 443 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Fall back to \"Smooth\" if you have problems.</p></body></html>" 444 msgstr "" 445 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n" 446 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n" 497 "</style></head><body style=\" font-family:'Segoe'; font-size:8pt; " 498 "font-weight:400; font-style:normal;\">\n" 499 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 500 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" " 501 "font-weight:600;\">Crisp:</span></p>\n" 502 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 503 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" " 504 "font-style:italic;\">GL_NEAREST</span> - (very) fast on all GPUs but looks " 505 "bricky</p>\n" 506 "<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; " 507 "margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>" 508 "\n" 509 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 510 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" " 511 "font-weight:600;\">Smooth:</span></p>\n" 512 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 513 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" " 514 "font-style:italic;\">GL_LINEAR</span> - fast on most GPUs but a little " 515 "blurry</p>\n" 516 "<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; " 517 "margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>" 518 "\n" 519 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 520 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" " 521 "font-weight:600;\">Accurate:</span></p>\n" 522 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 523 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Lanczos filter, " 524 "requires shader support (glsl or arb).</p>\n" 525 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 526 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Might be slow on " 527 "weaker GPUs and even cause various troubles with broken drivers (from " 528 "overbrightening to segfaults.)</p>\n" 529 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 530 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Fall back to " 531 "\"Smooth\" if you have problems.</p></body></html>" 532 msgstr "" 533 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3." 534 "org/TR/REC-html40/strict.dtd\">\n" 535 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">" 536 "\n" 447 537 "p, li { white-space: pre-wrap; }\n" 448 "</style></head><body style=\" font-family:'Segoe'; font-size:8pt; font-weight:400; font-style:normal;\">\n" 449 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Kruto:</span></p>\n" 450 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">GL_NEAREST</span> â (popriliÄno) brzo na svim GPU-ovima, no izgleda kockasto</p>\n" 451 "<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>\n" 452 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">UglaÄeno:</span></p>\n" 453 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">GL_LINEAR</span> â brzo na veÄini GPU-ova, no malo je zamagljeno</p>\n" 454 "<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>\n" 455 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Precizno:</span></p>\n" 456 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Filtar Lanczos, treba podrÅ¡ku za sjenÄanje (glsl ili arb).</p>\n" 457 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">MoÅŸe biti sporo na slabijim GPU-ovima ili Äak uzrokovati razne probleme s nevaljalim upravljaÄkim programima (od prejakog osvjetljenja do \"segfaultova\".)</p>\n" 458 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Vratite na \"UglaÄeno\" ako imate problema.</p></body></html>" 538 "</style></head><body style=\" font-family:'Segoe'; font-size:8pt; " 539 "font-weight:400; font-style:normal;\">\n" 540 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 541 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" " 542 "font-weight:600;\">Kruto:</span></p>\n" 543 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 544 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" " 545 "font-style:italic;\">GL_NEAREST</span> â (popriliÄno) brzo na svim " 546 "GPU-ovima, no izgleda kockasto</p>\n" 547 "<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; " 548 "margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>" 549 "\n" 550 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 551 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" " 552 "font-weight:600;\">UglaÄeno:</span></p>\n" 553 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 554 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" " 555 "font-style:italic;\">GL_LINEAR</span> â brzo na veÄini GPU-ova, no malo je " 556 "zamagljeno</p>\n" 557 "<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; " 558 "margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>" 559 "\n" 560 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 561 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" " 562 "font-weight:600;\">Precizno:</span></p>\n" 563 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 564 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Filtar Lanczos, " 565 "treba podrÅ¡ku za sjenÄanje (glsl ili arb).</p>\n" 566 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 567 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\">MoÅŸe biti sporo na " 568 "slabijim GPU-ovima ili Äak uzrokovati razne probleme s nevaljalim " 569 "upravljaÄkim programima (od prejakog osvjetljenja do \"segfaultova\".)</p>\n" 570 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 571 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Vratite na " 572 "\"UglaÄeno\" ako imate problema.</p></body></html>" 459 573 460 574 #. i18n: ectx: property (text), item, widget (QComboBox, glScaleFilter) … … 474 588 #: main.ui:726 475 589 msgid "Suspend desktop effects for fullscreen windows" 476 msgstr "Obustavi efekte radne povrÅ¡ine za prozore rastegnute preko cijelog zaslona" 590 msgstr "" 591 "Obustavi efekte radne povrÅ¡ine za prozore rastegnute preko cijelog zaslona" 477 592 478 593 #. i18n: ectx: property (title), widget (QGroupBox, glGroup) … … 498 613 #: main.ui:798 499 614 msgid "" 500 "If enabled all rendering will be performed with Shaders written in the OpenGL Shading Language.\n" 615 "If enabled all rendering will be performed with Shaders written in the OpenGL " 616 "Shading Language.\n" 501 617 "On legacy hardware disabling Shaders can improve the performance." 502 618 msgstr "" 503 "Ako je omoguÄeno, svo iscrtavanje Äe se izvrÅ¡iti uz SjenÄanje napisano u OpenGL-ovom jeziku za sjenÄanje.\n" 619 "Ako je omoguÄeno, svo iscrtavanje Äe se izvrÅ¡iti uz SjenÄanje napisano u " 620 "OpenGL-ovom jeziku za sjenÄanje.\n" 504 621 " Na starom hardveru onemoguÄavanje SjenÄanja moÅŸe poboljÅ¡ati performanse." 505 622 -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmkwinrules.po
r1123 r1129 7 7 # Andrej DundoviÄ <adundovi@gmail.com>, 2009. 8 8 # Andrej Dundovic <adundovi@gmail.com>, 2010. 9 # Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>, 2011. 9 10 msgid "" 10 11 msgstr "" … … 12 13 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 13 14 "POT-Creation-Date: 2011-07-08 10:22+0200\n" 14 "PO-Revision-Date: 2011-0 3-04 19:01+0100\n"15 "Last-Translator: Marko Dimja sevic<marko@dimjasevic.net>\n"15 "PO-Revision-Date: 2011-07-12 17:36+0200\n" 16 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 16 17 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" 17 18 "MIME-Version: 1.0\n" … … 19 20 "Content-Transfer-Encoding: 8bit\n" 20 21 "Language: hr\n" 21 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 22 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 23 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 22 24 "X-Generator: Lokalize 1.2\n" 23 25 "X-Environment: kde\n" … … 28 30 msgctxt "NAME OF TRANSLATORS" 29 31 msgid "Your names" 30 msgstr "Renato PaviÄiÄ, Åœarko Pintar "32 msgstr "Renato PaviÄiÄ, Åœarko Pintar, Marko DimjaÅ¡eviÄ" 31 33 32 34 #. +> trunk stable 33 35 msgctxt "EMAIL OF TRANSLATORS" 34 36 msgid "Your emails" 35 msgstr "renato@translator-shop.org, zarko.pintar@gmail.com" 37 msgstr "" 38 "renato@translator-shop.org, zarko.pintar@gmail.com, marko@dimjasevic.net" 36 39 37 40 #. i18n: ectx: property (text), item, widget (QListWidget, types) … … 155 158 #. +> trunk stable 156 159 #: detectwidget.ui:175 157 #, fuzzy158 160 msgid "Match Strategy" 159 msgstr " Taktika i strategija"161 msgstr "Strategija podudaranja" 160 162 161 163 #. i18n: ectx: property (whatsThis), widget (QRadioButton, use_class) 162 164 #. +> trunk stable 163 165 #: detectwidget.ui:184 164 msgid "For selecting all windows belonging to a specific application, selecting only window class should usually work." 165 msgstr "Za odabir svih prozora koji pripadaju odreÄenoj aplikaciji, dovoljno je odabrati samo klasu porozora." 166 msgid "" 167 "For selecting all windows belonging to a specific application, selecting only " 168 "window class should usually work." 169 msgstr "" 170 "Za odabir svih prozora koji pripadaju odreÄenoj aplikaciji, dovoljno je " 171 "odabrati samo klasu porozora." 166 172 167 173 #. i18n: ectx: property (text), widget (QRadioButton, use_class) … … 174 180 #. +> trunk stable 175 181 #: detectwidget.ui:197 176 msgid "For selecting a specific window in an application, both window class and window role should be selected. Window class will determine the application, and window role the specific window in the application; many applications do not provide useful window roles though." 177 msgstr "Za odabir odreÄenog prozora unutar aplikacije, i klasa prozora i uloga se trebaju oznaÄiti. Klasa prozora Äe odrediti aplikaciju, a uloga prozora odreÄeni prozor unutar aplikacije; iako mnoge aplikacije ne pruÅŸaju korisne informacije kroz prozorske uloge. " 182 msgid "" 183 "For selecting a specific window in an application, both window class and " 184 "window role should be selected. Window class will determine the application, " 185 "and window role the specific window in the application; many applications do " 186 "not provide useful window roles though." 187 msgstr "" 188 "Za odabir odreÄenog prozora unutar aplikacije, i klasa prozora i uloga se " 189 "trebaju oznaÄiti. Klasa prozora Äe odrediti aplikaciju, a uloga prozora " 190 "odreÄeni prozor unutar aplikacije; iako mnoge aplikacije ne pruÅŸaju korisne " 191 "informacije kroz prozorske uloge. " 178 192 179 193 #. i18n: ectx: property (text), widget (QRadioButton, use_role) … … 186 200 #. +> trunk stable 187 201 #: detectwidget.ui:207 188 msgid "With some (non-KDE) applications whole window class can be sufficient for selecting a specific window in an application, as they set whole window class to contain both application and window role." 189 msgstr "Za neke (ne-KDE) aplikacije cijela klasa prozora moÅŸe biti dovoljna za odabir odreÄenog prozora u aplikaciji, kako je podeÅ¡eno da cijela klasa prozora sadrÅŸi i ulogu aplikacije i prozora." 202 msgid "" 203 "With some (non-KDE) applications whole window class can be sufficient for " 204 "selecting a specific window in an application, as they set whole window class " 205 "to contain both application and window role." 206 msgstr "" 207 "Za neke (ne-KDE) aplikacije cijela klasa prozora moÅŸe biti dovoljna za odabir " 208 "odreÄenog prozora u aplikaciji, kako je podeÅ¡eno da cijela klasa prozora " 209 "sadrÅŸi i ulogu aplikacije i prozora." 190 210 191 211 #. i18n: ectx: property (text), widget (QRadioButton, use_whole_class) … … 205 225 #: editshortcut.ui:18 206 226 msgid "" 207 "A single shortcut can be easily assigned or cleared using the two buttons. Only shortcuts with modifiers can be used.<p>\n" 208 "It is possible to have several possible shortcuts, and the first available shortcut will be used. The shortcuts are specified using space-separated shortcut sets. One set is specified as <i>base</i>+(<i>list</i>), where base are modifiers and list is a list of keys.<br>\n" 209 "For example \"<b>Shift+Alt+(123) Shift+Ctrl+(ABC)</b>\" will first try <b>Shift+Alt+1</b>, then others with <b>Shift+Ctrl+C</b> as the last one." 210 msgstr "" 211 "Pojedini preÄac moÅŸe se jednostavno pridruÅŸiti ili izbrisati koristeÄi dva gumba. Mogu se koristit samo preÄaci sa modifikatorima.<p>\n" 212 "MoguÄe je imati nekoliko preÄaca, a koristiti prvi slobodni preÄac. PreÄaci koriste posebni razmakno-separatorski skup. Jedan skup je odreÄen kao <i>base</i>+(<i>list</i>), gdje su 'base' modifikatori, a 'list' lista tipki.<br>\n" 213 "Na primjer \"<b>Shift+Alt+(123) Shift+Ctrl+(ABC)</b>\" Äe prvo pokuÅ¡ati <b>Shift+Alt+1</b>, a tada ostale sa <b>Shift+Ctrl+C</b> kao zadnjim." 227 "A single shortcut can be easily assigned or cleared using the two buttons. " 228 "Only shortcuts with modifiers can be used.<p>\n" 229 "It is possible to have several possible shortcuts, and the first available " 230 "shortcut will be used. The shortcuts are specified using space-separated " 231 "shortcut sets. One set is specified as <i>base</i>+(<i>list</i>), where base " 232 "are modifiers and list is a list of keys.<br>\n" 233 "For example \"<b>Shift+Alt+(123) Shift+Ctrl+(ABC)</b>\" will first try <b>" 234 "Shift+Alt+1</b>, then others with <b>Shift+Ctrl+C</b> as the last one." 235 msgstr "" 236 "Pojedini preÄac moÅŸe se jednostavno pridruÅŸiti ili izbrisati koristeÄi dva " 237 "gumba. Mogu se koristit samo preÄaci sa modifikatorima.<p>\n" 238 "MoguÄe je imati nekoliko preÄaca, a koristiti prvi slobodni preÄac. PreÄaci " 239 "koriste posebni razmakno-separatorski skup. Jedan skup je odreÄen kao <i>" 240 "base</i>+(<i>list</i>), gdje su 'base' modifikatori, a 'list' lista tipki.<br>" 241 "\n" 242 "Na primjer \"<b>Shift+Alt+(123) Shift+Ctrl+(ABC)</b>\" Äe prvo pokuÅ¡ati <b>" 243 "Shift+Alt+1</b>, a tada ostale sa <b>Shift+Ctrl+C</b> kao zadnjim." 214 244 215 245 #. i18n: ectx: property (text), widget (QPushButton, pushButton1) … … 247 277 #. +> trunk stable 248 278 #: kcm.cpp:86 249 msgid "<p><h1>Window-specific Settings</h1> Here you can customize window settings specifically only for some windows.</p> <p>Please note that this configuration will not take effect if you do not use KWin as your window manager. If you do use a different window manager, please refer to its documentation for how to customize window behavior.</p>" 250 msgstr "<p><h1>Prozorski-posebne postavke</h1> Ovdje moÅŸete prilagoditi postavke prozora posebno za neki prozor.</p> <p>Imajte na umu da ova konfiguracija nema efekta ako ne koristite KWin kao vaÅ¡ upravitelj prozorima. Ako koristite drugi upravitelj prozorima, onda konzultirajte njegovu dokumentaciju kako prilagoditi ponaÅ¡anje prozora</p>" 279 msgid "" 280 "<p><h1>Window-specific Settings</h1> Here you can customize window settings " 281 "specifically only for some windows.</p> <p>Please note that this " 282 "configuration will not take effect if you do not use KWin as your window " 283 "manager. If you do use a different window manager, please refer to its " 284 "documentation for how to customize window behavior.</p>" 285 msgstr "" 286 "<p><h1>Prozorski-posebne postavke</h1> Ovdje moÅŸete prilagoditi postavke " 287 "prozora posebno za neki prozor.</p> <p>Imajte na umu da ova konfiguracija " 288 "nema efekta ako ne koristite KWin kao vaÅ¡ upravitelj prozorima. Ako koristite " 289 "drugi upravitelj prozorima, onda konzultirajte njegovu dokumentaciju kako " 290 "prilagoditi ponaÅ¡anje prozora</p>" 251 291 252 292 #. +> trunk stable … … 304 344 #. +> trunk stable 305 345 #: ruleslist.cpp:155 306 #, fuzzy307 346 msgid "Export Rule" 308 msgstr "Izvezi rutu"347 msgstr "Izvezi pravilo" 309 348 310 349 #. +> trunk stable 311 350 #: ruleslist.cpp:166 312 #, fuzzy313 351 msgid "Import Rules" 314 msgstr " Stil ruba okvira"352 msgstr "Uvezi pravila" 315 353 316 354 #. i18n: ectx: property (text), widget (KPushButton, new_button) … … 347 385 #. +> trunk stable 348 386 #: ruleslist.ui:91 349 #, fuzzy350 387 msgid "&Import" 351 388 msgstr "&Uvoz" … … 354 391 #. +> trunk stable 355 392 #: ruleslist.ui:98 356 #, fuzzy357 393 msgid "&Export" 358 394 msgstr "&Izvoz" … … 360 396 #. +> trunk stable 361 397 #: ruleswidget.cpp:57 362 msgid "Enable this checkbox to alter this window property for the specified window(s)." 363 msgstr "OmoguÄi ovaj odabirni okvir kako bi promijenili svojstva odreÄenih prozora sa svojstvima ovog prozora." 398 msgid "" 399 "Enable this checkbox to alter this window property for the specified " 400 "window(s)." 401 msgstr "" 402 "OmoguÄi ovaj odabirni okvir kako bi promijenili svojstva odreÄenih prozora sa " 403 "svojstvima ovog prozora." 364 404 365 405 #. +> trunk stable 366 406 #: ruleswidget.cpp:59 367 msgid "Specify how the window property should be affected:<ul><li><em>Do Not Affect:</em> The window property will not be affected and therefore the default handling for it will be used. Specifying this will block more generic window settings from taking effect.</li><li><em>Apply Initially:</em> The window property will be only set to the given value after the window is created. No further changes will be affected.</li><li><em>Remember:</em> The value of the window property will be remembered and every time time the window is created, the last remembered value will be applied.</li><li><em>Force:</em> The window property will be always forced to the given value.</li><li><em>Apply Now:</em> The window property will be set to the given value immediately and will not be affected later (this action will be deleted afterwards).</li><li><em>Force temporarily:</em> The window property will be forced to the given value until it is hidden (this action will be deleted after the window is hidden).</li></ul>" 368 msgstr "Odredite kakav Äe imati utjecaj prozorske osobitosti:<ul><li><em>Bez utjecaja:</em> Prozorske osobitosti neÄe imati utjecaja i biti Äe koriÅ¡teno zadano rukovanje. Ovo Äe blokirati mnoge opÄenite postavke prozora.</li><li><em>Primijeni na poÄetku:</em> Prozorske osobitosti Äe biti postavljene na odreÄenu vrijednost samo pri stvaranju prozora. BuduÄe promjene neÄe imati utjecaja.</li><li><em>Zapamti:</em> Vrijednost prozorske osobitosti biti Äe zapamÄena i svaki puta kada se prozor stvori, biti Äe primjenjena zadnja zapamÄena vrijednost.</li><li><em>Prisilno:</em> Prozorska osobitost biti Äe uvijek prisilno postavljena na zadanu vrijednost.</li><li><em>Primjeni sada:</em> Prozorska osobitost biti Äe odmah postavljena na zadanu vrijednost i neÄe imati utjecaja kasnije (akcija Äe biti izbrisana).</li><li><em>Privremeno prisilno:</em> Prozorska osobitost biti Äe prisilno postavljena na zadanu vrijednost sve dok nije sakrivena (ova akcija biti Äe izbrisana nakon Å¡to se prozor sakrije).</li></ul>" 407 msgid "" 408 "Specify how the window property should be affected:<ul><li><em>Do Not " 409 "Affect:</em> The window property will not be affected and therefore the " 410 "default handling for it will be used. Specifying this will block more generic " 411 "window settings from taking effect.</li><li><em>Apply Initially:</em> The " 412 "window property will be only set to the given value after the window is " 413 "created. No further changes will be affected.</li><li><em>Remember:</em> The " 414 "value of the window property will be remembered and every time time the " 415 "window is created, the last remembered value will be applied.</li><li><em>" 416 "Force:</em> The window property will be always forced to the given value.</li>" 417 "<li><em>Apply Now:</em> The window property will be set to the given value " 418 "immediately and will not be affected later (this action will be deleted " 419 "afterwards).</li><li><em>Force temporarily:</em> The window property will be " 420 "forced to the given value until it is hidden (this action will be deleted " 421 "after the window is hidden).</li></ul>" 422 msgstr "" 423 "Odredite kakav Äe imati utjecaj prozorske osobitosti:<ul><li><em>Bez " 424 "utjecaja:</em> Prozorske osobitosti neÄe imati utjecaja i biti Äe koriÅ¡teno " 425 "zadano rukovanje. Ovo Äe blokirati mnoge opÄenite postavke prozora.</li><li><" 426 "em>Primijeni na poÄetku:</em> Prozorske osobitosti Äe biti postavljene na " 427 "odreÄenu vrijednost samo pri stvaranju prozora. BuduÄe promjene neÄe imati " 428 "utjecaja.</li><li><em>Zapamti:</em> Vrijednost prozorske osobitosti biti Äe " 429 "zapamÄena i svaki puta kada se prozor stvori, biti Äe primjenjena zadnja " 430 "zapamÄena vrijednost.</li><li><em>Prisilno:</em> Prozorska osobitost biti Äe " 431 "uvijek prisilno postavljena na zadanu vrijednost.</li><li><em>Primjeni sada:<" 432 "/em> Prozorska osobitost biti Äe odmah postavljena na zadanu vrijednost i " 433 "neÄe imati utjecaja kasnije (akcija Äe biti izbrisana).</li><li><em>" 434 "Privremeno prisilno:</em> Prozorska osobitost biti Äe prisilno postavljena na " 435 "zadanu vrijednost sve dok nije sakrivena (ova akcija biti Äe izbrisana nakon " 436 "Å¡to se prozor sakrije).</li></ul>" 369 437 370 438 #. +> trunk stable 371 439 #: ruleswidget.cpp:74 372 msgid "Specify how the window property should be affected:<ul><li><em>Do Not Affect:</em> The window property will not be affected and therefore the default handling for it will be used. Specifying this will block more generic window settings from taking effect.</li><li><em>Force:</em> The window property will be always forced to the given value.</li><li><em>Force temporarily:</em> The window property will be forced to the given value until it is hidden (this action will be deleted after the window is hidden).</li></ul>" 373 msgstr "Odredite kakav Äe imati utjecaj prozorske osobitosti:<ul><li><em>Bez utjecaja:</em> Prozorske osobitosti neÄe imati utjecaja i biti Äe koriÅ¡teno zadano rukovanje. Ovo Äe blokirati mnoge opÄenite postavke prozora.</li><li><em>Prisilno:</em> Prozorska osobitost biti Äe uvijek prisilno postavljena na zadanu vrijednost.</li><li><em>Privremeno prisilno:</em> Prozorska osobitost biti Äe prisilno postavljena na zadanu vrijednost sve dok nije sakrivena (ova akcija biti Äe izbrisana nakon Å¡to se prozor sakrije).</li></ul>" 440 msgid "" 441 "Specify how the window property should be affected:<ul><li><em>Do Not " 442 "Affect:</em> The window property will not be affected and therefore the " 443 "default handling for it will be used. Specifying this will block more generic " 444 "window settings from taking effect.</li><li><em>Force:</em> The window " 445 "property will be always forced to the given value.</li><li><em>Force " 446 "temporarily:</em> The window property will be forced to the given value until " 447 "it is hidden (this action will be deleted after the window is hidden).</li><" 448 "/ul>" 449 msgstr "" 450 "Odredite kakav Äe imati utjecaj prozorske osobitosti:<ul><li><em>Bez " 451 "utjecaja:</em> Prozorske osobitosti neÄe imati utjecaja i biti Äe koriÅ¡teno " 452 "zadano rukovanje. Ovo Äe blokirati mnoge opÄenite postavke prozora.</li><li><" 453 "em>Prisilno:</em> Prozorska osobitost biti Äe uvijek prisilno postavljena na " 454 "zadanu vrijednost.</li><li><em>Privremeno prisilno:</em> Prozorska osobitost " 455 "biti Äe prisilno postavljena na zadanu vrijednost sve dok nije sakrivena (ova " 456 "akcija biti Äe izbrisana nakon Å¡to se prozor sakrije).</li></ul>" 374 457 375 458 #. +> trunk stable … … 396 479 msgid "" 397 480 "You have specified the window class as unimportant.\n" 398 "This means the settings will possibly apply to windows from all applications. If you really want to create a generic setting, it is recommended you at least limit the window types to avoid special window types." 481 "This means the settings will possibly apply to windows from all applications. " 482 "If you really want to create a generic setting, it is recommended you at " 483 "least limit the window types to avoid special window types." 399 484 msgstr "" 400 485 "Odredili ste klasu prozora kao nevaÅŸnu.\n" 401 "To znaÄi da je moguÄe da Äe se primjeniti postavke prozora iz svih aplikacija. Ako zaista ÅŸelite stvoriti opÄenite postavke, preporuÄamo vam da barem ograniÄite tipove prozora kako bi izbjegli posebne tipove." 486 "To znaÄi da je moguÄe da Äe se primjeniti postavke prozora iz svih aplikacija." 487 " Ako zaista ÅŸelite stvoriti opÄenite postavke, preporuÄamo vam da barem " 488 "ograniÄite tipove prozora kako bi izbjegli posebne tipove." 402 489 403 490 #. +> trunk stable … … 408 495 #. +> trunk stable 409 496 #: ruleswidget.cpp:743 410 msgid "This configuration dialog allows altering settings only for the selected window or application. Find the setting you want to affect, enable the setting using the checkbox, select in what way the setting should be affected and to which value." 411 msgstr "Ovaj konfiguracijski dijalog dopuÅ¡ta vam promjenu postavki samo za odabraog prozora ili aplikacije. PronaÄite postavku koju ÅŸelite promijeniti, omoguÄite postavku preko odabirnog okvira, odredite na koji naÄin Äe postavka viti primjenjena i na koju vrijednost." 497 msgid "" 498 "This configuration dialog allows altering settings only for the selected " 499 "window or application. Find the setting you want to affect, enable the " 500 "setting using the checkbox, select in what way the setting should be affected " 501 "and to which value." 502 msgstr "" 503 "Ovaj konfiguracijski dijalog dopuÅ¡ta vam promjenu postavki samo za odabraog " 504 "prozora ili aplikacije. PronaÄite postavku koju ÅŸelite promijeniti, omoguÄite " 505 "postavku preko odabirnog okvira, odredite na koji naÄin Äe postavka viti " 506 "primjenjena i na koju vrijednost." 412 507 413 508 #. +> trunk stable … … 424 519 #. +> trunk stable 425 520 #: ruleswidgetbase.ui:21 426 #, fuzzy427 521 msgid "&Window matching" 428 msgstr "P rebacivanje prozora"522 msgstr "P&rozor kojem se podudara" 429 523 430 524 #. i18n: ectx: property (text), widget (QLabel, textLabel1) … … 437 531 #. +> trunk stable 438 532 #: ruleswidgetbase.ui:46 439 #, fuzzy440 533 #| msgid "Window &class (application type):" 441 534 msgid "Window &class (application):" 442 msgstr " &Klasa prozora (tip aplikacije):"535 msgstr "Klasa prozora (aplika&cija):" 443 536 444 537 #. i18n: ectx: property (text), item, widget (KComboBox, wmclass_match) … … 536 629 #. +> trunk stable 537 630 #: ruleswidgetbase.ui:381 538 #, fuzzy539 631 msgid "s delay" 540 msgstr " Bez odgode"632 msgstr "s-zadrÅ¡ka" 541 633 542 634 #. i18n: ectx: property (text), item, widget (QListWidget, types) 543 635 #. +> trunk stable 544 636 #: ruleswidgetbase.ui:524 545 #, fuzzy546 637 msgid "Unmanaged Window" 547 msgstr " Nije pod kontrolom upravitelja mreÅŸe"638 msgstr "Slobodan prozor" 548 639 549 640 #. i18n: ectx: attribute (title), widget (QWidget, TabPage3) 550 641 #. +> trunk stable 551 642 #: ruleswidgetbase.ui:545 552 #, fuzzy553 643 msgid "&Size && Position" 554 msgstr " PoloÅŸaj teksta"644 msgstr "&VeliÄina && poloÅŸaj" 555 645 556 646 #. i18n: ectx: property (text), widget (QCheckBox, enable_position) … … 780 870 #: ruleswidgetbase.ui:598 781 871 msgid "x,y" 782 msgstr " "872 msgstr "x,y" 783 873 784 874 #. i18n: ectx: property (validChars), widget (KRestrictedLine, position) … … 803 893 #. +> trunk stable 804 894 #: ruleswidgetbase.ui:655 ruleswidgetbase.ui:1058 ruleswidgetbase.ui:1205 805 #, fuzzy806 895 msgid "width,height" 807 msgstr " visina"896 msgstr "Å¡irina,visina" 808 897 809 898 #. i18n: ectx: property (text), widget (QCheckBox, enable_maximizehoriz) … … 846 935 #. +> trunk stable 847 936 #: ruleswidgetbase.ui:891 848 #, fuzzy849 937 msgid "Initial p&lacement" 850 msgstr "PoÄetn a koliÄina"938 msgstr "PoÄetni po&loÅŸaj" 851 939 852 940 #. i18n: ectx: property (text), item, widget (KComboBox, placement) … … 952 1040 #. +> trunk stable 953 1041 #: ruleswidgetbase.ui:1280 954 #, fuzzy955 1042 msgid "Obey geometry restrictions" 956 msgstr " Makni filter"1043 msgstr "Strogo prati geometrijska ograniÄenja" 957 1044 958 1045 #. i18n: ectx: attribute (title), widget (QWidget, TabPage4) 959 1046 #. +> trunk stable 960 1047 #: ruleswidgetbase.ui:1313 961 #, fuzzy962 1048 msgid "&Arrangement && Access" 963 msgstr "R azmjeÅ¡taj"1049 msgstr "R&azmjeÅ¡taj && pristup" 964 1050 965 1051 #. i18n: ectx: property (text), widget (QCheckBox, enable_above) … … 1014 1100 #. +> trunk stable 1015 1101 #: ruleswidgetbase.ui:1606 1016 #, fuzzy1017 1102 msgid "Window shall (not) appear in the taskbar." 1018 msgstr "Prozor se neÄe pojaviti na traci sa zadacima"1103 msgstr "Prozor se (ne) smije pojaviti u traci sa zadacima." 1019 1104 1020 1105 #. i18n: ectx: property (text), widget (QCheckBox, enable_skiptaskbar) … … 1029 1114 msgid "Window shall (not) appear in the manager for virtual desktops" 1030 1115 msgstr "" 1116 "Prozor se (ne) smije pojaviti u upravitelju za virtualne radne povrÅ¡ine" 1031 1117 1032 1118 #. i18n: ectx: property (text), widget (QCheckBox, enable_skippager) … … 1040 1126 #: ruleswidgetbase.ui:1707 1041 1127 msgid "Window shall (not) appear in the Alt+Tab list" 1042 msgstr " "1128 msgstr "Prozor se (ne) smije pojaviti u listi Alt+Tab" 1043 1129 1044 1130 #. i18n: ectx: property (text), widget (QCheckBox, enable_skipswitcher) … … 1063 1149 #. +> trunk stable 1064 1150 #: ruleswidgetbase.ui:1907 1065 #, fuzzy1066 1151 msgid "Appearance && &Fixes" 1067 msgstr " Vrijeme pojavljivanja:"1152 msgstr "Izgled && &popravci" 1068 1153 1069 1154 #. i18n: ectx: property (text), widget (QCheckBox, enable_noborder) 1070 1155 #. +> trunk stable 1071 1156 #: ruleswidgetbase.ui:1913 1072 #, fuzzy1073 1157 msgid "&No titlebar and frame" 1074 msgstr " Naslovna traka i okvir"1158 msgstr "Bez &naslovne trake i okvira" 1075 1159 1076 1160 #. i18n: ectx: property (text), widget (QCheckBox, enable_opacityactive) 1077 1161 #. +> trunk stable 1078 1162 #: ruleswidgetbase.ui:1964 1079 #, fuzzy1080 1163 #| msgid "A&ctive opacity in %" 1081 1164 msgid "A&ctive opacity" 1082 msgstr "A&ktivna neprozirnost u %"1165 msgstr "A&ktivna neprozirnost" 1083 1166 1084 1167 #. i18n: ectx: property (suffix), widget (QSpinBox, opacityactive) … … 1086 1169 #. +> trunk stable 1087 1170 #: ruleswidgetbase.ui:1996 ruleswidgetbase.ui:2041 1088 #, fuzzy,no-c-format1171 #, no-c-format 1089 1172 msgid "%" 1090 1173 msgstr "%" … … 1093 1176 #. +> trunk stable 1094 1177 #: ruleswidgetbase.ui:2009 1095 #, fuzzy1096 1178 #| msgid "I&nactive opacity in %" 1097 1179 msgid "I&nactive opacity" 1098 msgstr "&Neaktivna neprozirnost u %"1180 msgstr "&Neaktivna neprozirnost" 1099 1181 1100 1182 #. i18n: ectx: property (text), widget (QCheckBox, enable_moveresizemode) … … 1136 1218 #. +> trunk stable 1137 1219 #: ruleswidgetbase.ui:2148 1138 #, fuzzy1139 1220 #| msgid "Block global shortcuts" 1140 1221 msgid "Ignore global shortcuts" 1141 msgstr " Blokiraj opÄe preÄace"1222 msgstr "Ignoriraj globalne preÄace" 1142 1223 1143 1224 #. i18n: ectx: property (text), widget (QCheckBox, enable_closeable) -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmlocale.po
r1124 r1129 13 13 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 14 14 "POT-Creation-Date: 2011-07-10 07:56+0200\n" 15 "PO-Revision-Date: 2011-0 5-03 01:03+0200\n"15 "PO-Revision-Date: 2011-07-12 17:05+0200\n" 16 16 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 17 17 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" … … 20 20 "Content-Transfer-Encoding: 8bit\n" 21 21 "Language: hr\n" 22 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 22 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 23 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 23 24 "X-Generator: Lokalize 1.2\n" 24 25 "X-Environment: kde\n" … … 29 30 msgctxt "NAME OF TRANSLATORS" 30 31 msgid "Your names" 31 msgstr "Dario Lah, Denis Lackovic, Vlatko Kosturjak, Oliver Mucafir, Andrej DundoviÄ, Marko DimjaÅ¡eviÄ" 32 msgstr "" 33 "Dario Lah, Denis Lackovic, Vlatko Kosturjak, Oliver Mucafir, Andrej DundoviÄ, " 34 "Marko DimjaÅ¡eviÄ" 32 35 33 36 #. +> trunk stable 34 37 msgctxt "EMAIL OF TRANSLATORS" 35 38 msgid "Your emails" 36 msgstr "lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, oliver.untwist@gmail.com, adundovi@gmail.com, marko@dimjasevic.net" 39 msgstr "" 40 "lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, oliver." 41 "untwist@gmail.com, adundovi@gmail.com, marko@dimjasevic.net" 37 42 38 43 #. +> trunk stable … … 75 80 #: kcmlocale.cpp:462 76 81 #, kde-format 77 msgid "You have the language with code '%1' in your list of languages to use for translation but the localization files for it could not be found. The language has been removed from your configuration. If you want to add it again please install the localization files for it and add the language again." 78 msgstr "U VaÅ¡oj listi jezika za prijevod imate jezik s kÃŽdom '%1', no nije moguÄe pronaÄi lokalizacijske datoteke za dotiÄni jezik. Taj je jezik uklonjen iz VaÅ¡e konfiguracije. Ako ga ÅŸelite ponovno dodati, instalirajte lokalizacijske datoteke za taj jezik i ponovno ga dodajte." 82 msgid "" 83 "You have the language with code '%1' in your list of languages to use for " 84 "translation but the localization files for it could not be found. The " 85 "language has been removed from your configuration. If you want to add it " 86 "again please install the localization files for it and add the language again." 87 msgstr "" 88 "U VaÅ¡oj listi jezika za prijevod imate jezik s kÃŽdom '%1', no nije moguÄe " 89 "pronaÄi lokalizacijske datoteke za dotiÄni jezik. Taj je jezik uklonjen iz " 90 "VaÅ¡e konfiguracije. Ako ga ÅŸelite ponovno dodati, instalirajte lokalizacijske " 91 "datoteke za taj jezik i ponovno ga dodajte." 79 92 80 93 #. +> trunk stable … … 84 97 "To change the language of all programs, you will have to logout first." 85 98 msgstr "" 86 "Promijenjene jeziÄne postavke primijenjuju se samo na novo pokrenute aplikacije.\n" 99 "Promijenjene jeziÄne postavke primijenjuju se samo na novo pokrenute " 100 "aplikacije.\n" 87 101 "Ako ÅŸelite promijeniti jezik u svim programima morate se prvo odjaviti." 88 102 … … 96 110 msgid "" 97 111 "<h1>Country/Region & Language</h1>\n" 98 "<p>Here you can set your localization settings such as language, numeric formats, date and time formats, etc. Choosing a country will load a set of default formats which you can then change to your personal preferences. These personal preferences will remain set even if you change the country. The reset buttons allow you to easily see where you have personal settings and to restore those items to the country's default value.</p>" 112 "<p>Here you can set your localization settings such as language, numeric " 113 "formats, date and time formats, etc. Choosing a country will load a set of " 114 "default formats which you can then change to your personal preferences. " 115 "These personal preferences will remain set even if you change the country. " 116 "The reset buttons allow you to easily see where you have personal settings " 117 "and to restore those items to the country's default value.</p>" 99 118 msgstr "" 100 119 "<h1>Zemlja i jezik</h1>\n" 101 "<p>Ovdje moÅŸete postaviti vaÅ¡e lokalizacijske postavke kao Å¡to su jezik, brojÄani formati, formati datuma i vremena itd. Odabir zemlje Äe uÄitati skup zadanih formata koje moÅŸete prilagoditi vlastitim ÅŸeljama i one Äe biti zapamÄene i kad promijenite zemlju. Gumbi za povratak na uobiÄajeno omoguÄuju Vam da lako uoÄite gdje imate prilagoÄene postavke i da ih vratite na zadane vrijednosti za odreÄenu zemlju.</p>" 120 "<p>Ovdje moÅŸete postaviti vaÅ¡e lokalizacijske postavke kao Å¡to su jezik, " 121 "brojÄani formati, formati datuma i vremena itd. Odabir zemlje Äe uÄitati skup " 122 "zadanih formata koje moÅŸete prilagoditi vlastitim ÅŸeljama i one Äe biti " 123 "zapamÄene i kad promijenite zemlju. Gumbi za povratak na uobiÄajeno omoguÄuju " 124 "Vam da lako uoÄite gdje imate prilagoÄene postavke i da ih vratite na zadane " 125 "vrijednosti za odreÄenu zemlju.</p>" 102 126 103 127 #. +> trunk stable … … 233 257 #. +> trunk stable 234 258 #: kcmlocale.cpp:1072 235 msgid "<p>This is the country where you live. The KDE Workspace will use the settings for this country or region.</p>" 236 msgstr "<p>Ovo je drÅŸava u kojoj ÅŸivite. KDE-ov radni prostor Äe koristiti postavke za ovu drÅŸavu ili regiju.</p>" 259 msgid "" 260 "<p>This is the country where you live. The KDE Workspace will use the " 261 "settings for this country or region.</p>" 262 msgstr "" 263 "<p>Ovo je drÅŸava u kojoj ÅŸivite. KDE-ov radni prostor Äe koristiti postavke " 264 "za ovu drÅŸavu ili regiju.</p>" 237 265 238 266 #. +> trunk stable … … 256 284 #. +> trunk stable 257 285 #: kcmlocale.cpp:1132 258 msgid "<p>This is the country subdivision where you live, e.g. your state or province. The KDE Workspace will use this setting for local information services such as holidays.</p>" 259 msgstr "<p>Ovo je podrazred drÅŸava gdje ÅŸivite, npr. savezna drÅŸava ili pokrajina. KDE-ov radni prostor Äe koristiti ove postavke za servise za lokalne informacije kao Å¡to su praznici.</p>" 286 msgid "" 287 "<p>This is the country subdivision where you live, e.g. your state or " 288 "province. The KDE Workspace will use this setting for local information " 289 "services such as holidays.</p>" 290 msgstr "" 291 "<p>Ovo je podrazred drÅŸava gdje ÅŸivite, npr. savezna drÅŸava ili pokrajina. " 292 "KDE-ov radni prostor Äe koristiti ove postavke za servise za lokalne " 293 "informacije kao Å¡to su praznici.</p>" 260 294 261 295 #. i18n: ectx: property (availableLabel), widget (KActionSelector, m_selectTranslations) … … 267 301 #. +> trunk stable 268 302 #: kcmlocale.cpp:1170 269 msgid "<p>This is the list of installed KDE Workspace language translations not currently being used. To use a language translation move it to the 'Preferred Languages' list in the order of preference. If no suitable languages are listed, then you may need to install more language packages using your usual installation method.</p>" 270 msgstr "<p>Ovo je lista instaliranih prijevoda KDE-ovog radnog prostora koji se trenutno ne koriste. Kako biste koristili neki jezik, premjestite ga u listu 'Preferirani jezici' na ÅŸeljeno mjesto. Ako nije naveden ni jedan Vama prikladan jezik, moÅŸda Äete trebati instalirati dodatne jeziÄne pakete koristeÄi uobiÄajeni instalacijski postupak.</p>" 303 msgid "" 304 "<p>This is the list of installed KDE Workspace language translations not " 305 "currently being used. To use a language translation move it to the " 306 "'Preferred Languages' list in the order of preference. If no suitable " 307 "languages are listed, then you may need to install more language packages " 308 "using your usual installation method.</p>" 309 msgstr "" 310 "<p>Ovo je lista instaliranih prijevoda KDE-ovog radnog prostora koji se " 311 "trenutno ne koriste. Kako biste koristili neki jezik, premjestite ga u listu " 312 "'Preferirani jezici' na ÅŸeljeno mjesto. Ako nije naveden ni jedan Vama " 313 "prikladan jezik, moÅŸda Äete trebati instalirati dodatne jeziÄne pakete " 314 "koristeÄi uobiÄajeni instalacijski postupak.</p>" 271 315 272 316 #. i18n: ectx: property (selectedLabel), widget (KActionSelector, m_selectTranslations) … … 278 322 #. +> trunk stable 279 323 #: kcmlocale.cpp:1180 280 msgid "<p>This is the list of installed KDE Workspace language translations currently being used, listed in order of preference. If a translation is not available for the first language in the list, the next language will be used. If no other translations are available then US English will be used.</p>" 281 msgstr "<p>Ovo je lista instaliranih prijevoda KDE-ovog radnog prostora koji se trenutno koriste, navedenih ÅŸeljenim redoslijedom. Ako nije dostupan prijevod za prvi jezik u listi, koristit Äe se sljedeÄi jezik. Ako nije dostupan ni jedan drugi prijevod, koristit Äe se ameriÄki engleski.</p>" 324 msgid "" 325 "<p>This is the list of installed KDE Workspace language translations " 326 "currently being used, listed in order of preference. If a translation is not " 327 "available for the first language in the list, the next language will be used. " 328 " If no other translations are available then US English will be used.</p>" 329 msgstr "" 330 "<p>Ovo je lista instaliranih prijevoda KDE-ovog radnog prostora koji se " 331 "trenutno koriste, navedenih ÅŸeljenim redoslijedom. Ako nije dostupan prijevod " 332 "za prvi jezik u listi, koristit Äe se sljedeÄi jezik. Ako nije dostupan ni " 333 "jedan drugi prijevod, koristit Äe se ameriÄki engleski.</p>" 282 334 283 335 #. +> trunk stable … … 304 356 #: kcmlocale.cpp:1300 kcmlocale.cpp:1754 kcmlocalewidget.ui:163 305 357 #: kcmlocalewidget.ui:524 306 #, fuzzy307 358 msgid "Digit grouping:" 308 msgstr " svetlosna grupa"359 msgstr "Grupiranje znamenki:" 309 360 310 361 #. +> trunk stable … … 312 363 #, fuzzy 313 364 #| msgid "<p>Here you can define the digit group separator used to display numbers.</p><p>Note that the digit group separator used to display monetary values has to be set separately (see the 'Money' tab).</p>" 314 msgid "<p>Here you can define the digit grouping used to display numbers.</p><p>Note that the digit grouping used to display monetary values has to be set separately (see the 'Money' tab).</p>" 315 msgstr "<p>Ovdje moÅŸete odrediti razdjelnicu grupa znamenki za prikaz brojeva.</p><p>Primijetite da razdjelnik grupa znamenki za prikaz novÄanih vrijednosti treba podesiti posebno (vidjeti karticu 'Novac').</p>" 365 msgid "" 366 "<p>Here you can define the digit grouping used to display numbers.</p><p>Note " 367 "that the digit grouping used to display monetary values has to be set " 368 "separately (see the 'Money' tab).</p>" 369 msgstr "" 370 "<p>Ovdje moÅŸete odrediti razdjelnicu grupa znamenki za prikaz brojeva.</p><p>" 371 "Primijetite da razdjelnik grupa znamenki za prikaz novÄanih vrijednosti treba " 372 "podesiti posebno (vidjeti karticu 'Novac').</p>" 316 373 317 374 #. i18n: ectx: property (text), widget (QLabel, m_labelThousandsSeparator) … … 325 382 #. +> trunk stable 326 383 #: kcmlocale.cpp:1339 327 msgid "<p>Here you can define the digit group separator used to display numbers.</p><p>Note that the digit group separator used to display monetary values has to be set separately (see the 'Money' tab).</p>" 328 msgstr "<p>Ovdje moÅŸete odrediti razdjelnicu grupa znamenki za prikaz brojeva.</p><p>Primijetite da razdjelnik grupa znamenki za prikaz novÄanih vrijednosti treba podesiti posebno (vidjeti karticu 'Novac').</p>" 384 msgid "" 385 "<p>Here you can define the digit group separator used to display numbers.</p>" 386 "<p>Note that the digit group separator used to display monetary values has to " 387 "be set separately (see the 'Money' tab).</p>" 388 msgstr "" 389 "<p>Ovdje moÅŸete odrediti razdjelnicu grupa znamenki za prikaz brojeva.</p><p>" 390 "Primijetite da razdjelnik grupa znamenki za prikaz novÄanih vrijednosti treba " 391 "podesiti posebno (vidjeti karticu 'Novac').</p>" 329 392 330 393 #. i18n: ectx: property (text), widget (QLabel, m_labelDecimalSymbol) … … 338 401 #. +> trunk stable 339 402 #: kcmlocale.cpp:1396 340 msgid "<p>Here you can define the decimal separator used to display numbers (i.e. a dot or a comma in most countries).</p><p>Note that the decimal separator used to display monetary values has to be set separately (see the 'Money' tab).</p>" 341 msgstr "<p>Ovdje moÅŸete odrediti decimalnu razdjelnicu za prikaz brojeva (toÄka ili zarez u mnogim zemljama).</p><p>Primijetite da decimalna razdjelnica za prikaz novÄanih vrijednosti valja definirati posebno (vidjeti karticu 'Novac').</p>" 403 msgid "" 404 "<p>Here you can define the decimal separator used to display numbers (i.e. a " 405 "dot or a comma in most countries).</p><p>Note that the decimal separator used " 406 "to display monetary values has to be set separately (see the 'Money' tab).</p>" 407 msgstr "" 408 "<p>Ovdje moÅŸete odrediti decimalnu razdjelnicu za prikaz brojeva (toÄka ili " 409 "zarez u mnogim zemljama).</p><p>Primijetite da decimalna razdjelnica za " 410 "prikaz novÄanih vrijednosti valja definirati posebno (vidjeti karticu " 411 "'Novac').</p>" 342 412 343 413 #. i18n: ectx: property (text), widget (QLabel, m_labelDecimalPlaces) … … 351 421 #. +> trunk stable 352 422 #: kcmlocale.cpp:1447 353 msgid "<p>Here you can set the number of decimal places displayed for numeric values, i.e. the number of digits <em>after</em> the decimal separator.</p><p>Note that the decimal places used to display monetary values has to be set separately (see the 'Money' tab).</p>" 354 msgstr "<p>Ovdje moÅŸete postaviti broj decimalnih mjesta za prikaz brojÄanih vrijednosti, odnosno broj znamenki <em>nakon</em> decimalne razdjelnice.</p><p>Primijetite da decimalna mjesta za prikaz novÄanih vrijednosti valja podesiti posebno (vidjeti karticu 'Novac').</p>" 423 msgid "" 424 "<p>Here you can set the number of decimal places displayed for numeric " 425 "values, i.e. the number of digits <em>after</em> the decimal separator.</p><p>" 426 "Note that the decimal places used to display monetary values has to be set " 427 "separately (see the 'Money' tab).</p>" 428 msgstr "" 429 "<p>Ovdje moÅŸete postaviti broj decimalnih mjesta za prikaz brojÄanih " 430 "vrijednosti, odnosno broj znamenki <em>nakon</em> decimalne razdjelnice.</p><" 431 "p>Primijetite da decimalna mjesta za prikaz novÄanih vrijednosti valja " 432 "podesiti posebno (vidjeti karticu 'Novac').</p>" 355 433 356 434 #. i18n: ectx: property (text), widget (QLabel, m_labelPositiveFormat) … … 362 440 #. +> trunk stable 363 441 #: kcmlocale.cpp:1485 364 msgid "<p>Here you can specify text used to prefix positive numbers. Most locales leave this blank.</p><p>Note that the positive sign used to display monetary values has to be set separately (see the 'Money' tab).</p>" 365 msgstr "<p>Ovdje moÅŸete navesti tekst koji Äe biti prefiks pozitivnim brojevima. VeÄina zemalja ima prazan tekst.</p><p>Primijetite da pozitivni predznak za prikaz novÄanih vrijednosti valja postavitiposebno (vidjeti karticu 'Novac').</p>" 442 msgid "" 443 "<p>Here you can specify text used to prefix positive numbers. Most locales " 444 "leave this blank.</p><p>Note that the positive sign used to display monetary " 445 "values has to be set separately (see the 'Money' tab).</p>" 446 msgstr "" 447 "<p>Ovdje moÅŸete navesti tekst koji Äe biti prefiks pozitivnim brojevima. " 448 "VeÄina zemalja ima prazan tekst.</p><p>Primijetite da pozitivni predznak za " 449 "prikaz novÄanih vrijednosti valja postavitiposebno (vidjeti karticu 'Novac')." 450 "</p>" 366 451 367 452 #. +> trunk stable … … 379 464 #. +> trunk stable 380 465 #: kcmlocale.cpp:1542 381 msgid "<p>Here you can specify text used to prefix negative numbers. This should not be empty, so you can distinguish positive and negative numbers. It is normally set to minus (-).</p><p>Note that the negative sign used to display monetary values has to be set separately (see the 'Money' tab).</p>" 382 msgstr "<p>Ovdje moÅŸete navesti tekst koji Äe biti prefiks negativnim brojevima. Ovo ne bi smjelo biti prazno kako biste mogli razlikovati pozitivne od negativnih brojeva. ObiÄno se postavlja minus (-).</p><p>Primijetite da negativni predznak za prikaz novÄanih vrijednosti valja postaviti posebno (vidjeti karticu 'Novac').</p>" 466 msgid "" 467 "<p>Here you can specify text used to prefix negative numbers. This should not " 468 "be empty, so you can distinguish positive and negative numbers. It is " 469 "normally set to minus (-).</p><p>Note that the negative sign used to display " 470 "monetary values has to be set separately (see the 'Money' tab).</p>" 471 msgstr "" 472 "<p>Ovdje moÅŸete navesti tekst koji Äe biti prefiks negativnim brojevima. Ovo " 473 "ne bi smjelo biti prazno kako biste mogli razlikovati pozitivne od negativnih " 474 "brojeva. ObiÄno se postavlja minus (-).</p><p>Primijetite da negativni " 475 "predznak za prikaz novÄanih vrijednosti valja postaviti posebno (vidjeti " 476 "karticu 'Novac').</p>" 383 477 384 478 #. +> trunk stable … … 399 493 #. +> trunk stable 400 494 #: kcmlocale.cpp:1596 401 msgid "<p>Here you can define the set of digits used to display numbers. If digits other than Arabic are selected, they will appear only if used in the language of the application or the piece of text where the number is shown.</p> <p>Note that the set of digits used to display monetary values has to be set separately (see the 'Money' tab).</p>" 402 msgstr "<p>Ovdje moÅŸete odrediti brojevni sustav za prikaz brojeva. Ako je izabran nearapski brojevni sustav, prikazat Äe se samo ako je koriÅ¡ten u jeziku aplikacije ili dijelu teksta u kojem je prikazan broj.</p> <p>Primijetite da brojevni sustav za prikaz novÄanih vrijednosti valja definirati posebno (vidjeti karticu 'Novac').</p>" 495 msgid "" 496 "<p>Here you can define the set of digits used to display numbers. If digits " 497 "other than Arabic are selected, they will appear only if used in the language " 498 "of the application or the piece of text where the number is shown.</p> <p>" 499 "Note that the set of digits used to display monetary values has to be set " 500 "separately (see the 'Money' tab).</p>" 501 msgstr "" 502 "<p>Ovdje moÅŸete odrediti brojevni sustav za prikaz brojeva. Ako je izabran " 503 "nearapski brojevni sustav, prikazat Äe se samo ako je koriÅ¡ten u jeziku " 504 "aplikacije ili dijelu teksta u kojem je prikazan broj.</p> <p>Primijetite da " 505 "brojevni sustav za prikaz novÄanih vrijednosti valja definirati posebno " 506 "(vidjeti karticu 'Novac').</p>" 403 507 404 508 #. i18n: ectx: property (text), widget (QLabel, m_labelCurrencyCode) … … 410 514 #. +> trunk stable 411 515 #: kcmlocale.cpp:1637 412 msgid "<p>Here you can choose the currency to be used when displaying monetary values, e.g. United States Dollar or Pound Sterling.</p>" 413 msgstr "<p>Ovdje moÅŸete odabrati valutu za prikaznovÄanih vrijednosti, npr. dolar Sjedinjenih DrÅŸava ili funta Ujedinjenog Kraljevstva.</p>" 516 msgid "" 517 "<p>Here you can choose the currency to be used when displaying monetary " 518 "values, e.g. United States Dollar or Pound Sterling.</p>" 519 msgstr "" 520 "<p>Ovdje moÅŸete odabrati valutu za prikaznovÄanih vrijednosti, npr. dolar " 521 "Sjedinjenih DrÅŸava ili funta Ujedinjenog Kraljevstva.</p>" 414 522 415 523 #. +> trunk stable … … 428 536 #. +> trunk stable 429 537 #: kcmlocale.cpp:1698 430 msgid "<p>Here you can choose the symbol to be used when displaying monetary values, e.g. $, US$ or USD.</p>" 431 msgstr "<p>Ovdje moÅŸete odabrati simbol za prikaz novÄanih vrijednosti, npr. $, US$ ili USD.</p>" 538 msgid "" 539 "<p>Here you can choose the symbol to be used when displaying monetary values, " 540 "e.g. $, US$ or USD.</p>" 541 msgstr "" 542 "<p>Ovdje moÅŸete odabrati simbol za prikaz novÄanih vrijednosti, npr. $, US$ " 543 "ili USD.</p>" 432 544 433 545 #. +> trunk stable … … 435 547 #, fuzzy 436 548 #| msgid "<p>Here you can define the decimal separator used to display monetary values.</p><p>Note that the decimal separator used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>" 437 msgid "<p>Here you can define the digit grouping used to display monetary values.</p><p>Note that the digit grouping used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>" 438 msgstr "<p>Ovdje moÅŸete definirati decimalnu razdjelnicu za prikaz novÄanih vrijednosti.</p><p>Primijetite da decimalnu razdjelnicu za prikaz drugih brojeva treba podesiti posebno (vidjeti karticu 'Brojevi').</p>" 549 msgid "" 550 "<p>Here you can define the digit grouping used to display monetary values.</p>" 551 "<p>Note that the digit grouping used to display other numbers has to be " 552 "defined separately (see the 'Numbers' tab).</p>" 553 msgstr "" 554 "<p>Ovdje moÅŸete definirati decimalnu razdjelnicu za prikaz novÄanih " 555 "vrijednosti.</p><p>Primijetite da decimalnu razdjelnicu za prikaz drugih " 556 "brojeva treba podesiti posebno (vidjeti karticu 'Brojevi').</p>" 439 557 440 558 #. +> trunk stable 441 559 #: kcmlocale.cpp:1794 442 msgid "<p>Here you can define the group separator used to display monetary values.</p><p>Note that the thousands separator used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>" 443 msgstr "<p>Ovdje moÅŸete definirati razdjelnicu grupa za prikaz novÄanih vrijednosti.</p><p>Primijetite da razdjelnica tisuÄa za prikaz drugih brojeva treba definirati posebno (vidjeti karticu 'Brojevi').</p>" 560 msgid "" 561 "<p>Here you can define the group separator used to display monetary values.<" 562 "/p><p>Note that the thousands separator used to display other numbers has to " 563 "be defined separately (see the 'Numbers' tab).</p>" 564 msgstr "" 565 "<p>Ovdje moÅŸete definirati razdjelnicu grupa za prikaz novÄanih vrijednosti.<" 566 "/p><p>Primijetite da razdjelnica tisuÄa za prikaz drugih brojeva treba " 567 "definirati posebno (vidjeti karticu 'Brojevi').</p>" 444 568 445 569 #. +> trunk stable 446 570 #: kcmlocale.cpp:1849 447 msgid "<p>Here you can define the decimal separator used to display monetary values.</p><p>Note that the decimal separator used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>" 448 msgstr "<p>Ovdje moÅŸete definirati decimalnu razdjelnicu za prikaz novÄanih vrijednosti.</p><p>Primijetite da decimalnu razdjelnicu za prikaz drugih brojeva treba podesiti posebno (vidjeti karticu 'Brojevi').</p>" 571 msgid "" 572 "<p>Here you can define the decimal separator used to display monetary values." 573 "</p><p>Note that the decimal separator used to display other numbers has to " 574 "be defined separately (see the 'Numbers' tab).</p>" 575 msgstr "" 576 "<p>Ovdje moÅŸete definirati decimalnu razdjelnicu za prikaz novÄanih " 577 "vrijednosti.</p><p>Primijetite da decimalnu razdjelnicu za prikaz drugih " 578 "brojeva treba podesiti posebno (vidjeti karticu 'Brojevi').</p>" 449 579 450 580 #. +> trunk stable 451 581 #: kcmlocale.cpp:1902 452 msgid "<p>Here you can set the number of decimal places displayed for monetary values, i.e. the number of digits <em>after</em> the decimal separator.</p><p>Note that the decimal places used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>" 453 msgstr "<p>Ovdje moÅŸete postaviti broj decimalnih mjesta za prikaz novÄanih vrijednosti, odnosno broj znamenki <em>nakon</em> decimalne razdjelnice.</p><p>Primijetite da decimalna mjesta za prikaz drugih brojeva treba definirati posebno (vidjeti karticu 'Brojevi').</p>" 582 msgid "" 583 "<p>Here you can set the number of decimal places displayed for monetary " 584 "values, i.e. the number of digits <em>after</em> the decimal separator.</p><p>" 585 "Note that the decimal places used to display other numbers has to be defined " 586 "separately (see the 'Numbers' tab).</p>" 587 msgstr "" 588 "<p>Ovdje moÅŸete postaviti broj decimalnih mjesta za prikaz novÄanih " 589 "vrijednosti, odnosno broj znamenki <em>nakon</em> decimalne razdjelnice.</p><" 590 "p>Primijetite da decimalna mjesta za prikaz drugih brojeva treba definirati " 591 "posebno (vidjeti karticu 'Brojevi').</p>" 454 592 455 593 #. i18n: ectx: property (text), widget (QLabel, m_labelMonetaryPositiveFormat) … … 461 599 #. +> trunk stable 462 600 #: kcmlocale.cpp:1953 463 msgid "<p>Here you can set the format of positive monetary values.</p><p>Note that the positive sign used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>" 464 msgstr "<p>Ovdje moÅŸete postaviti format pozitivnih novÄanih vrijednosti.</p><p>Primijetite da pozitivni predznak za prikaz drugih brojeva valja definirati posebno (vidjeti karticu 'Brojevi').</p>" 601 msgid "" 602 "<p>Here you can set the format of positive monetary values.</p><p>Note that " 603 "the positive sign used to display other numbers has to be defined separately " 604 "(see the 'Numbers' tab).</p>" 605 msgstr "" 606 "<p>Ovdje moÅŸete postaviti format pozitivnih novÄanih vrijednosti.</p><p>" 607 "Primijetite da pozitivni predznak za prikaz drugih brojeva valja definirati " 608 "posebno (vidjeti karticu 'Brojevi').</p>" 465 609 466 610 #. +> trunk stable … … 496 640 #. +> trunk stable 497 641 #: kcmlocale.cpp:2010 498 msgid "Here you can select how a positive sign will be positioned. This only affects monetary values." 499 msgstr "Ovdje birate kako Äe znak za pozitivno biti postavljen. Ovdje podeÅ¡eno Äe ujtecati samo na novÄane vrijednosti." 642 msgid "" 643 "Here you can select how a positive sign will be positioned. This only affects " 644 "monetary values." 645 msgstr "" 646 "Ovdje birate kako Äe znak za pozitivno biti postavljen. Ovdje podeÅ¡eno Äe " 647 "ujtecati samo na novÄane vrijednosti." 500 648 501 649 #. +> trunk stable … … 506 654 #. +> trunk stable 507 655 #: kcmlocale.cpp:2014 508 msgid "If this option is checked, the currency sign will be prefixed (i.e. to the left of the value) for all positive monetary values. If not, it will be postfixed (i.e. to the right)." 509 msgstr "Ako ovdje odaberete, znak valute Äe se pisati kao prefix (slijeva) za sve pozitivne vrijednosti novca. U suprotnom, on Äe biti zdesna." 656 msgid "" 657 "If this option is checked, the currency sign will be prefixed (i.e. to the " 658 "left of the value) for all positive monetary values. If not, it will be " 659 "postfixed (i.e. to the right)." 660 msgstr "" 661 "Ako ovdje odaberete, znak valute Äe se pisati kao prefix (slijeva) za sve " 662 "pozitivne vrijednosti novca. U suprotnom, on Äe biti zdesna." 510 663 511 664 #. i18n: ectx: property (text), widget (QLabel, m_labelMonetaryNegativeFormat) … … 517 670 #. +> trunk stable 518 671 #: kcmlocale.cpp:2108 519 msgid "<p>Here you can set the format of negative monetary values.</p><p>Note that the negative sign used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>" 520 msgstr "<p>Ovdje moÅŸete postaviti format negativnih novÄanih vrijednosti.</p><p>Primijetite da negativnih predznak za prikaz drugih brojeva valja definirati posebno (vidjeti karticu 'Brojevi').</p>" 672 msgid "" 673 "<p>Here you can set the format of negative monetary values.</p><p>Note that " 674 "the negative sign used to display other numbers has to be defined separately " 675 "(see the 'Numbers' tab).</p>" 676 msgstr "" 677 "<p>Ovdje moÅŸete postaviti format negativnih novÄanih vrijednosti.</p><p>" 678 "Primijetite da negativnih predznak za prikaz drugih brojeva valja definirati " 679 "posebno (vidjeti karticu 'Brojevi').</p>" 521 680 522 681 #. +> trunk stable 523 682 #: kcmlocale.cpp:2120 524 msgid "Here you can select how a negative sign will be positioned. This only affects monetary values." 525 msgstr "Ovdje moÅŸete odabrati smjeÅ¡taj znaka negativnosti. Ovo se odnosi samo na novaÄane vrijednosti." 683 msgid "" 684 "Here you can select how a negative sign will be positioned. This only affects " 685 "monetary values." 686 msgstr "" 687 "Ovdje moÅŸete odabrati smjeÅ¡taj znaka negativnosti. Ovo se odnosi samo na " 688 "novaÄane vrijednosti." 526 689 527 690 #. +> trunk stable 528 691 #: kcmlocale.cpp:2125 529 msgid "If this option is checked, the currency sign will be prefixed (i.e. to the left of the value) for all negative monetary values. If not, it will be postfixed (i.e. to the right)." 530 msgstr "Ako ovdje omoguÄite, znak za valutu Äe biti stavljen ispred (slijeva) negativnih novÄanih vrijednosti. U surotnom, biti Äe stavljen straga (zdesna)." 692 msgid "" 693 "If this option is checked, the currency sign will be prefixed (i.e. to the " 694 "left of the value) for all negative monetary values. If not, it will be " 695 "postfixed (i.e. to the right)." 696 msgstr "" 697 "Ako ovdje omoguÄite, znak za valutu Äe biti stavljen ispred (slijeva) " 698 "negativnih novÄanih vrijednosti. U surotnom, biti Äe stavljen straga (zdesna)." 531 699 532 700 #. +> trunk stable 533 701 #: kcmlocale.cpp:2215 534 msgid "<p>Here you can define the set of digits used to display monetary values. If digits other than Arabic are selected, they will appear only if used in the language of the application or the piece of text where the number is shown.</p><p>Note that the set of digits used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>" 535 msgstr "<p>Ovdje moÅŸete odabrati brojevni sustav za prikaz novÄanih vrijednosti. Ako je izabran nearapski brojevni sustav, pokazat Äe se ako je koriÅ¡ten u jeziku aplikacije ili dijelu teksta u kojem je prikazan broj.</p><p>Primijetite da brojevni sustav za prikaz drugih brojeva treba podesiti posebno (vidjeti karticu 'Brojevi').</p>" 702 msgid "" 703 "<p>Here you can define the set of digits used to display monetary values. If " 704 "digits other than Arabic are selected, they will appear only if used in the " 705 "language of the application or the piece of text where the number is shown.<" 706 "/p><p>Note that the set of digits used to display other numbers has to be " 707 "defined separately (see the 'Numbers' tab).</p>" 708 msgstr "" 709 "<p>Ovdje moÅŸete odabrati brojevni sustav za prikaz novÄanih vrijednosti. Ako " 710 "je izabran nearapski brojevni sustav, pokazat Äe se ako je koriÅ¡ten u jeziku " 711 "aplikacije ili dijelu teksta u kojem je prikazan broj.</p><p>Primijetite da " 712 "brojevni sustav za prikaz drugih brojeva treba podesiti posebno (vidjeti " 713 "karticu 'Brojevi').</p>" 536 714 537 715 #. i18n: ectx: property (text), widget (QLabel, m_labelCalendarSystem) … … 544 722 #: kcmlocale.cpp:2258 545 723 msgid "<p>Here you can set the Calendar System to use to display dates.</p>" 546 msgstr "<p>Ovdje moÅŸete postaviti kalendarski sustav koji Äe se koristiti za prikaz datuma.</p>" 724 msgstr "" 725 "<p>Ovdje moÅŸete postaviti kalendarski sustav koji Äe se koristiti za prikaz " 726 "datuma.</p>" 547 727 548 728 #. i18n: ectx: property (text), widget (QCheckBox, m_checkCalendarGregorianUseCommonEra) … … 554 734 #. +> trunk stable 555 735 #: kcmlocale.cpp:2314 556 msgid "<p>This option determines if the Common Era (CE/BCE) should be used instead of the Christian Era (AD/BC).</p>" 557 msgstr "<p>Ova opcija odreÄuje da li se koristi \"NaÅ¡a era\" (CE/BCE) umjesto \"KrÅ¡Äanska era\" (AD/BC).</p>" 736 msgid "" 737 "<p>This option determines if the Common Era (CE/BCE) should be used instead " 738 "of the Christian Era (AD/BC).</p>" 739 msgstr "" 740 "<p>Ova opcija odreÄuje da li se koristi \"NaÅ¡a era\" (CE/BCE) umjesto " 741 "\"KrÅ¡Äanska era\" (AD/BC).</p>" 558 742 559 743 #. i18n: ectx: property (text), widget (QLabel, m_labelShortYearWindow) … … 572 756 #. +> trunk stable 573 757 #: kcmlocale.cpp:2359 574 msgid "<p>This option determines what year range a two digit date is interpreted as, for example with a range of 1950 to 2049 the value 10 is interpreted as 2010. This range is only applied when reading the Short Year (YY) date format.</p>" 575 msgstr "<p>Ova opcija odreÄuje koje se razdoblje godina podrazumijeva za dvije znamenke, npr. u razdoblju od 1950. do 2049. vrijednost 10. predstavlja 2010. godinu. Ovo se koristi samo pri formatu kratkog prikaza godine (YY).</p>" 758 msgid "" 759 "<p>This option determines what year range a two digit date is interpreted as, " 760 "for example with a range of 1950 to 2049 the value 10 is interpreted as 2010. " 761 " This range is only applied when reading the Short Year (YY) date format.</p>" 762 msgstr "" 763 "<p>Ova opcija odreÄuje koje se razdoblje godina podrazumijeva za dvije " 764 "znamenke, npr. u razdoblju od 1950. do 2049. vrijednost 10. predstavlja 2010. " 765 "godinu. Ovo se koristi samo pri formatu kratkog prikaza godine (YY).</p>" 576 766 577 767 #. i18n: ectx: property (text), widget (QLabel, m_labelWeekNumberSystem) 578 768 #. +> trunk stable 579 769 #: kcmlocale.cpp:2401 kcmlocalewidget.ui:938 580 #, fuzzy581 770 #| msgid "Measure system:" 582 771 msgid "Week number system:" 583 msgstr " Mjerni sustav:"772 msgstr "Sustav brojanja tjedana:" 584 773 585 774 #. +> trunk 586 775 #: kcmlocale.cpp:2402 587 msgid "<p>This option determines how the Week Number will be calculated. There are four options available:</p> <ul><li><b>ISO Week</b> Use the ISO standard Week Number. This will always use Monday as the first day of the ISO week. This is the most commonly used system.</li><li><b>Full First Week</b> The first week of the year starts on the first occurrence of the <i>First day of the week</i>, and lasts for seven days. Any days before Week 1 are considered part of the last week of the previous year. This system is most commonly used in the USA.</li><li><b>Partial First Week</b> The first week starts on the first day of the year. The second week of the year starts on the first occurrence of the <i>First day of the week</i>, and lasts for seven days. The first week may not contain seven days.</li><li><b>Simple Week</b> The first week starts on the first day of the year and lasts seven days, with all new weeks starting on the same weekday as the first day of the year.</li></ul>" 776 msgid "" 777 "<p>This option determines how the Week Number will be calculated. There are " 778 "four options available:</p> <ul><li><b>ISO Week</b> Use the ISO standard Week " 779 "Number. This will always use Monday as the first day of the ISO week. This is " 780 "the most commonly used system.</li><li><b>Full First Week</b> The first week " 781 "of the year starts on the first occurrence of the <i>First day of the week</i>" 782 ", and lasts for seven days. Any days before Week 1 are considered part of " 783 "the last week of the previous year. This system is most commonly used in the " 784 "USA.</li><li><b>Partial First Week</b> The first week starts on the first day " 785 "of the year. The second week of the year starts on the first occurrence of " 786 "the <i>First day of the week</i>, and lasts for seven days. The first week " 787 "may not contain seven days.</li><li><b>Simple Week</b> The first week starts " 788 "on the first day of the year and lasts seven days, with all new weeks " 789 "starting on the same weekday as the first day of the year.</li></ul>" 588 790 msgstr "" 589 791 590 792 #. +> stable 591 793 #: kcmlocale.cpp:2402 592 msgid "<p>This option determines how the Week Number will be calculated. There are four options available:</p> <ul><li><b>ISO Week</b> Use the ISO standard Week Number. This will always use Monday as the first day of the ISO week. This is the most commonly used system.</li><li><b>Full First Week</b> The first week of the year starts on the first occurrence of the <i>First day of the week</i>, and lasts for seven days. Any days before Week 1 are considered part of the last week of the previous year. This system is most commonly used in the USA.</li><li><b>Partial First Week</b> The first week starts on the first day of the year. The second week of the year starts on the first occurrence of the <i>First day of the week</i>, and lasts for seven days. The first week may not contain seven days.</li><li><b>Simple Week</b> The first week starts on the first day of the year and lasts seven days, will all new weeks starting on the same weekday as the first day of the year.</li></ul>" 794 msgid "" 795 "<p>This option determines how the Week Number will be calculated. There are " 796 "four options available:</p> <ul><li><b>ISO Week</b> Use the ISO standard Week " 797 "Number. This will always use Monday as the first day of the ISO week. This is " 798 "the most commonly used system.</li><li><b>Full First Week</b> The first week " 799 "of the year starts on the first occurrence of the <i>First day of the week</i>" 800 ", and lasts for seven days. Any days before Week 1 are considered part of " 801 "the last week of the previous year. This system is most commonly used in the " 802 "USA.</li><li><b>Partial First Week</b> The first week starts on the first day " 803 "of the year. The second week of the year starts on the first occurrence of " 804 "the <i>First day of the week</i>, and lasts for seven days. The first week " 805 "may not contain seven days.</li><li><b>Simple Week</b> The first week starts " 806 "on the first day of the year and lasts seven days, will all new weeks " 807 "starting on the same weekday as the first day of the year.</li></ul>" 593 808 msgstr "" 594 809 595 810 #. +> trunk stable 596 811 #: kcmlocale.cpp:2425 597 #, fuzzy598 812 msgid "ISO Week" 599 msgstr " 1tjedan"813 msgstr "ISO tjedan" 600 814 601 815 #. +> trunk stable 602 816 #: kcmlocale.cpp:2427 603 #, fuzzy604 817 msgid "Full First Week" 605 msgstr " Broj"818 msgstr "Puni prvi tjedan" 606 819 607 820 #. +> trunk stable 608 821 #: kcmlocale.cpp:2429 609 #, fuzzy610 822 msgid "Partial First Week" 611 msgstr " Parcijalni naboj"823 msgstr "DjelomiÄni prvi tjedan" 612 824 613 825 #. +> trunk stable 614 826 #: kcmlocale.cpp:2431 615 #, fuzzy616 827 msgid "Simple Week" 617 msgstr "Jednostav an test"828 msgstr "Jednostavni tjedan" 618 829 619 830 #. i18n: ectx: property (text), widget (QLabel, m_labelWeekStartDay) … … 625 836 #. +> trunk stable 626 837 #: kcmlocale.cpp:2461 627 #, fuzzy628 838 #| msgid "<p>This option determines which day will be considered as the first one of the week.</p> " 629 msgid "<p>This option determines which day will be considered as the first one of the week. This value may affect the Week Number System.</p> " 630 msgstr "<p>Ova opcija odreÄuje koji se dan smatra prvim danom tjedna.</p> " 839 msgid "" 840 "<p>This option determines which day will be considered as the first one of " 841 "the week. This value may affect the Week Number System.</p> " 842 msgstr "" 843 "<p>Ova opcija odreÄuje koji se dan smatra prvim danom tjedna. Ova vrijednost " 844 "moÅŸe utjecati na Sustav brojanja tjedana.</p> " 631 845 632 846 #. i18n: ectx: property (text), widget (QLabel, m_labelWorkingWeekStartDay) … … 638 852 #. +> trunk stable 639 853 #: kcmlocale.cpp:2496 640 msgid "<p>This option determines which day will be considered as the first working day of the week.</p>" 641 msgstr "<p>Ova opcija odreÄuje koji dan se smatra prvim radnim danom u tjednu.</p>" 854 msgid "" 855 "<p>This option determines which day will be considered as the first working " 856 "day of the week.</p>" 857 msgstr "" 858 "<p>Ova opcija odreÄuje koji dan se smatra prvim radnim danom u tjednu.</p>" 642 859 643 860 #. i18n: ectx: property (text), widget (QLabel, m_labelWorkingWeekEndDay) … … 649 866 #. +> trunk stable 650 867 #: kcmlocale.cpp:2530 651 msgid "<p>This option determines which day will be considered as the last working day of the week.</p>" 652 msgstr "<p>Ova opcija odreÄuje koji se dan smatra zadnjim radnim danom u tjednu.</p>" 868 msgid "" 869 "<p>This option determines which day will be considered as the last working " 870 "day of the week.</p>" 871 msgstr "" 872 "<p>Ova opcija odreÄuje koji se dan smatra zadnjim radnim danom u tjednu.</p>" 653 873 654 874 #. i18n: ectx: property (text), widget (QLabel, m_labelWeekDayOfPray) … … 660 880 #. +> trunk stable 661 881 #: kcmlocale.cpp:2564 662 msgid "<p>This option determines which day if any will be considered as the day of the week for special religious observance.</p>" 663 msgstr "<p>Ova opcija odreÄuje koji Äe se dan u tjednu smatrati danom u tjednu za posebne vjerske obrede.</p>" 882 msgid "" 883 "<p>This option determines which day if any will be considered as the day of " 884 "the week for special religious observance.</p>" 885 msgstr "" 886 "<p>Ova opcija odreÄuje koji Äe se dan u tjednu smatrati danom u tjednu za " 887 "posebne vjerske obrede.</p>" 664 888 665 889 #. +> trunk stable … … 677 901 #. +> trunk stable 678 902 #: kcmlocale.cpp:2599 679 msgid "<p>The text in this textbox will be used to format time strings. The sequences below will be replaced:</p><table><tr><td><b>HH</b></td><td>The hour as a decimal number using a 24-hour clock (00-23).</td></tr><tr><td><b>hH</b></td><td>The hour (24-hour clock) as a decimal number (0-23).</td></tr><tr><td><b>PH</b></td><td>The hour as a decimal number using a 12-hour clock (01-12).</td></tr><tr><td><b>pH</b></td><td>The hour (12-hour clock) as a decimal number (1-12).</td></tr><tr><td><b>MM</b></td><td>The minutes as a decimal number (00-59).</td></tr><tr><td><b>SS</b></td><td>The seconds as a decimal number (00-59).</td></tr><tr><td><b>AMPM</b></td><td>Either 'AM' or 'PM' according to the given time value. Noon is treated as 'PM' and midnight as 'AM'.</td></tr></table>" 680 msgstr "<p>Tekst u ovom tekstualnom polju koristi se za oblikovanje oznaka vremena. SljedeÄi nizovi bit Äe zamijenjeni:</p><table><tr><td><b>HH</b></td><td>Sat kao decimalni broj kod 24-satnog formata (00-23).</td></tr><tr><td><b>hH</b></td><td>Sat (24-satni prikaz) kao decimalni broj (0-23).</td></tr><tr><td><b>PH</b></td><td>Sat kao decimalni broj kod 12-satnog formata (01-12).</td></tr><tr><td><b>pH</b></td><td>Sat (12-satni prikaz) kao decimalni broj (1-12).</td></tr><tr><td><b>MM</b></td><td>Minute kao decimalni broj (00-59).</td></tr><tr><td><b>SS</b></td><td>Sekunde kao decimalni broj (00-59).</td></tr><tr><td><b>AMPM</b></td><td>Ili 'AM' ili 'PM' ovisno o danom vremenu. Podne je 'PM', a ponoÄ je 'AM'.</td></tr></table>" 903 msgid "" 904 "<p>The text in this textbox will be used to format time strings. The " 905 "sequences below will be replaced:</p><table><tr><td><b>HH</b></td><td>The " 906 "hour as a decimal number using a 24-hour clock (00-23).</td></tr><tr><td><b>" 907 "hH</b></td><td>The hour (24-hour clock) as a decimal number (0-23).</td></tr>" 908 "<tr><td><b>PH</b></td><td>The hour as a decimal number using a 12-hour clock " 909 "(01-12).</td></tr><tr><td><b>pH</b></td><td>The hour (12-hour clock) as a " 910 "decimal number (1-12).</td></tr><tr><td><b>MM</b></td><td>The minutes as a " 911 "decimal number (00-59).</td></tr><tr><td><b>SS</b></td><td>The seconds as a " 912 "decimal number (00-59).</td></tr><tr><td><b>AMPM</b></td><td>Either 'AM' or " 913 "'PM' according to the given time value. Noon is treated as 'PM' and midnight " 914 "as 'AM'.</td></tr></table>" 915 msgstr "" 916 "<p>Tekst u ovom tekstualnom polju koristi se za oblikovanje oznaka vremena. " 917 "SljedeÄi nizovi bit Äe zamijenjeni:</p><table><tr><td><b>HH</b></td><td>Sat " 918 "kao decimalni broj kod 24-satnog formata (00-23).</td></tr><tr><td><b>hH</b><" 919 "/td><td>Sat (24-satni prikaz) kao decimalni broj (0-23).</td></tr><tr><td><b>" 920 "PH</b></td><td>Sat kao decimalni broj kod 12-satnog formata (01-12).</td></tr>" 921 "<tr><td><b>pH</b></td><td>Sat (12-satni prikaz) kao decimalni broj (1-12).<" 922 "/td></tr><tr><td><b>MM</b></td><td>Minute kao decimalni broj (00-59).</td><" 923 "/tr><tr><td><b>SS</b></td><td>Sekunde kao decimalni broj (00-59).</td></tr><" 924 "tr><td><b>AMPM</b></td><td>Ili 'AM' ili 'PM' ovisno o danom vremenu. Podne je " 925 "'PM', a ponoÄ je 'AM'.</td></tr></table>" 681 926 682 927 #. +> trunk stable … … 735 980 #: kcmlocale.cpp:2709 736 981 msgid "<p>Here you can set the text to be displayed for AM.</p>" 737 msgstr "<p>Ovdje moÅŸete postaviti tekst koji Äe se prikazati za prijepodne.</p>" 982 msgstr "" 983 "<p>Ovdje moÅŸete postaviti tekst koji Äe se prikazati za prijepodne.</p>" 738 984 739 985 #. i18n: ectx: property (text), widget (QLabel, m_labelPmSymbol) … … 746 992 #: kcmlocale.cpp:2714 747 993 msgid "<p>Here you can set the text to be displayed for PM.</p>" 748 msgstr "<p>Ovdje moÅŸete postaviti tekst koji Äe se prikazati za poslijepodne.</p>" 994 msgstr "" 995 "<p>Ovdje moÅŸete postaviti tekst koji Äe se prikazati za poslijepodne.</p>" 749 996 750 997 #. i18n: ectx: property (text), widget (QLabel, m_labelDateFormat) … … 756 1003 #. +> trunk stable 757 1004 #: kcmlocale.cpp:2819 758 msgid "<p>The text in this textbox will be used to format long dates. The sequences below will be replaced:</p><table><tr><td><b>YYYY</b></td><td>The year with century as a decimal number.</td></tr><tr><td><b>YY</b></td><td>The year without century as a decimal number (00-99).</td></tr><tr><td><b>MM</b></td><td>The month as a decimal number (01-12).</td></tr><tr><td><b>mM</b></td><td>The month as a decimal number (1-12).</td></tr><tr><td><b>SHORTMONTH</b></td><td>The first three characters of the month name.</td></tr><tr><td><b>MONTH</b></td><td>The full month name.</td></tr><tr><td><b>DD</b></td><td>The day of month as a decimal number (01-31).</td></tr><tr><td><b>dD</b></td><td>The day of month as a decimal number (1-31).</td></tr><tr><td><b>SHORTWEEKDAY</b></td><td>The first three characters of the weekday name.</td></tr><tr><td><b>WEEKDAY</b></td><td>The full weekday name.</td></tr><tr><td><b>ERAYEAR</b></td><td>The Era Year in local format (e.g. 2000 AD).</td></tr><tr><td><b>SHORTERANAME</b></td><td>The short Era Name.</td></tr><tr><td><b>YEARINERA</b></td><td>The Year in Era as a decimal number.</td></tr><tr><td><b>DAYOFYEAR</b></td><td>The Day of Year as a decimal number.</td></tr><tr><td><b>ISOWEEK</b></td><td>The ISO Week as a decimal number.</td></tr><tr><td><b>DAYOFISOWEEK</b></td><td>The Day of the ISO Week as a decimal number.</td></tr></table>" 759 msgstr "<p>Tekst u ovom tekstualnom polju koristit Äe se u formatiranju dugih datuma. NiÅŸe navedeni nizovi bit Äe zamijenjeni:</p><table><tr><td><b>GGGG</b></td><td>Godina sa stoljeÄem kao decimalni broj.</td></tr><tr><td><b>GG</b></td><td>Godina bez stoljeÄa kao decimalni broj (00-99).</td></tr><tr><td><b>MM</b></td><td>Mjesec kao decimalni broj (01-12).</td></tr><tr><td><b>mM</b></td><td>Mjesec kao decimalni broj (1-12).</td></tr><tr><td><b>KRATKIMJESEC</b></td><td>Prva tri slova iz naziva mjeseca. </td></tr><tr><td><b>MJESEC</b></td><td>Puni naziv mjeseca.</td></tr><tr><td><b>DD</b></td><td>Dan u mjesecu kao decimalni broj (01-31).</td></tr><tr><td><b>dD</b></td><td>Dan u mjesecu kao decimalni broj (1-31).</td></tr><tr><td><b>KRATKIDAN</b></td><td>Prva tri slova imena dana.</td></tr><tr><td><b>DANUTJEDNU</b></td><td>Puni naziv dana u tjednu.</td></tr><tr><td><b>ERAGODINA</b></td><td>Godina ere u lokalnom formatu (npr. 2000. AD).</td></tr><tr><td><b>KRATKINAZIVERE</b></td><td>Kratki naziv ere.</td></tr><tr><td><b>GODINAUERI</b></td><td>Godina u eri kao decimalni broj.</td></tr><tr><td><b>DANGODINE</b></td><td>Dan u godini kao decimalni broj.</td></tr><tr><td><b>ISOTJEDAN</b></td><td>ISO tjedan kao decimalni broj.</td></tr><tr><td><b>DANISOTJEDNA</b></td><td>Dan ISO tjedna kao decimalni broj.</td></tr></table>" 1005 msgid "" 1006 "<p>The text in this textbox will be used to format long dates. The sequences " 1007 "below will be replaced:</p><table><tr><td><b>YYYY</b></td><td>The year with " 1008 "century as a decimal number.</td></tr><tr><td><b>YY</b></td><td>The year " 1009 "without century as a decimal number (00-99).</td></tr><tr><td><b>MM</b></td><" 1010 "td>The month as a decimal number (01-12).</td></tr><tr><td><b>mM</b></td><td>" 1011 "The month as a decimal number (1-12).</td></tr><tr><td><b>SHORTMONTH</b></td>" 1012 "<td>The first three characters of the month name.</td></tr><tr><td><b>MONTH<" 1013 "/b></td><td>The full month name.</td></tr><tr><td><b>DD</b></td><td>The day " 1014 "of month as a decimal number (01-31).</td></tr><tr><td><b>dD</b></td><td>The " 1015 "day of month as a decimal number (1-31).</td></tr><tr><td><b>SHORTWEEKDAY</b>" 1016 "</td><td>The first three characters of the weekday name.</td></tr><tr><td><b>" 1017 "WEEKDAY</b></td><td>The full weekday name.</td></tr><tr><td><b>ERAYEAR</b><" 1018 "/td><td>The Era Year in local format (e.g. 2000 AD).</td></tr><tr><td><b>" 1019 "SHORTERANAME</b></td><td>The short Era Name.</td></tr><tr><td><b>YEARINERA</b>" 1020 "</td><td>The Year in Era as a decimal number.</td></tr><tr><td><b>DAYOFYEAR<" 1021 "/b></td><td>The Day of Year as a decimal number.</td></tr><tr><td><b>ISOWEEK<" 1022 "/b></td><td>The ISO Week as a decimal number.</td></tr><tr><td><b>" 1023 "DAYOFISOWEEK</b></td><td>The Day of the ISO Week as a decimal number.</td><" 1024 "/tr></table>" 1025 msgstr "" 1026 "<p>Tekst u ovom tekstualnom polju koristit Äe se u formatiranju dugih datuma. " 1027 "NiÅŸe navedeni nizovi bit Äe zamijenjeni:</p><table><tr><td><b>GGGG</b></td><" 1028 "td>Godina sa stoljeÄem kao decimalni broj.</td></tr><tr><td><b>GG</b></td><td>" 1029 "Godina bez stoljeÄa kao decimalni broj (00-99).</td></tr><tr><td><b>MM</b><" 1030 "/td><td>Mjesec kao decimalni broj (01-12).</td></tr><tr><td><b>mM</b></td><td>" 1031 "Mjesec kao decimalni broj (1-12).</td></tr><tr><td><b>KRATKIMJESEC</b></td><" 1032 "td>Prva tri slova iz naziva mjeseca. </td></tr><tr><td><b>MJESEC</b></td><td>" 1033 "Puni naziv mjeseca.</td></tr><tr><td><b>DD</b></td><td>Dan u mjesecu kao " 1034 "decimalni broj (01-31).</td></tr><tr><td><b>dD</b></td><td>Dan u mjesecu kao " 1035 "decimalni broj (1-31).</td></tr><tr><td><b>KRATKIDAN</b></td><td>Prva tri " 1036 "slova imena dana.</td></tr><tr><td><b>DANUTJEDNU</b></td><td>Puni naziv dana " 1037 "u tjednu.</td></tr><tr><td><b>ERAGODINA</b></td><td>Godina ere u lokalnom " 1038 "formatu (npr. 2000. AD).</td></tr><tr><td><b>KRATKINAZIVERE</b></td><td>" 1039 "Kratki naziv ere.</td></tr><tr><td><b>GODINAUERI</b></td><td>Godina u eri kao " 1040 "decimalni broj.</td></tr><tr><td><b>DANGODINE</b></td><td>Dan u godini kao " 1041 "decimalni broj.</td></tr><tr><td><b>ISOTJEDAN</b></td><td>ISO tjedan kao " 1042 "decimalni broj.</td></tr><tr><td><b>DANISOTJEDNA</b></td><td>Dan ISO tjedna " 1043 "kao decimalni broj.</td></tr></table>" 760 1044 761 1045 #. +> trunk stable … … 858 1142 #. +> trunk stable 859 1143 #: kcmlocale.cpp:2953 860 msgid "<p>The text in this textbox will be used to format short dates. For instance, this is used when listing files. The sequences below will be replaced:</p><table><tr><td><b>YYYY</b></td><td>The year with century as a decimal number.</td></tr><tr><td><b>YY</b></td><td>The year without century as a decimal number (00-99).</td></tr><tr><td><b>MM</b></td><td>The month as a decimal number (01-12).</td></tr><tr><td><b>mM</b></td><td>The month as a decimal number (1-12).</td></tr><tr><td><b>SHORTMONTH</b></td><td>The first three characters of the month name.</td></tr><tr><td><b>MONTH</b></td><td>The full month name.</td></tr><tr><td><b>DD</b></td><td>The day of month as a decimal number (01-31).</td></tr><tr><td><b>dD</b></td><td>The day of month as a decimal number (1-31).</td></tr><tr><td><b>SHORTWEEKDAY</b></td><td>The first three characters of the weekday name.</td></tr><tr><td><b>WEEKDAY</b></td><td>The full weekday name.</td></tr><tr><td><b>ERAYEAR</b></td><td>The Era Year in local format (e.g. 2000 AD).</td></tr><tr><td><b>SHORTERANAME</b></td><td>The short Era Name.</td></tr><tr><td><b>YEARINERA</b></td><td>The Year in Era as a decimal number.</td></tr><tr><td><b>DAYOFYEAR</b></td><td>The Day of Year as a decimal number.</td></tr><tr><td><b>ISOWEEK</b></td><td>The ISO Week as a decimal number.</td></tr><tr><td><b>DAYOFISOWEEK</b></td><td>The Day of the ISO Week as a decimal number.</td></tr></table>" 861 msgstr "<p>Tekst u ovom tekstualnom polju koristit Äe se u formatiranju kratkih datuma. Na primjer, ovo se koristi pri izlistavanju datoteka. NiÅŸe navedeni nizovi bit Äe zamijenjeni:</p><table><tr><td><b>GGGG</b></td><td>Godina sa stoljeÄem kao decimalni broj.</td></tr><tr><td><b>GG</b></td><td>Godina bez stoljeÄa kao decimalni broj (00-99).</td></tr><tr><td><b>MM</b></td><td>Mjesec kao decimalni broj (01-12).</td></tr><tr><td><b>mM</b></td><td>Mjesec kao decimalni broj (1-12).</td></tr><tr><td><b>KRATKIMJESEC</b></td><td>Prva tri slova iz naziva mjeseca.</td></tr><tr><td><b>MJESEC</b></td><td>Puni naziv mjeseca.</td></tr><tr><td><b>DD</b></td><td>Dan u mjesecu kao decimalni broj (01-31).</td></tr><tr><td><b>dD</b></td><td>Dan u mjesecu kao decimalni broj (1-31).</td></tr><tr><td><b>KRATKIDAN</b></td><td>Prva tri znaka naziva dana u tjednu.</td></tr><tr><td><b>DANUTJEDNU</b></td><td>Puni naziv dana u tjednu.</td></tr><tr><td><b>ERAGODINA</b></td><td>Godina u eri u lokalnom formatu (npr. 2000. AD).</td></tr><tr><td><b>KRATKINAZIVERE</b></td><td>Kratki naziv ere.</td></tr><tr><td><b>GODINAUERI</b></td><td>Godina u eri kao decimalni broj.</td></tr><tr><td><b>DANGODINE</b></td><td>Dan u godini kao decimalni broj.</td></tr><tr><td><b>ISOTJEDAN</b></td><td>ISO tjedan kao decimalni broj.</td></tr><tr><td><b>DANISOTJEDNA</b></td><td>Dan u ISO tjednu kao decimalni broj.</td></tr></table>" 1144 msgid "" 1145 "<p>The text in this textbox will be used to format short dates. For instance, " 1146 "this is used when listing files. The sequences below will be replaced:</p><" 1147 "table><tr><td><b>YYYY</b></td><td>The year with century as a decimal number.<" 1148 "/td></tr><tr><td><b>YY</b></td><td>The year without century as a decimal " 1149 "number (00-99).</td></tr><tr><td><b>MM</b></td><td>The month as a decimal " 1150 "number (01-12).</td></tr><tr><td><b>mM</b></td><td>The month as a decimal " 1151 "number (1-12).</td></tr><tr><td><b>SHORTMONTH</b></td><td>The first three " 1152 "characters of the month name.</td></tr><tr><td><b>MONTH</b></td><td>The full " 1153 "month name.</td></tr><tr><td><b>DD</b></td><td>The day of month as a decimal " 1154 "number (01-31).</td></tr><tr><td><b>dD</b></td><td>The day of month as a " 1155 "decimal number (1-31).</td></tr><tr><td><b>SHORTWEEKDAY</b></td><td>The first " 1156 "three characters of the weekday name.</td></tr><tr><td><b>WEEKDAY</b></td><td>" 1157 "The full weekday name.</td></tr><tr><td><b>ERAYEAR</b></td><td>The Era Year " 1158 "in local format (e.g. 2000 AD).</td></tr><tr><td><b>SHORTERANAME</b></td><td>" 1159 "The short Era Name.</td></tr><tr><td><b>YEARINERA</b></td><td>The Year in Era " 1160 "as a decimal number.</td></tr><tr><td><b>DAYOFYEAR</b></td><td>The Day of " 1161 "Year as a decimal number.</td></tr><tr><td><b>ISOWEEK</b></td><td>The ISO " 1162 "Week as a decimal number.</td></tr><tr><td><b>DAYOFISOWEEK</b></td><td>The " 1163 "Day of the ISO Week as a decimal number.</td></tr></table>" 1164 msgstr "" 1165 "<p>Tekst u ovom tekstualnom polju koristit Äe se u formatiranju kratkih " 1166 "datuma. Na primjer, ovo se koristi pri izlistavanju datoteka. NiÅŸe navedeni " 1167 "nizovi bit Äe zamijenjeni:</p><table><tr><td><b>GGGG</b></td><td>Godina sa " 1168 "stoljeÄem kao decimalni broj.</td></tr><tr><td><b>GG</b></td><td>Godina bez " 1169 "stoljeÄa kao decimalni broj (00-99).</td></tr><tr><td><b>MM</b></td><td>" 1170 "Mjesec kao decimalni broj (01-12).</td></tr><tr><td><b>mM</b></td><td>Mjesec " 1171 "kao decimalni broj (1-12).</td></tr><tr><td><b>KRATKIMJESEC</b></td><td>Prva " 1172 "tri slova iz naziva mjeseca.</td></tr><tr><td><b>MJESEC</b></td><td>Puni " 1173 "naziv mjeseca.</td></tr><tr><td><b>DD</b></td><td>Dan u mjesecu kao decimalni " 1174 "broj (01-31).</td></tr><tr><td><b>dD</b></td><td>Dan u mjesecu kao decimalni " 1175 "broj (1-31).</td></tr><tr><td><b>KRATKIDAN</b></td><td>Prva tri znaka naziva " 1176 "dana u tjednu.</td></tr><tr><td><b>DANUTJEDNU</b></td><td>Puni naziv dana u " 1177 "tjednu.</td></tr><tr><td><b>ERAGODINA</b></td><td>Godina u eri u lokalnom " 1178 "formatu (npr. 2000. AD).</td></tr><tr><td><b>KRATKINAZIVERE</b></td><td>" 1179 "Kratki naziv ere.</td></tr><tr><td><b>GODINAUERI</b></td><td>Godina u eri kao " 1180 "decimalni broj.</td></tr><tr><td><b>DANGODINE</b></td><td>Dan u godini kao " 1181 "decimalni broj.</td></tr><tr><td><b>ISOTJEDAN</b></td><td>ISO tjedan kao " 1182 "decimalni broj.</td></tr><tr><td><b>DANISOTJEDNA</b></td><td>Dan u ISO tjednu " 1183 "kao decimalni broj.</td></tr></table>" 862 1184 863 1185 #. +> trunk stable … … 881 1203 #. +> trunk stable 882 1204 #: kcmlocale.cpp:3073 883 msgid "<p>This option determines whether possessive form of month names should be used in dates.</p>" 884 msgstr "<p>Ova opcija odreÄuje da li se u datumima koristi duÅŸi oblik imena mjeseca.</p>" 1205 msgid "" 1206 "<p>This option determines whether possessive form of month names should be " 1207 "used in dates.</p>" 1208 msgstr "" 1209 "<p>Ova opcija odreÄuje da li se u datumima koristi duÅŸi oblik imena mjeseca.<" 1210 "/p>" 885 1211 886 1212 #. +> trunk stable 887 1213 #: kcmlocale.cpp:3114 888 msgid "<p>Here you can define the set of digits used to display dates and times. If digits other than Arabic are selected, they will appear only if used in the language of the application or the piece of text where the date or time is shown.</p><p>Note that the set of digits used to display numeric and monetary values have to be set separately (see the 'Number' or 'Money' tabs).</p>" 889 msgstr "<p>Ovdje moÅŸete odrediti brojevni sustav za prikaz datuma i vremena. Ako je izabran nearapski brojevni sustav, prikazat Äe se samo ako je koriÅ¡ten u jeziku aplikacije ili dijelu teksta u kojem je prikazan datum ili vrijeme.</p><p> Primijetite da brojevni sustav za prikaz brojÄanih i novÄanih vrijednosti valja postaviti posebno (vidjeti kartice 'Brojevi' i 'Novac').</p>" 1214 msgid "" 1215 "<p>Here you can define the set of digits used to display dates and times. If " 1216 "digits other than Arabic are selected, they will appear only if used in the " 1217 "language of the application or the piece of text where the date or time is " 1218 "shown.</p><p>Note that the set of digits used to display numeric and monetary " 1219 "values have to be set separately (see the 'Number' or 'Money' tabs).</p>" 1220 msgstr "" 1221 "<p>Ovdje moÅŸete odrediti brojevni sustav za prikaz datuma i vremena. Ako je " 1222 "izabran nearapski brojevni sustav, prikazat Äe se samo ako je koriÅ¡ten u " 1223 "jeziku aplikacije ili dijelu teksta u kojem je prikazan datum ili vrijeme.</p>" 1224 "<p> Primijetite da brojevni sustav za prikaz brojÄanih i novÄanih vrijednosti " 1225 "valja postaviti posebno (vidjeti kartice 'Brojevi' i 'Novac').</p>" 890 1226 891 1227 #. +> trunk stable … … 896 1232 #. +> trunk stable 897 1233 #: kcmlocale.cpp:3152 898 msgid "<p>Here you can define the default page size to be used in new documents.</p><p>Note that this setting has no effect on printer paper size.</p>" 899 msgstr "<p>Ovdje moÅŸete definirati zadanu veliÄinu stranice koja Äe se koristiti u novim dokumentima.</p> <p>Primijetite da ova postavka nema utjecaj na veliÄinu papira pisaÄa.</p>" 1234 msgid "" 1235 "<p>Here you can define the default page size to be used in new documents.</p>" 1236 "<p>Note that this setting has no effect on printer paper size.</p>" 1237 msgstr "" 1238 "<p>Ovdje moÅŸete definirati zadanu veliÄinu stranice koja Äe se koristiti u " 1239 "novim dokumentima.</p> <p>Primijetite da ova postavka nema utjecaj na " 1240 "veliÄinu papira pisaÄa.</p>" 900 1241 901 1242 #. +> trunk stable … … 1112 1453 #. +> trunk stable 1113 1454 #: kcmlocale.cpp:3290 1114 msgid "<p>This changes the units used by most KDE programs to display numbers counted in bytes. Traditionally \"kilobytes\" meant units of 1024, instead of the metric 1000, for most (but not all) byte sizes.<ul><li>To reduce confusion you can use the recently standardized IEC units which are always in multiples of 1024.</li><li>You can also select metric, which is always in units of 1000.</li><li>Selecting JEDEC restores the older-style units used in KDE 3.5 and some other operating systems.</li></p>" 1115 msgstr "<p>Ovo mijenja jedinice koje koristi veÄina KDE-ovih programa za prikaz brojeva u bajtovima. Tradicionalni \"kilobajt\" je znaÄio 1024 jedinica, umjesto metriÄkih 1000 za veÄinu (ali ne svih) bajtnih veliÄina.<ul><li>Kako bi smanjili zbunjenost, moÅŸete koristiti nedavno standardizirane jedinice IEC-a koje su uvijek viÅ¡ekratnici od 1024.</li><li>TakoÄer moÅŸete odabrati metriÄke koje su uvijek u jedincama po 1000.</li><li>Odabiranjem JEDEC-a vraÄate stare jedinice koje su se koristile u KDE-u 3.5 i u nekim drugim operacijskim sustavima.</li></p>" 1455 msgid "" 1456 "<p>This changes the units used by most KDE programs to display numbers " 1457 "counted in bytes. Traditionally \"kilobytes\" meant units of 1024, instead of " 1458 "the metric 1000, for most (but not all) byte sizes.<ul><li>To reduce " 1459 "confusion you can use the recently standardized IEC units which are always in " 1460 "multiples of 1024.</li><li>You can also select metric, which is always in " 1461 "units of 1000.</li><li>Selecting JEDEC restores the older-style units used in " 1462 "KDE 3.5 and some other operating systems.</li></p>" 1463 msgstr "" 1464 "<p>Ovo mijenja jedinice koje koristi veÄina KDE-ovih programa za prikaz " 1465 "brojeva u bajtovima. Tradicionalni \"kilobajt\" je znaÄio 1024 jedinica, " 1466 "umjesto metriÄkih 1000 za veÄinu (ali ne svih) bajtnih veliÄina.<ul><li>Kako " 1467 "bi smanjili zbunjenost, moÅŸete koristiti nedavno standardizirane jedinice " 1468 "IEC-a koje su uvijek viÅ¡ekratnici od 1024.</li><li>TakoÄer moÅŸete odabrati " 1469 "metriÄke koje su uvijek u jedincama po 1000.</li><li>Odabiranjem JEDEC-a " 1470 "vraÄate stare jedinice koje su se koristile u KDE-u 3.5 i u nekim drugim " 1471 "operacijskim sustavima.</li></p>" 1116 1472 1117 1473 #. +> trunk stable -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmnic.po
r750 r1129 3 3 # Andrej DundoviÄ <adundovi@gmail.com>, 2009. 4 4 # DoDo <DoDoEntertainment@gmail.com>, 2009. 5 # Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>, 2011. 5 6 msgid "" 6 7 msgstr "" … … 8 9 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 9 10 "POT-Creation-Date: 2011-01-11 10:25+0100\n" 10 "PO-Revision-Date: 20 09-08-11 16:29+0200\n"11 "Last-Translator: DoDo <DoDoEntertainment@gmail.com>\n"11 "PO-Revision-Date: 2011-07-12 17:37+0200\n" 12 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 12 13 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" 13 14 "MIME-Version: 1.0\n" … … 15 16 "Content-Transfer-Encoding: 8bit\n" 16 17 "Language: hr\n" 17 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 18 "X-Generator: Lokalize 0.3\n" 18 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 19 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 20 "X-Generator: Lokalize 1.2\n" 19 21 "X-Environment: kde\n" 20 22 "X-Accelerator-Marker: &\n" … … 73 75 #. +> trunk stable 74 76 #: nic.cpp:112 75 #, fuzzy76 77 #| msgid "KDE Panel System Information Control Module" 77 78 msgid "System Information Control Module" 78 msgstr " KDE panel â UpravljaÄki modul podatakao sustavu"79 msgstr "UpravljaÄki modul za informacije o sustavu" 79 80 80 81 #. +> trunk stable -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmopengl.po
r1123 r1129 2 2 # 3 3 # Zarko Pintar <zarko.pintar@gmail.com>, 2009. 4 # Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>, 2011. 4 5 msgid "" 5 6 msgstr "" … … 7 8 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 8 9 "POT-Creation-Date: 2011-07-08 10:22+0200\n" 9 "PO-Revision-Date: 20 09-08-25 08:28+0200\n"10 "Last-Translator: Zarko Pintar <zarko.pintar@gmail.com>\n"10 "PO-Revision-Date: 2011-07-12 17:42+0200\n" 11 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 11 12 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" 12 13 "MIME-Version: 1.0\n" … … 14 15 "Content-Transfer-Encoding: 8bit\n" 15 16 "Language: hr\n" 16 "X-Generator: Lokalize 0.3\n" 17 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 17 "X-Generator: Lokalize 1.2\n" 18 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 19 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 18 20 "X-Environment: kde\n" 19 21 "X-Accelerator-Marker: &\n" … … 263 265 #. +> trunk stable 264 266 #: opengl.cpp:580 265 #, fuzzy266 267 #| msgid "OpenGL version" 267 268 msgid "OpenGL/ES version" 268 msgstr " openGL verzija"269 msgstr "InaÄica OpenGL/ES-a" 269 270 270 271 #. +> trunk stable … … 275 276 #. +> trunk stable 276 277 #: opengl.cpp:587 277 #, fuzzy278 278 #| msgid "OpenGL extensions" 279 279 msgid "OpenGL/ES extensions" 280 msgstr "OpenGL 280 msgstr "OpenGL/ES-proÅ¡irenja" 281 281 282 282 #. +> trunk stable … … 303 303 #: opengl.cpp:606 304 304 msgid "server GLX extensions" 305 msgstr "P roÅ¡irenja GLX posluÅŸitelja"305 msgstr "PosluÅŸiteljska GLX-proÅ¡irenja" 306 306 307 307 #. +> trunk stable … … 318 318 #: opengl.cpp:611 319 319 msgid "client GLX extensions" 320 msgstr " ProÅ¡irenja GLX klijenta"320 msgstr "Klijentska GLX-proÅ¡irenja" 321 321 322 322 #. +> trunk stable 323 323 #: opengl.cpp:613 324 324 msgid "GLX extensions" 325 msgstr "GLX 325 msgstr "GLX-proÅ¡irenja" 326 326 327 327 #. +> trunk stable … … 338 338 #: opengl.cpp:618 339 339 msgid "GLU extensions" 340 msgstr "GLU 340 msgstr "GLU-proÅ¡irenja" 341 341 342 342 #. +> trunk stable 343 343 #: opengl.cpp:627 344 #, fuzzy345 344 #| msgid "GLX" 346 345 msgid "EGL" 347 msgstr " GLX"346 msgstr "EGL" 348 347 349 348 #. +> trunk stable 350 349 #: opengl.cpp:628 351 #, fuzzy352 350 #| msgid "Vendor" 353 351 msgid "EGL Vendor" 354 msgstr " ProizvoÄaÄ"352 msgstr "Razvijatelj EGL-a" 355 353 356 354 #. +> trunk stable 357 355 #: opengl.cpp:629 358 #, fuzzy359 356 #| msgid "GLU version" 360 357 msgid "EGL Version" 361 msgstr " GLU verzija"358 msgstr "InaÄica EGL-a" 362 359 363 360 #. +> trunk stable 364 361 #: opengl.cpp:630 365 #, fuzzy366 362 #| msgid "GLX extensions" 367 363 msgid "EGL Extensions" 368 msgstr " GLXproÅ¡irenja"364 msgstr "EGL-proÅ¡irenja" 369 365 370 366 #. +> trunk stable … … 390 386 #. +> trunk stable 391 387 #: opengl.cpp:865 392 #, fuzzy393 388 #| msgid "Could not initialize OpenGL" 394 389 msgid "Could not initialize OpenGL ES2.0" 395 msgstr "Ne mogu inicijalizirati OpenGL "390 msgstr "Ne mogu inicijalizirati OpenGL ES2.0" 396 391 397 392 #. i18n: ectx: property (text), widget (QTreeWidget, glinfoTreeWidget) -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmstyle.po
r750 r1129 7 7 # Andrej Dundovic <adundovi@gmail.com>, 2009. 8 8 # Andrej DundoviÄ <adundovi@gmail.com>, 2009. 9 # Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>, 2011. 9 10 msgid "" 10 11 msgstr "" … … 12 13 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 13 14 "POT-Creation-Date: 2011-01-11 10:25+0100\n" 14 "PO-Revision-Date: 20 09-12-09 08:24+0100\n"15 "Last-Translator: Andrej DundoviÄ <adundovi@gmail.com>\n"15 "PO-Revision-Date: 2011-07-12 17:43+0200\n" 16 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 16 17 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" 17 18 "MIME-Version: 1.0\n" … … 19 20 "Content-Transfer-Encoding: 8bit\n" 20 21 "Language: hr\n" 21 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 22 "X-Generator: Lokalize 1.0\n" 22 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 23 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 24 "X-Generator: Lokalize 1.2\n" 23 25 "X-Environment: kde\n" 24 26 "X-Accelerator-Marker: &\n" … … 28 30 msgctxt "NAME OF TRANSLATORS" 29 31 msgid "Your names" 30 msgstr "Denis Lackovic, Goran Åœugelj, Mato KutliÄ, Robert Sedak, Roko Roic, Vlatko Kosturjak, Oliver Mucafir, Andrej DundoviÄ" 32 msgstr "" 33 "Denis Lackovic, Goran Åœugelj, Mato KutliÄ, Robert Sedak, Roko Roic, Vlatko " 34 "Kosturjak, Oliver Mucafir, Andrej DundoviÄ" 31 35 32 36 #. +> trunk stable 33 37 msgctxt "EMAIL OF TRANSLATORS" 34 38 msgid "Your emails" 35 msgstr "lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, oliver.untwist@gmail.com, adundovi@gmail.com" 39 msgstr "" 40 "lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, " 41 "lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, oliver." 42 "untwist@gmail.com, adundovi@gmail.com" 36 43 37 44 #. i18n: ectx: property (text), widget (QLabel, label_4) … … 102 109 #. +> trunk stable 103 110 #: kcmstyle.cpp:165 104 msgid "<h1>Style</h1>This module allows you to modify the visual appearance of user interface elements, such as the widget style and effects." 105 msgstr "<h1>Stil</h1>Ovaj modul dopuÅ¡ta vam mijenjati izgled elemenata korisniÄkog suÄelja, kao Å¡to su stilovi ukrasa i efekti." 111 msgid "" 112 "<h1>Style</h1>This module allows you to modify the visual appearance of user " 113 "interface elements, such as the widget style and effects." 114 msgstr "" 115 "<h1>Stil</h1>Ovaj modul dopuÅ¡ta vam mijenjati izgled elemenata korisniÄkog " 116 "suÄelja, kao Å¡to su stilovi ukrasa i efekti." 106 117 107 118 #. +> trunk stable … … 195 206 #: kcmstyle.cpp:297 kcmstyle.cpp:308 196 207 msgid "There was an error loading the configuration dialog for this style." 197 msgstr "DoÅ¡lo je do greÅ¡ke prilikom uÄitavanja dijaloga za podeÅ¡avanje ovog stila." 208 msgstr "" 209 "DoÅ¡lo je do greÅ¡ke prilikom uÄitavanja dijaloga za podeÅ¡avanje ovog stila." 198 210 199 211 #. +> trunk stable … … 205 217 #: kcmstyle.cpp:382 206 218 #, fuzzy 207 msgid "<p>Changes to the visibility of menu icons will only affect newly started applications.</p>" 208 msgstr "<p>Neke izmjene, poput postavki DPI-a, imat Äe uÄinak samo na novo pokrenutim aplikacijama.</p>" 219 msgid "" 220 "<p>Changes to the visibility of menu icons will only affect newly started " 221 "applications.</p>" 222 msgstr "" 223 "<p>Neke izmjene, poput postavki DPI-a, imat Äe uÄinak samo na novo pokrenutim " 224 "aplikacijama.</p>" 209 225 210 226 #. +> trunk stable … … 228 244 #. +> trunk stable 229 245 #: kcmstyle.cpp:734 230 msgid "Here you can choose from a list of predefined widget styles (e.g. the way buttons are drawn) which may or may not be combined with a theme (additional information like a marble texture or a gradient)." 231 msgstr "Ovdje moÅŸete odabrati jedan od unaprijed definiranih stilova ukrasa(izgled komponenti kao Å¡to su gumbi, padajuÄi menijiâŠ).Ovo se moÅŸe kombinirati s temom (koja dodaje dodatne efekte kao Å¡to su pozadine ili prijelazi boja)" 246 msgid "" 247 "Here you can choose from a list of predefined widget styles (e.g. the way " 248 "buttons are drawn) which may or may not be combined with a theme (additional " 249 "information like a marble texture or a gradient)." 250 msgstr "" 251 "Ovdje moÅŸete odabrati jedan od unaprijed definiranih stilova ukrasa(izgled " 252 "komponenti kao Å¡to su gumbi, padajuÄi menijiâŠ).Ovo se moÅŸe kombinirati s " 253 "temom (koja dodaje dodatne efekte kao Å¡to su pozadine ili prijelazi boja)" 232 254 233 255 #. +> trunk stable 234 256 #: kcmstyle.cpp:738 235 msgid "This area shows a preview of the currently selected style without having to apply it to the whole desktop." 236 msgstr "Ovdje moÅŸete vidjeti pregled trenutno odabaranog stila prije nego ga primjenite na cijelu radnu povrÅ¡inu." 257 msgid "" 258 "This area shows a preview of the currently selected style without having to " 259 "apply it to the whole desktop." 260 msgstr "" 261 "Ovdje moÅŸete vidjeti pregled trenutno odabaranog stila prije nego ga " 262 "primjenite na cijelu radnu povrÅ¡inu." 237 263 238 264 #. +> trunk stable … … 243 269 #. +> trunk stable 244 270 #: kcmstyle.cpp:742 245 msgid "<p><b>No Text:</b> Shows only icons on toolbar buttons. Best option for low resolutions.</p><p><b>Text Only: </b>Shows only text on toolbar buttons.</p><p><b>Text Beside Icons: </b> Shows icons and text on toolbar buttons. Text is aligned beside the icon.</p><b>Text Below Icons: </b> Shows icons and text on toolbar buttons. Text is aligned below the icon." 246 msgstr "<p><b>Bez teksta:</b> Prikazuje samo ikone na gumbima alatne trake. Najbolji izbor za niske rezolucije.</p><p><b>Samo tekst: </b>Prikazuje samo tekst gumbima alatne trake.</p><p><b>Tekst uz ikone: </b> Prikazuje ikone i tekst na gumbima alatne trake. Tekst je pokraj ikone.</p><b>Tekst ispod ikona: </b> Prikazuje ikone i tekst na gumbima alatne trake. Tekst je ispod ikone." 271 msgid "" 272 "<p><b>No Text:</b> Shows only icons on toolbar buttons. Best option for low " 273 "resolutions.</p><p><b>Text Only: </b>Shows only text on toolbar buttons.</p><" 274 "p><b>Text Beside Icons: </b> Shows icons and text on toolbar buttons. Text is " 275 "aligned beside the icon.</p><b>Text Below Icons: </b> Shows icons and text on " 276 "toolbar buttons. Text is aligned below the icon." 277 msgstr "" 278 "<p><b>Bez teksta:</b> Prikazuje samo ikone na gumbima alatne trake. Najbolji " 279 "izbor za niske rezolucije.</p><p><b>Samo tekst: </b>Prikazuje samo tekst " 280 "gumbima alatne trake.</p><p><b>Tekst uz ikone: </b> Prikazuje ikone i tekst " 281 "na gumbima alatne trake. Tekst je pokraj ikone.</p><b>Tekst ispod ikona: </b> " 282 "Prikazuje ikone i tekst na gumbima alatne trake. Tekst je ispod ikone." 247 283 248 284 #. +> trunk stable 249 285 #: kcmstyle.cpp:749 250 msgid "If you enable this option, KDE Applications will show small icons alongside some important buttons." 251 msgstr "Ako ukljuÄite ovu moguÄnost, KDE Aplikacije Äe prikazati male ikone uz neke vaÅŸne gumbe." 286 msgid "" 287 "If you enable this option, KDE Applications will show small icons alongside " 288 "some important buttons." 289 msgstr "" 290 "Ako ukljuÄite ovu moguÄnost, KDE Aplikacije Äe prikazati male ikone uz neke " 291 "vaÅŸne gumbe." 252 292 253 293 #. +> trunk stable 254 294 #: kcmstyle.cpp:751 255 #, fuzzy256 295 #| msgid "If you enable this option, KDE Applications will show small icons alongside some important buttons." 257 msgid "If you enable this option, KDE Applications will show small icons alongside most menu items." 258 msgstr "Ako ukljuÄite ovu moguÄnost, KDE Aplikacije Äe prikazati male ikone uz neke vaÅŸne gumbe." 296 msgid "" 297 "If you enable this option, KDE Applications will show small icons alongside " 298 "most menu items." 299 msgstr "" 300 "Ako ukljuÄite ovu moguÄnost, KDE-aplikacije Äe prikazati male ikone uz veÄinu " 301 "izbornih stavki." 259 302 260 303 #. +> trunk stable 261 304 #: kcmstyle.cpp:753 262 msgid "If you enable this option, KDE Applications will run internal animations." 263 msgstr "Ako ukljuÄite ovu moguÄnost, KDE Aplikacije Äe pokrenuti interne animacije." 305 msgid "" 306 "If you enable this option, KDE Applications will run internal animations." 307 msgstr "" 308 "Ako ukljuÄite ovu moguÄnost, KDE Aplikacije Äe pokrenuti interne animacije." 264 309 265 310 #. +> trunk stable -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/kurifilter.po
r1128 r1129 3 3 # DoDo <DoDoEntertainment@gmail.com>, 2009. 4 4 # Marko Dimjasevic <marko@dimjasevic.net>, 2011. 5 # Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>, 2011. 5 6 msgid "" 6 7 msgstr "" … … 8 9 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 9 10 "POT-Creation-Date: 2011-01-11 10:25+0100\n" 10 "PO-Revision-Date: 2011-0 3-04 19:21+0100\n"11 "Last-Translator: Marko Dimja sevic<marko@dimjasevic.net>\n"11 "PO-Revision-Date: 2011-07-12 17:47+0200\n" 12 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 12 13 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" 13 14 "MIME-Version: 1.0\n" … … 16 17 "Language: hr\n" 17 18 "X-Generator: Lokalize 1.2\n" 18 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 19 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 20 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 19 21 "X-Environment: kde\n" 20 22 "X-Accelerator-Marker: &\n" … … 40 42 #, fuzzy 41 43 #| msgid "<p>In this module you can configure the web shortcuts feature. Web shortcuts allow you to quickly search or lookup words on the Internet. For example, to search for information about the KDE project using the Google engine, you simply type <b>gg:KDE</b> or <b>google:KDE</b>.</p><p>If you select a default search engine, normal words or phrases will be looked up at the specified search engine by simply typing them into applications, such as Konqueror, that have built-in support for such a feature.</p>" 42 msgid "<p>In this module you can configure the web shortcuts feature. Web shortcuts allow you to quickly search or lookup words on the Internet. For example, to search for information about the KDE project using the Google engine, you simply type <b>gg:KDE</b> or <b>google:KDE</b>.</p><p>If you select a default search engine, then you can search for normal words or phrases by simply typing them into the input widget of applications that have built-in support for such a feature, e.g Konqueror.</p>" 43 msgstr "<p>U ovom modulu moÅŸete konfigurirati web preÄace. Web preÄaci Vam omoguÄuju brzo pretraÅŸivanje Interneta. Na primjer, za traÅŸenje informacija o KDE projektu pomoÄu Google traÅŸilice, jednostavno upiÅ¡ete <b>gg:KDE</b> ili <b>google:KDE</b>.</p> <p>Ako odaberete uobiÄajenu traÅŸilicu, normalne rijeÄi i fraze Äe se traÅŸiti pomoÄu te traÅŸilice ako samo upiÅ¡ete navedene u aplikacije poput Konquerora koje podrÅŸavaju web preÄace.</p>" 44 msgid "" 45 "<p>In this module you can configure the web shortcuts feature. Web shortcuts " 46 "allow you to quickly search or lookup words on the Internet. For example, to " 47 "search for information about the KDE project using the Google engine, you " 48 "simply type <b>gg:KDE</b> or <b>google:KDE</b>.</p><p>If you select a default " 49 "search engine, then you can search for normal words or phrases by simply " 50 "typing them into the input widget of applications that have built-in support " 51 "for such a feature, e.g Konqueror.</p>" 52 msgstr "" 53 "<p>U ovom modulu moÅŸete konfigurirati web preÄace. Web preÄaci Vam omoguÄuju " 54 "brzo pretraÅŸivanje Interneta. Na primjer, za traÅŸenje informacija o KDE " 55 "projektu pomoÄu Google traÅŸilice, jednostavno upiÅ¡ete <b>gg:KDE</b> ili <b>" 56 "google:KDE</b>.</p> <p>Ako odaberete uobiÄajenu traÅŸilicu, normalne rijeÄi i " 57 "fraze Äe se traÅŸiti pomoÄu te traÅŸilice ako samo upiÅ¡ete navedene u " 58 "aplikacije poput Konquerora koje podrÅŸavaju web preÄace.</p>" 44 59 45 60 #. i18n: ectx: property (whatsThis), widget (QCheckBox, cbEnableShortcuts) … … 48 63 msgid "" 49 64 "<qt>\n" 50 "Enable shortcuts that allow you to quickly search for information on the web. For example, entering the shortcut <b>gg:KDE</b> will result in a search for the word <b>KDE</b> on the Google(TM) search engine.\n" 51 "</qt>" 52 msgstr "" 53 "<qt>\n" 54 "OmoguÄite preÄace koji Vam omoguÄuju brzo pretraÅŸivanje informacija na Internetu- Na primjer, unoÅ¡enjem preÄice <b>gg:KDE</b> Äe rezultirati traÅŸenjem rijeÄi <b>KDE</b> na Google(TM) traÅŸilici.\n" 65 "Enable shortcuts that allow you to quickly search for information on the web. " 66 "For example, entering the shortcut <b>gg:KDE</b> will result in a search for " 67 "the word <b>KDE</b> on the Google(TM) search engine.\n" 68 "</qt>" 69 msgstr "" 70 "<qt>\n" 71 "OmoguÄite preÄace koji Vam omoguÄuju brzo pretraÅŸivanje informacija na " 72 "Internetu- Na primjer, unoÅ¡enjem preÄice <b>gg:KDE</b> Äe rezultirati " 73 "traÅŸenjem rijeÄi <b>KDE</b> na Google(TM) traÅŸilici.\n" 55 74 "</qt>" 56 75 … … 64 83 #. +> trunk stable 65 84 #: ikwsopts_ui.ui:32 66 #, fuzzy67 85 msgid "&Use selected shortcuts only" 68 msgstr " Pomakni prema lijevo"86 msgstr "Koristi sam&o odabrane preÄace" 69 87 70 88 #. i18n: ectx: property (whatsThis), widget (QPushButton, pbNew) … … 110 128 msgid "" 111 129 "<qt>\n" 112 "Select the search engine to use for input boxes that provide automatic lookup services when you type in normal words and phrases instead of a URL. To disable this feature select <b>None</b> from the list.\n" 113 "</qt>" 114 msgstr "" 115 "<qt>\n" 116 "Odaberite traÅŸilicu za koriÅ¡tenje u poljima koja pruÅŸaju uslugu automatske pretrage dok unosite tekst u njih umjesto URL-a. Za iskljuÄenje te moguÄnosti, odaberite <b>NiÅ¡ta</b> iz popisa.\n" 130 "Select the search engine to use for input boxes that provide automatic lookup " 131 "services when you type in normal words and phrases instead of a URL. To " 132 "disable this feature select <b>None</b> from the list.\n" 133 "</qt>" 134 msgstr "" 135 "<qt>\n" 136 "Odaberite traÅŸilicu za koriÅ¡tenje u poljima koja pruÅŸaju uslugu automatske " 137 "pretrage dok unosite tekst u njih umjesto URL-a. Za iskljuÄenje te " 138 "moguÄnosti, odaberite <b>NiÅ¡ta</b> iz popisa.\n" 117 139 "</qt>" 118 140 … … 127 149 #. +> trunk stable 128 150 #: ikwsopts_ui.ui:176 ikwsopts_ui.ui:198 129 msgid "Choose the delimiter that separates the keyword from the phrase or word to be searched." 130 msgstr "Odaberite razdvojnik koji razdvaja kljuÄnu rijeÄ od fraze ili rijeÄi koja se pretraÅŸuje." 151 msgid "" 152 "Choose the delimiter that separates the keyword from the phrase or word to be " 153 "searched." 154 msgstr "" 155 "Odaberite razdvojnik koji razdvaja kljuÄnu rijeÄ od fraze ili rijeÄi koja se " 156 "pretraÅŸuje." 131 157 132 158 #. i18n: ectx: property (text), widget (QLabel, lbDelimiter) … … 150 176 #. +> trunk stable 151 177 #: kuriikwsfilter.cpp:125 152 #, fuzzy153 178 msgid "No preferred search providers were found." 154 msgstr " nije pronaÄen valjani rukovoditelj pretraÅŸivanja."179 msgstr "Nije pronaÄen ni jedan preferirani pretraÅŸivaÄki pruÅŸatelj." 155 180 156 181 #. +> trunk stable 157 182 #: kuriikwsfilter.cpp:144 158 #, fuzzy159 183 msgid "No search providers were found." 160 msgstr "N ova pretraga za pruÅŸateljem usluga"184 msgstr "Nije pronaÄen ni jedan pretraÅŸivaÄki pruÅŸatelj." 161 185 162 186 #. +> trunk stable … … 182 206 #. +> trunk stable 183 207 #: searchproviderdlg.cpp:106 184 #, fuzzy, kde-format 185 msgid "The shortcut \"%1\" is already assigned to \"%2\". Please choose a different one." 186 msgstr "Nadimak je veÄ u upotrebi. Odaberite drugi nadimak." 208 #, kde-format 209 msgid "" 210 "The shortcut \"%1\" is already assigned to \"%2\". Please choose a different " 211 "one." 212 msgstr "" 213 "PreÄac \"%1\" je veÄ pridruÅŸen na \"%2\". Molim odaberite drugaÄiji preÄac." 187 214 188 215 #. +> trunk stable … … 205 232 msgid "" 206 233 "The URI does not contain a \\{...} placeholder for the user query.\n" 207 "This means that the same page is always going to be visited, regardless of what the user types." 234 "This means that the same page is always going to be visited, regardless of " 235 "what the user types." 208 236 msgstr "" 209 237 "URI ne sadrÅŸi \\âŠ} oznaku za korisniÄki upit.\n" … … 238 266 msgid "" 239 267 "<qt>\n" 240 "Enter the URI that is used to perform a search on the search engine here.<br/>The whole text to be searched for can be specified as \\{@} or \\{0}.<br/>\n" 241 "Recommended is \\{@}, since it removes all query variables (name=value) from the resulting string, whereas \\{0} will be substituted with the unmodified query string.<br/>You can use \\{1} ... \\{n} to specify certain words from the query and \\{name} to specify a value given by 'name=value' in the user query.<br/>In addition it is possible to specify multiple references (names, numbers and strings) at once (\\{name1,name2,...,\"string\"}).<br/>The first matching value (from the left) will be used as the substitution value for the resulting URI.<br/>A quoted string can be used as the default value if nothing matches from the left of the reference list.\n" 242 "</qt>" 243 msgstr "" 244 "<qt>\n" 245 "Ovdje unesite URI koji se koristi za traÅŸenje na traÅŸilici.<br/> Cijeli tekst za pretragu se moÅŸe odrediti kao \\{@} ili \\{0}.<br/> \n" 246 "PreporuÄeno je \\{@}, jer on ukloni sve varijable upita (ime=vrijednost) iz rezultata, dok Äe \\{0} biti zamijenjen sa nepromijenjenim upitom.<br/> MoÅŸete koristiti \\{1}⊠\\{n} za specificiranje odreÄenih rijeÄi iz upita i \\{ime} za specificiranje vrijednosti dobivene kao 'ime=vrijednost' iz korisniÄkog upita.<br/> TakoÄer je moguÄe specificirati viÅ¡e referenci (imena, brojevi i tekstovi) odjednom (\\{ime1, ime2,âŠ, \"neki nekst\"}).<br/> Prva podudarna vrijednost (s lijeva) Äe se koristiti kao zamjenska vrijednost za rezultirajuÄi URI.<br/> Tekst pod navodnicima se moÅŸe koristiti kao uobiÄajena vrijednost ako se niÅ¡ta iz referentnog popisa ne podudara s lijeva.\n" 268 "Enter the URI that is used to perform a search on the search engine here.<br/>" 269 "The whole text to be searched for can be specified as \\{@} or \\{0}.<br/>\n" 270 "Recommended is \\{@}, since it removes all query variables (name=value) from " 271 "the resulting string, whereas \\{0} will be substituted with the unmodified " 272 "query string.<br/>You can use \\{1} ... \\{n} to specify certain words from " 273 "the query and \\{name} to specify a value given by 'name=value' in the user " 274 "query.<br/>In addition it is possible to specify multiple references (names, " 275 "numbers and strings) at once (\\{name1,name2,...,\"string\"}).<br/>The first " 276 "matching value (from the left) will be used as the substitution value for the " 277 "resulting URI.<br/>A quoted string can be used as the default value if " 278 "nothing matches from the left of the reference list.\n" 279 "</qt>" 280 msgstr "" 281 "<qt>\n" 282 "Ovdje unesite URI koji se koristi za traÅŸenje na traÅŸilici.<br/> Cijeli tekst " 283 "za pretragu se moÅŸe odrediti kao \\{@} ili \\{0}.<br/> \n" 284 "PreporuÄeno je \\{@}, jer on ukloni sve varijable upita (ime=vrijednost) iz " 285 "rezultata, dok Äe \\{0} biti zamijenjen sa nepromijenjenim upitom.<br/> " 286 "MoÅŸete koristiti \\{1}⊠\\{n} za specificiranje odreÄenih rijeÄi iz upita i " 287 "\\{ime} za specificiranje vrijednosti dobivene kao 'ime=vrijednost' iz " 288 "korisniÄkog upita.<br/> TakoÄer je moguÄe specificirati viÅ¡e referenci " 289 "(imena, brojevi i tekstovi) odjednom (\\{ime1, ime2,âŠ, \"neki nekst\"}).<br/> " 290 "Prva podudarna vrijednost (s lijeva) Äe se koristiti kao zamjenska vrijednost " 291 "za rezultirajuÄi URI.<br/> Tekst pod navodnicima se moÅŸe koristiti kao " 292 "uobiÄajena vrijednost ako se niÅ¡ta iz referentnog popisa ne podudara s lijeva." 293 "\n" 247 294 "</qt>" 248 295 … … 261 308 msgid "" 262 309 "<qt>\n" 263 "The shortcuts entered here can be used as a pseudo-URI scheme in KDE. For example, the shortcut <b>av</b> can be used as in <b>av</b>:<b>my search</b>\n" 264 "</qt>" 265 msgstr "" 266 "<qt>\n" 267 "Ovdje uneseni preÄaci mogu biti koriÅ¡teni kao polu-URI shema u KDE-u. Na primjer, preÄac <b>av</b> moÅŸe biti koriÅ¡ten kao u <b>av</b>:<b>moja pretraga</b>\n" 310 "The shortcuts entered here can be used as a pseudo-URI scheme in KDE. For " 311 "example, the shortcut <b>av</b> can be used as in <b>av</b>:<b>my search</b>\n" 312 "</qt>" 313 msgstr "" 314 "<qt>\n" 315 "Ovdje uneseni preÄaci mogu biti koriÅ¡teni kao polu-URI shema u KDE-u. Na " 316 "primjer, preÄac <b>av</b> moÅŸe biti koriÅ¡ten kao u <b>av</b>:<b>moja " 317 "pretraga</b>\n" 268 318 "</qt>" 269 319 … … 278 328 #: searchproviderdlg_ui.ui:119 279 329 msgid "Select the character set that will be used to encode your search query" 280 msgstr "Odaberite skup znakova koji Äe biti koriÅ¡ten za kodiranje VaÅ¡eg upita traÅŸilici" 330 msgstr "" 331 "Odaberite skup znakova koji Äe biti koriÅ¡ten za kodiranje VaÅ¡eg upita " 332 "traÅŸilici" 281 333 282 334 #. i18n: ectx: property (text), widget (QLabel, lbCharset) … … 290 342 #: searchproviderdlg_ui.ui:141 291 343 msgid "Select the character set that will be used to encode your search query." 292 msgstr "Odaberite skup znakova koji Äe biti koriÅ¡ten za kodiranje VaÅ¡eg upita traÅŸilici." 344 msgstr "" 345 "Odaberite skup znakova koji Äe biti koriÅ¡ten za kodiranje VaÅ¡eg upita " 346 "traÅŸilici." 293 347 294 348 #~ msgid "<p>In this module you can configure the web shortcuts feature. Web shortcuts allow you to quickly search or lookup words on the Internet. For example, to search for information about the KDE project using the Google engine, you simply type <b>gg:KDE</b> or <b>google:KDE</b>.</p><p>If you select a default search engine, normal words or phrases will be looked up at the specified search engine by simply typing them into applications, such as Konqueror, that have built-in support for such a feature.</p>" -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/kwin.po
r1124 r1129 12 12 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 13 13 "POT-Creation-Date: 2011-07-10 07:56+0200\n" 14 "PO-Revision-Date: 2011-0 4-20 22:35+0200\n"14 "PO-Revision-Date: 2011-07-12 17:48+0200\n" 15 15 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 16 16 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" … … 19 19 "Content-Transfer-Encoding: 8bit\n" 20 20 "Language: hr\n" 21 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 21 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 22 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 22 23 "X-Generator: Lokalize 1.2\n" 23 24 "X-Poedit-Bookmarks: 110,-1,-1,-1,-1,-1,-1,-1,-1,-1\n" … … 34 35 msgctxt "EMAIL OF TRANSLATORS" 35 36 msgid "Your emails" 36 msgstr "renato@translator-shop.org, zarko.pintar@gmail.com, adundovi@gmail.com, marko@dimjasevic.net" 37 msgstr "" 38 "renato@translator-shop.org, zarko.pintar@gmail.com, adundovi@gmail.com, " 39 "marko@dimjasevic.net" 37 40 38 41 #. +> trunk stable … … 45 48 #: composite.cpp:279 46 49 #, kde-format 47 msgid "Desktop effects have been suspended by another application.<br/>You can resume using the '%1' shortcut." 48 msgstr "Druga je aplikacija obustavila efekte radne povrÅ¡ine.<br/>MoÅŸete ih vratiti koristeÄi preÄac '%1'." 50 msgid "" 51 "Desktop effects have been suspended by another application.<br/>You can " 52 "resume using the '%1' shortcut." 53 msgstr "" 54 "Druga je aplikacija obustavila efekte radne povrÅ¡ine.<br/>MoÅŸete ih vratiti " 55 "koristeÄi preÄac '%1'." 49 56 50 57 #. +> stable … … 52 59 msgid "" 53 60 "Desktop effects were too slow and have been suspended.\n" 54 "You can disable functionality checks in System Settings (on the Advanced tab in Desktop Effects)." 61 "You can disable functionality checks in System Settings (on the Advanced tab " 62 "in Desktop Effects)." 55 63 msgstr "" 56 64 "3D efekti bili su prespori pa su obustavljeni.\n" 57 "MoÅŸete onemoguÄiti provjere funkcionalnosti u Postavkama sustava (unutar kartice Napredno kod 3D efekata)." 65 "MoÅŸete onemoguÄiti provjere funkcionalnosti u Postavkama sustava (unutar " 66 "kartice Napredno kod 3D efekata)." 58 67 59 68 #. +> stable … … 62 71 msgid "" 63 72 "Desktop effects were too slow and have been suspended.\n" 64 "If this was only a temporary problem, you can resume using the '%1' shortcut.\n" 65 "You can disable functionality checks in System Settings (on the Advanced tab in Desktop Effects)." 73 "If this was only a temporary problem, you can resume using the '%1' shortcut." 74 "\n" 75 "You can disable functionality checks in System Settings (on the Advanced tab " 76 "in Desktop Effects)." 66 77 msgstr "" 67 78 "3D efekti bili su prespori pa su obustavljeni.\n" 68 79 "Ako je ovo samo privremeni problem, moÅŸete ih vratiti koristeÄi preÄac '%1'.\n" 69 "TakoÄer moÅŸete onemoguÄiti provjere funkcionalnosti u Postavkama sustava (unutar kartice Napredno kod 3D efekata)." 80 "TakoÄer moÅŸete onemoguÄiti provjere funkcionalnosti u Postavkama sustava " 81 "(unutar kartice Napredno kod 3D efekata)." 70 82 71 83 #. +> trunk stable 72 84 #: compositingprefs.cpp:108 73 msgid "<b>OpenGL compositing (the default) has crashed KWin in the past.</b><br>This was most likely due to a driver bug.<p>If you think that you have meanwhile upgraded to a stable driver,<br>you can reset this protection but <b>be aware that this might result in an immediate crash!</b></p><p>Alternatively, you might want to use the XRender backend instead.</p>" 85 msgid "" 86 "<b>OpenGL compositing (the default) has crashed KWin in the past.</b><br>This " 87 "was most likely due to a driver bug.<p>If you think that you have meanwhile " 88 "upgraded to a stable driver,<br>you can reset this protection but <b>be aware " 89 "that this might result in an immediate crash!</b></p><p>Alternatively, you " 90 "might want to use the XRender backend instead.</p>" 74 91 msgstr "" 75 92 … … 86 103 #. +> trunk stable 87 104 #: compositingprefs.cpp:123 88 msgid "XRender/XFixes extensions are not available and only XRender support is compiled." 105 msgid "" 106 "XRender/XFixes extensions are not available and only XRender support is " 107 "compiled." 89 108 msgstr "XRender/XFixes proÅ¡irenja nisu dostupna, podrÅŸan je samo XRender." 90 109 … … 151 170 #: killer/killer.cpp:70 152 171 #, kde-format 153 msgid "<p>The window \"<b>%2</b>\" is not responding. It belongs to the application <b>%1</b> (Process ID = %3, hostname = %4).</p><p>Do you wish to terminate the application process <em>including <b>all</b> of its child windows</em>?<br /><b>Any unsaved data will be lost.</b></p>" 154 msgstr "<p>Prozor \"<b>%2</b>\" nema odziva. Pripada aplikaciji <b>%1</b> (Proces ID = %3, ime raÄunala = %4).</p><p>Da li ÅŸelite prekinuti proces ove aplikacije <em>ukljuÄujuÄi <b>sve</b> prozore koji joj pripadaju</em>?<br /><b>Svi nespremljeni podaci biti Äe izgubljeni.</b></p>" 172 msgid "" 173 "<p>The window \"<b>%2</b>\" is not responding. It belongs to the application " 174 "<b>%1</b> (Process ID = %3, hostname = %4).</p><p>Do you wish to terminate " 175 "the application process <em>including <b>all</b> of its child windows</em>?<" 176 "br /><b>Any unsaved data will be lost.</b></p>" 177 msgstr "" 178 "<p>Prozor \"<b>%2</b>\" nema odziva. Pripada aplikaciji <b>%1</b> (Proces ID " 179 "= %3, ime raÄunala = %4).</p><p>Da li ÅŸelite prekinuti proces ove aplikacije " 180 "<em>ukljuÄujuÄi <b>sve</b> prozore koji joj pripadaju</em>?<br /><b>Svi " 181 "nespremljeni podaci biti Äe izgubljeni.</b></p>" 155 182 156 183 #. +> trunk stable … … 382 409 #. +> trunk stable 383 410 #: kwinbindings.cpp:147 384 #, fuzzy,kde-format411 #, kde-format 385 412 #| msgid "Window to Desktop 1" 386 413 msgid "Window to Desktop %1" 387 msgstr "Prozor na radnu povrÅ¡inu 1"414 msgstr "Prozor na radnu povrÅ¡inu %1" 388 415 389 416 #. +> trunk stable … … 419 446 #. +> trunk stable 420 447 #: kwinbindings.cpp:157 421 #, fuzzy,kde-format448 #, kde-format 422 449 #| msgid "Window to Screen 1" 423 450 msgid "Window to Screen %1" 424 msgstr "Prozor na zaslon 1"451 msgstr "Prozor na zaslon %1" 425 452 426 453 #. +> trunk stable … … 441 468 #. +> trunk stable 442 469 #: kwinbindings.cpp:169 443 #, fuzzy,kde-format470 #, kde-format 444 471 msgid "Switch to Desktop %1" 445 472 msgstr "Prebaci na radnu povrÅ¡inu %1" … … 477 504 #. +> trunk stable 478 505 #: kwinbindings.cpp:180 479 #, fuzzy,kde-format506 #, kde-format 480 507 #| msgid "Switch to Screen 1" 481 508 msgid "Switch to Screen %1" 482 msgstr "Prebaci na zaslon 1"509 msgstr "Prebaci na zaslon %1" 483 510 484 511 #. +> trunk stable … … 579 606 #. +> trunk stable 580 607 #: main.cpp:179 581 msgid "kwin: it looks like there's already a window manager running. kwin not started.\n" 582 msgstr "kwin: izgleda da je upravitelj prozora veÄ pokrenut. kwin nije pokrenut.\n" 608 msgid "" 609 "kwin: it looks like there's already a window manager running. kwin not " 610 "started.\n" 611 msgstr "" 612 "kwin: izgleda da je upravitelj prozora veÄ pokrenut. kwin nije pokrenut.\n" 583 613 584 614 #. +> trunk stable … … 595 625 #. +> trunk stable 596 626 #: main.cpp:264 597 msgid "kwin: unable to claim manager selection, another wm running? (try using --replace)\n" 598 msgstr "kwin: ne mogu izvrÅ¡iti zahtjev za odabir upravitelja, moÅŸda je drugi upravitelj pokrenut? (pokuÅ¡ajte koristiti --replace)\n" 627 msgid "" 628 "kwin: unable to claim manager selection, another wm running? (try using " 629 "--replace)\n" 630 msgstr "" 631 "kwin: ne mogu izvrÅ¡iti zahtjev za odabir upravitelja, moÅŸda je drugi " 632 "upravitelj pokrenut? (pokuÅ¡ajte koristiti --replace)\n" 599 633 600 634 #. +> trunk stable … … 915 949 msgid "" 916 950 "You have selected to show a window without its border.\n" 917 "Without the border, you will not be able to enable the border again using the mouse: use the window operations menu instead, activated using the %1 keyboard shortcut." 951 "Without the border, you will not be able to enable the border again using the " 952 "mouse: use the window operations menu instead, activated using the %1 " 953 "keyboard shortcut." 918 954 msgstr "" 919 955 "Odabrali ste prikazivanje prozora bez njegovog ruba.\n" 920 "Bez ruba, neÄete moÄi ponovo ukljuÄiti rub miÅ¡em. Umjesto toga upotrebite izbornik prozorskih operacija, koji se aktivira preÄacom tipkovnice %1." 956 "Bez ruba, neÄete moÄi ponovo ukljuÄiti rub miÅ¡em. Umjesto toga upotrebite " 957 "izbornik prozorskih operacija, koji se aktivira preÄacom tipkovnice %1." 921 958 922 959 #. +> trunk stable … … 925 962 msgid "" 926 963 "You have selected to show a window in fullscreen mode.\n" 927 "If the application itself does not have an option to turn the fullscreen mode off you will not be able to disable it again using the mouse: use the window operations menu instead, activated using the %1 keyboard shortcut." 964 "If the application itself does not have an option to turn the fullscreen mode " 965 "off you will not be able to disable it again using the mouse: use the window " 966 "operations menu instead, activated using the %1 keyboard shortcut." 928 967 msgstr "" 929 968 "Odabrali ste prikazivanje prozora preko cijelog zaslona.\n" 930 "Ako sâm program nema opciju da se naÄin rada preko cijelog zaslona iskljuÄi, neÄete ga moÄi iskljuÄiti upotrebom miÅ¡a. Umjesto toga upotrebite izbornik prozorskih operacija, koji se aktivira preÄacom tipkovnice %1." 969 "Ako sâm program nema opciju da se naÄin rada preko cijelog zaslona iskljuÄi, " 970 "neÄete ga moÄi iskljuÄiti upotrebom miÅ¡a. Umjesto toga upotrebite izbornik " 971 "prozorskih operacija, koji se aktivira preÄacom tipkovnice %1." 931 972 932 973 #~ msgid "Window to Desktop 1" -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/kwin_clients.po
r1123 r1129 12 12 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 13 13 "POT-Creation-Date: 2011-07-08 10:23+0200\n" 14 "PO-Revision-Date: 2011-0 3-14 20:32+0100\n"14 "PO-Revision-Date: 2011-07-12 17:49+0200\n" 15 15 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 16 16 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" … … 20 20 "Language: hr\n" 21 21 "X-Generator: Lokalize 1.2\n" 22 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 22 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 23 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 23 24 "X-Environment: kde\n" 24 25 "X-Accelerator-Marker: &\n" … … 152 153 #. +> trunk stable 153 154 #: b2/config/config.cpp:61 154 msgid "When selected, the window borders are drawn using the titlebar colors; otherwise, they are drawn using normal border colors." 155 msgstr "Kada je oznaÄeno, rubovi prozora iscrtavati Äe se koristeÄi boje naslovne trake; inaÄe Äe se iscrtavati koristeÄi uobiÄajene boje ruba." 155 msgid "" 156 "When selected, the window borders are drawn using the titlebar colors; " 157 "otherwise, they are drawn using normal border colors." 158 msgstr "" 159 "Kada je oznaÄeno, rubovi prozora iscrtavati Äe se koristeÄi boje naslovne " 160 "trake; inaÄe Äe se iscrtavati koristeÄi uobiÄajene boje ruba." 156 161 157 162 #. +> trunk stable … … 162 167 #. +> trunk stable 163 168 #: b2/config/config.cpp:69 164 msgid "When selected, decorations are drawn with a \"grab handle\" in the bottom right corner of the windows; otherwise, no grab handle is drawn." 165 msgstr "Kada je oznaÄeno, ukrasi Äe biti iscrtani sa \"oznakom uhvati\" u donjem desnom kutu prozora; inaÄe se neÄe iscratvati oznaka hvatanja." 169 msgid "" 170 "When selected, decorations are drawn with a \"grab handle\" in the bottom " 171 "right corner of the windows; otherwise, no grab handle is drawn." 172 msgstr "" 173 "Kada je oznaÄeno, ukrasi Äe biti iscrtani sa \"oznakom uhvati\" u donjem " 174 "desnom kutu prozora; inaÄe se neÄe iscratvati oznaka hvatanja." 166 175 167 176 #. +> trunk stable … … 172 181 #. +> trunk stable 173 182 #: b2/config/config.cpp:77 174 msgid "When selected, titlebars are automatically relocated to visible positions; otherwise, they are only moved manually using shift+drag." 175 msgstr "Kad je odabrano, naslovne su trake automatski relocirane na vidljive pozicije; u suprotnom, moguÄe ih je samo ruÄno pomicati koristeÄi shift+povlaÄenje." 183 msgid "" 184 "When selected, titlebars are automatically relocated to visible positions; " 185 "otherwise, they are only moved manually using shift+drag." 186 msgstr "" 187 "Kad je odabrano, naslovne su trake automatski relocirane na vidljive " 188 "pozicije; u suprotnom, moguÄe ih je samo ruÄno pomicati koristeÄi " 189 "shift+povlaÄenje." 176 190 177 191 #. +> trunk stable … … 207 221 #. +> trunk stable 208 222 #: b2/config/config.cpp:93 209 msgid "An action can be associated to a double click of the menu button. Leave it to none if in doubt." 210 msgstr "Radnja moÅŸe biti pridruÅŸena dvostrukom kliku gumba izbornika. Ostavite na niÅ¡ta ako se dvoumite." 223 msgid "" 224 "An action can be associated to a double click of the menu button. Leave it to " 225 "none if in doubt." 226 msgstr "" 227 "Radnja moÅŸe biti pridruÅŸena dvostrukom kliku gumba izbornika. Ostavite na " 228 "niÅ¡ta ako se dvoumite." 211 229 212 230 #. +> trunk stable … … 217 235 #. +> trunk 218 236 #: oxygen/config/oxygenconfigurationui.cpp:145 219 #, fuzzy220 237 msgid "Hide Advanced Configuration Options" 221 msgstr " Izvorni kod"238 msgstr "Sakrij napredne opcije podeÅ¡avanja" 222 239 223 240 #. +> trunk 224 241 #: oxygen/config/oxygenconfigurationui.cpp:145 225 #, fuzzy226 242 msgid "Show Advanced Configuration Options" 227 msgstr " Nema opcija za konfiguriranje"243 msgstr "PrikaÅŸi napredne opcije podeÅ¡avanja" 228 244 229 245 #. +> trunk stable … … 792 808 #. +> trunk stable 793 809 #: plastik/config/configdialog.ui:53 794 msgid "Check this option if the window border should be painted in the titlebar color. Otherwise it will be painted in the background color." 795 msgstr "OznaÄite ovu opciju kako bi rub prozora bio obojan u boju naslovne trake. InaÄe Äe biti obojan u boju pozadine." 810 msgid "" 811 "Check this option if the window border should be painted in the titlebar " 812 "color. Otherwise it will be painted in the background color." 813 msgstr "" 814 "OznaÄite ovu opciju kako bi rub prozora bio obojan u boju naslovne trake. " 815 "InaÄe Äe biti obojan u boju pozadine." 796 816 797 817 #. i18n: ectx: property (text), widget (QCheckBox, coloredBorder) … … 804 824 #. +> trunk stable 805 825 #: plastik/config/configdialog.ui:66 806 msgid "Check this option if you want the titlebar text to have a 3D look with a shadow behind it." 807 msgstr "OznaÄite ovu opciju ako ÅŸelite da tekst naslovne trake ima 3D izgled sa sjenom ispod. " 826 msgid "" 827 "Check this option if you want the titlebar text to have a 3D look with a " 828 "shadow behind it." 829 msgstr "" 830 "OznaÄite ovu opciju ako ÅŸelite da tekst naslovne trake ima 3D izgled sa " 831 "sjenom ispod. " 808 832 809 833 #. i18n: ectx: property (text), widget (QCheckBox, titleShadow) … … 816 840 #. +> trunk stable 817 841 #: plastik/config/configdialog.ui:76 818 msgid "Check this option if you want the buttons to fade in when the mouse pointer hovers over them and fade out again when it moves away." 819 msgstr "OznaÄite ovu opciju ako ÅŸelite da se gumbi naglase kada se prijeÄe preko njih miÅ¡em i ponovo izblijede kada se miÅ¡ makne." 842 msgid "" 843 "Check this option if you want the buttons to fade in when the mouse pointer " 844 "hovers over them and fade out again when it moves away." 845 msgstr "" 846 "OznaÄite ovu opciju ako ÅŸelite da se gumbi naglase kada se prijeÄe preko njih " 847 "miÅ¡em i ponovo izblijede kada se miÅ¡ makne." 820 848 821 849 #. i18n: ectx: property (text), widget (QCheckBox, animateButtons) … … 828 856 #. +> trunk stable 829 857 #: plastik/config/configdialog.ui:86 830 msgid "Check this option if you want windows to be closed when you double click the menu button, similar to Microsoft Windows." 831 msgstr "OznaÄite ovu opciju ako ÅŸelite da se prozori zatvore kada dvaput kliknete na gumb izbornika, sliÄno kao u Microsoft Windows-ima." 858 msgid "" 859 "Check this option if you want windows to be closed when you double click the " 860 "menu button, similar to Microsoft Windows." 861 msgstr "" 862 "OznaÄite ovu opciju ako ÅŸelite da se prozori zatvore kada dvaput kliknete na " 863 "gumb izbornika, sliÄno kao u Microsoft Windows-ima." 832 864 833 865 #. i18n: ectx: property (text), widget (QCheckBox, menuClose) -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/kwin_effects.po
r1123 r1129 12 12 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 13 13 "POT-Creation-Date: 2011-07-08 10:23+0200\n" 14 "PO-Revision-Date: 2011-0 3-14 20:48+0100\n"14 "PO-Revision-Date: 2011-07-12 17:50+0200\n" 15 15 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 16 16 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" … … 19 19 "Content-Transfer-Encoding: 8bit\n" 20 20 "Language: hr\n" 21 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 21 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 22 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 22 23 "X-Generator: Lokalize 1.2\n" 23 24 "X-Environment: kde\n" … … 202 203 #. +> trunk stable 203 204 #: coverswitch/coverswitch_config.ui:187 204 msgid "Only show thumbnail bar if there are at least specified number of windows" 205 msgid "" 206 "Only show thumbnail bar if there are at least specified number of windows" 205 207 msgstr "PrikaÅŸi traku sa sliÄicama samo ako postoji neki odreÄeni broj prozora" 206 208 … … 414 416 #: cube/cube_config.ui:411 415 417 msgid "" 416 "If enabled the effect will be deactivated after rotating the cube with the mouse,\n" 418 "If enabled the effect will be deactivated after rotating the cube with the " 419 "mouse,\n" 417 420 "otherwise it will remain active" 418 421 msgstr "" … … 1456 1459 #: zoom/zoom_config.ui:25 zoom/zoom_config.ui:41 1457 1460 msgid "On zoom-in and zoom-out change the zoom by the defined zoom-factor." 1458 msgstr "Pri pribliÅŸavanju ili udaljavanju promijeni zoom za definirani faktor zumiranja." 1461 msgstr "" 1462 "Pri pribliÅŸavanju ili udaljavanju promijeni zoom za definirani faktor " 1463 "zumiranja." 1459 1464 1460 1465 #. i18n: ectx: property (text), widget (QLabel, label) … … 1467 1472 #. +> trunk stable 1468 1473 #: zoom/zoom_config.ui:66 1469 msgid "Enable tracking of the focused location. This needs QAccessible to be enabled per application (\"export QT_ACCESSIBILITY=1\")." 1470 msgstr "OmoguÄi praÄenje fokusirane lokacije. Za ovo treba biti omoguÄeno QAccessible po aplikaciji (\"export QT_ACCESSIBILITY=1\")." 1474 msgid "" 1475 "Enable tracking of the focused location. This needs QAccessible to be enabled " 1476 "per application (\"export QT_ACCESSIBILITY=1\")." 1477 msgstr "" 1478 "OmoguÄi praÄenje fokusirane lokacije. Za ovo treba biti omoguÄeno QAccessible " 1479 "po aplikaciji (\"export QT_ACCESSIBILITY=1\")." 1471 1480 1472 1481 #. i18n: ectx: property (text), widget (QCheckBox, focusTrackingCheckBox) … … 1539 1548 #. +> trunk stable 1540 1549 #: zoom/zoom_config.ui:138 1541 #, fuzzy1542 1550 msgid "Push" 1543 msgstr " Pushto"1551 msgstr "Guranje" 1544 1552 1545 1553 #. i18n: ectx: property (text), item, widget (QComboBox, mouseTrackingComboBox) -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/kxkb.po
r1123 r1129 3 3 # DoDo <DoDoEntertainment@gmail.com>, 2009. 4 4 # Andrej Dundovic <adundovi@gmail.com>, 2009, 2010. 5 # Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>, 2011. 5 6 msgid "" 6 7 msgstr "" … … 8 9 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 9 10 "POT-Creation-Date: 2011-07-08 10:23+0200\n" 10 "PO-Revision-Date: 201 0-03-18 11:06+0100\n"11 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"11 "PO-Revision-Date: 2011-07-12 17:54+0200\n" 12 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 12 13 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" 13 14 "MIME-Version: 1.0\n" … … 15 16 "Content-Transfer-Encoding: 8bit\n" 16 17 "Language: hr\n" 17 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 18 "X-Generator: Lokalize 1.0\n" 18 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 19 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 20 "X-Generator: Lokalize 1.2\n" 19 21 "X-Environment: kde\n" 20 22 "X-Accelerator-Marker: &\n" … … 23 25 #. +> trunk stable 24 26 #: flags.cpp:132 25 #, fuzzy,kde-format27 #, kde-format 26 28 msgctxt "short layout label - full layout name" 27 29 msgid "%1 - %2" 28 msgstr "%1 â%2"30 msgstr "%1 - %2" 29 31 30 32 #. +> trunk stable 31 33 #: flags.cpp:140 32 #, fuzzy,kde-format34 #, kde-format 33 35 msgctxt "layout - variant" 34 36 msgid "%1 - %2" 35 msgstr "%1 â%2"37 msgstr "%1 - %2" 36 38 37 39 #. +> trunk stable … … 58 60 #. +> trunk stable 59 61 #: kcm_keyboard.cpp:58 60 msgid "<h1>Keyboard</h1> This control module can be used to configure keyboard parameters and layouts." 61 msgstr "<h1>Tipkovnica</h1> Ovaj kontrolni modul moÅŸe biti koriÅ¡ten za podeÅ¡avanje parametara i rasporeda tipkovnice." 62 msgid "" 63 "<h1>Keyboard</h1> This control module can be used to configure keyboard " 64 "parameters and layouts." 65 msgstr "" 66 "<h1>Tipkovnica</h1> Ovaj kontrolni modul moÅŸe biti koriÅ¡ten za podeÅ¡avanje " 67 "parametara i rasporeda tipkovnice." 62 68 63 69 #. +> trunk stable … … 69 75 #. +> trunk stable 70 76 #: kcm_keyboard_widget.cpp:203 71 #, fuzzy,kde-format77 #, kde-format 72 78 #| msgctxt "vendor, keyboard model" 73 79 #| msgid "%1 | %2" … … 78 84 #. +> trunk stable 79 85 #: kcm_keyboard_widget.cpp:213 80 #, fuzzy,kde-format86 #, kde-format 81 87 msgid "Only up to %1 keyboard layout is supported" 82 88 msgid_plural "Only up to %1 keyboard layouts are supported" 83 msgstr[0] "PodrÅŸan e su samo lokalne datoteke."84 msgstr[1] "PodrÅŸan e su samo lokalne datoteke."85 msgstr[2] "PodrÅŸan e su samo lokalne datoteke."89 msgstr[0] "PodrÅŸano je samo do %1 raspored tipkovnice" 90 msgstr[1] "PodrÅŸano je samo do %1 rasporeda tipkovnice" 91 msgstr[2] "PodrÅŸano je samo do %1 rasporeda tipkovnice" 86 92 87 93 #. +> trunk stable 88 94 #: kcm_keyboard_widget.cpp:561 89 #, fuzzy90 95 msgctxt "no shortcuts defined" 91 96 msgid "None" … … 94 99 #. +> trunk stable 95 100 #: kcm_keyboard_widget.cpp:577 96 #, fuzzy,kde-format101 #, kde-format 97 102 #| msgid "%1 shortcuts" 98 103 msgid "%1 shortcut" 99 104 msgid_plural "%1 shortcuts" 100 105 msgstr[0] "%1 preÄac" 101 msgstr[1] "%1 preÄac" 102 msgstr[2] "%1 preÄac" 103 104 #. +> trunk stable 105 #: kcm_view_models.cpp:225 106 #, fuzzy 106 msgstr[1] "%1 preÄaca" 107 msgstr[2] "%1 preÄaca" 108 109 #. +> trunk stable 110 #: kcm_view_models.cpp:225 107 111 #| msgid "Map" 108 112 msgctxt "layout map name" 109 113 msgid "Map" 110 msgstr " Mapiranje"114 msgstr "Preslikavanje" 111 115 112 116 #. +> trunk stable … … 127 131 #. +> trunk stable 128 132 #: kcm_view_models.cpp:225 129 #, fuzzy130 133 msgid "Shortcut" 131 134 msgstr "PreÄac" … … 133 136 #. +> trunk stable 134 137 #: keyboard_applet.cpp:52 135 #, fuzzy136 138 msgid "XKB extension failed to initialize" 137 msgstr " Biblioteka libsmbclient nije uspjeÅ¡no inicijalizirana."139 msgstr "XKB-ovo proÅ¡irenje nije se uspjelo inicijalizirati" 138 140 139 141 #. +> trunk stable 140 142 #: layout_tray_icon.cpp:46 layout_tray_icon.cpp:47 141 #, fuzzy142 143 #| msgid "Keyboard Layout" 143 144 msgctxt "tooltip title" -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/libkdecorations.po
r1123 r1129 3 3 # Zarko Pintar <zarko.pintar@gmail.com>, 2009. 4 4 # Andrej Dundovic <adundovi@gmail.com>, 2010. 5 # Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>, 2011. 5 6 msgid "" 6 7 msgstr "" … … 8 9 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 9 10 "POT-Creation-Date: 2011-07-08 10:23+0200\n" 10 "PO-Revision-Date: 201 0-05-30 16:30+0200\n"11 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"11 "PO-Revision-Date: 2011-07-12 17:55+0200\n" 12 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 12 13 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" 13 14 "MIME-Version: 1.0\n" … … 15 16 "Content-Transfer-Encoding: 8bit\n" 16 17 "Language: hr\n" 17 "X-Generator: Lokalize 1.0\n" 18 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 18 "X-Generator: Lokalize 1.2\n" 19 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 20 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 19 21 "X-Environment: kde\n" 20 22 "X-Accelerator-Marker: &\n" … … 101 103 #. +> trunk stable 102 104 #: kdecoration_plugins_p.cpp:109 103 #, fuzzy104 105 #| msgid "No window decoration plugin library was found." 105 106 msgid "Loading of window decoration plugin library disabled in configuration." 106 msgstr "Nije pronaÄen prikljuÄak biblioteke za dekoraciju prozora." 107 msgstr "" 108 "U postavkama je onemoguÄeno uÄitavanje biblioteki za prikljuÄke za dekoraciju " 109 "prozora." 107 110 108 111 #. +> trunk stable -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/libplasmaclock.po
r1123 r1129 4 4 # Andrej Dundovic <andrej@dundovic.com.hr>, 2009, 2010. 5 5 # Marko Dimjasevic <marko@dimjasevic.net>, 2010, 2011. 6 # Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>, 2011. 6 7 msgid "" 7 8 msgstr "" … … 9 10 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 10 11 "POT-Creation-Date: 2011-07-08 10:23+0200\n" 11 "PO-Revision-Date: 2011-0 2-15 16:31+0100\n"12 "Last-Translator: Marko Dimja sevic<marko@dimjasevic.net>\n"12 "PO-Revision-Date: 2011-07-12 17:57+0200\n" 13 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 13 14 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" 14 15 "MIME-Version: 1.0\n" … … 16 17 "Content-Transfer-Encoding: 8bit\n" 17 18 "Language: hr\n" 18 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 19 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 20 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 19 21 "X-Generator: Lokalize 1.2\n" 20 22 "X-Environment: kde\n" … … 49 51 #. +> trunk stable 50 52 #: calendartable.cpp:663 51 #, fuzzy,kde-format53 #, kde-format 52 54 msgctxt "Not day off: Holiday name (holiday region)" 53 55 msgid "%1 (%2)" … … 56 58 #. +> trunk stable 57 59 #: calendartable.cpp:672 58 #, fuzzy,kde-format60 #, kde-format 59 61 #| msgid "<i>Event</i>: %1<br>" 60 62 msgid "<i>Event</i>: %1" 61 msgstr "<i>DogaÄaj</i>: %1 <br>"63 msgstr "<i>DogaÄaj</i>: %1" 62 64 63 65 #. +> trunk stable 64 66 #: calendartable.cpp:679 65 #, fuzzy,kde-format67 #, kde-format 66 68 #| msgid "<i>Todo</i>: %1<br>" 67 69 msgid "<i>Todo</i>: %1" 68 msgstr "<i>Za napraviti</i>: %1 <br>"70 msgstr "<i>Za napraviti</i>: %1" 69 71 70 72 #. +> trunk stable … … 73 75 msgctxt "All-day calendar event summary" 74 76 msgid "<br>%1" 75 msgstr " "77 msgstr "<br>%1" 76 78 77 79 #. +> trunk stable … … 80 82 msgctxt "Time and summary for a calendarevent" 81 83 msgid "%1<br>%2" 82 msgstr " "84 msgstr "%1<br>%2" 83 85 84 86 #. +> trunk stable 85 87 #: calendartable.cpp:701 86 #, fuzzy,kde-format88 #, kde-format 87 89 msgctxt "Start and end time and summary for a calendar event" 88 90 msgid "%1 - %2<br>%3" 89 msgstr "" 90 "Qt: %1\n" 91 "KDE: %2\n" 92 "%3: %4\n" 91 msgstr "%1 - %2<br>%3" 93 92 94 93 #. +> trunk stable … … 130 129 #: clockapplet.cpp:218 131 130 #, kde-format 132 msgctxt "Text sent to the text to speech service when minutes==0 and it is the 24 hour clock" 131 msgctxt "" 132 "Text sent to the text to speech service when minutes==0 and it is the 24 hour " 133 "clock" 133 134 msgid "It is 1 o clock" 134 135 msgid_plural "It is %1 o clock" … … 242 243 #: timezonesConfig.ui:43 243 244 msgid "" 244 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n" 245 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n" 245 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3." 246 "org/TR/REC-html40/strict.dtd\">\n" 247 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">" 248 "\n" 246 249 "p, li { white-space: pre-wrap; }\n" 247 "</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; font-weight:400; font-style:normal;\">\n" 248 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Your <span style=\" font-weight:600;\">Local</span> time and time zone are defined in System Settings, in the Date and Time tab. As default, your plasma clock will use this setting.</p>\n" 249 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">The plasma clock tooltip can display the time in several other time zones: to do so, select one or several more time zones in the list. Click on a line to select it and click on it again to deselect it. </p>\n" 250 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">After you validate your choices with the OK button, when your mouse is over the clock, a tooltip will display the time in all the selected time zones.</p>\n" 251 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">To select a <span style=\" font-weight:600;\">Default</span> time zone: you can either scroll over the clock with your mouse wheel and set the one you want or you can set it with \"Clock defaults to:\". .</p></body></html>" 250 "</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; " 251 "font-weight:400; font-style:normal;\">\n" 252 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 253 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Your <span style=\" " 254 "font-weight:600;\">Local</span> time and time zone are defined in System " 255 "Settings, in the Date and Time tab. As default, your plasma clock will use " 256 "this setting.</p>\n" 257 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 258 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\">The plasma clock " 259 "tooltip can display the time in several other time zones: to do so, select " 260 "one or several more time zones in the list. Click on a line to select it and " 261 "click on it again to deselect it. </p>\n" 262 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 263 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\">After you validate " 264 "your choices with the OK button, when your mouse is over the clock, a tooltip " 265 "will display the time in all the selected time zones.</p>\n" 266 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 267 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\">To select a <span " 268 "style=\" font-weight:600;\">Default</span> time zone: you can either scroll " 269 "over the clock with your mouse wheel and set the one you want or you can set " 270 "it with \"Clock defaults to:\". .</p></body></html>" 252 271 msgstr "" 253 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n" 254 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n" 272 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3." 273 "org/TR/REC-html40/strict.dtd\">\n" 274 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">" 275 "\n" 255 276 "p, li { white-space: pre-wrap; }\n" 256 "</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; font-weight:400; font-style:normal;\">\n" 257 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">VaÅ¡e <span style=\" font-weight:600;\">lokalno</span> vrijeme i vremenska zona su definirane u Postavkama sustava, u kartici Datum i vrijeme. UobiÄajeno Äe plasma-sat koristiti te postavke.</p>\n" 258 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">IskoÄna pomoÄ plasma-sata moÅŸe prikazivati vrijeme iz nekoliko drugih vremenskih zona: da biste to postigli, odaberite jednu ili viÅ¡e vremenskih zona iz popisa. Kliknite na liniju za odabir iste i kliknite ponovo na nju da biste uklonili odabir iste. </p>\n" 259 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Nakon Å¡to potvrdite svoj odabir gumbom 'U redu', svaki put kad se pokazivaÄ miÅ¡a naÄe iznad sata, pojavit Äe se iskoÄna pomoÄ s prikazom vremena u odabranim vremenskim zonama.</p>\n" 260 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Za odabrati <span style=\" font-weight:600;\">uobiÄajenu</span> vremensku zonu: kotaÄiÄem miÅ¡a moÅŸete klizati iznad sata i postaviti vremensku zonu koju ÅŸelite ili je postaviti s \"UobiÄajena vremenska zona:\".</p></body></html>" 277 "</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; " 278 "font-weight:400; font-style:normal;\">\n" 279 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 280 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\">VaÅ¡e <span style=\" " 281 "font-weight:600;\">lokalno</span> vrijeme i vremenska zona su definirane u " 282 "Postavkama sustava, u kartici Datum i vrijeme. UobiÄajeno Äe plasma-sat " 283 "koristiti te postavke.</p>\n" 284 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 285 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\">IskoÄna pomoÄ " 286 "plasma-sata moÅŸe prikazivati vrijeme iz nekoliko drugih vremenskih zona: da " 287 "biste to postigli, odaberite jednu ili viÅ¡e vremenskih zona iz popisa. " 288 "Kliknite na liniju za odabir iste i kliknite ponovo na nju da biste uklonili " 289 "odabir iste. </p>\n" 290 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 291 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Nakon Å¡to potvrdite " 292 "svoj odabir gumbom 'U redu', svaki put kad se pokazivaÄ miÅ¡a naÄe iznad sata, " 293 "pojavit Äe se iskoÄna pomoÄ s prikazom vremena u odabranim vremenskim zonama." 294 "</p>\n" 295 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; " 296 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Za odabrati <span " 297 "style=\" font-weight:600;\">uobiÄajenu</span> vremensku zonu: kotaÄiÄem miÅ¡a " 298 "moÅŸete klizati iznad sata i postaviti vremensku zonu koju ÅŸelite ili je " 299 "postaviti s \"UobiÄajena vremenska zona:\".</p></body></html>" 261 300 262 301 #. i18n: ectx: property (text), widget (QLabel, label) -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/plasma-desktop.po
r1123 r1129 5 5 # Marko Dimjasevic <marko@dimjasevic.net>, 2009, 2010, 2011. 6 6 # Andrej Dundovic <andrej@dundovic.com.hr>, 2009, 2010. 7 # Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>, 2011. 7 8 msgid "" 8 9 msgstr "" … … 10 11 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 11 12 "POT-Creation-Date: 2011-07-08 10:23+0200\n" 12 "PO-Revision-Date: 2011-0 2-18 18:14+0100\n"13 "Last-Translator: Marko Dimja sevic<marko@dimjasevic.net>\n"13 "PO-Revision-Date: 2011-07-12 17:58+0200\n" 14 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 14 15 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" 15 16 "MIME-Version: 1.0\n" … … 18 19 "Language: hr\n" 19 20 "X-Generator: Lokalize 1.2\n" 20 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 21 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 22 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 21 23 "X-Environment: kde\n" 22 24 "X-Accelerator-Marker: &\n" … … 134 136 #. +> trunk stable 135 137 #: data/plasma-shell-desktop.kcfg:15 136 msgid "Set to true if each virtual desktop should get its own, unique Plasma view." 137 msgstr "Postavite na ukljuÄeno ako ÅŸelite da svaka virtualna radna povrÅ¡ina ima svoj posebni Plasma izgled." 138 msgid "" 139 "Set to true if each virtual desktop should get its own, unique Plasma view." 140 msgstr "" 141 "Postavite na ukljuÄeno ako ÅŸelite da svaka virtualna radna povrÅ¡ina ima svoj " 142 "posebni Plasma izgled." 138 143 139 144 #. +> trunk stable … … 219 224 #: main.cpp:42 220 225 msgid "The KDE desktop, panels and widgets workspace application." 221 msgstr "Aplikacija za KDE-ov radni prostor s widgetima, panelima i radnom povrÅ¡inom." 226 msgstr "" 227 "Aplikacija za KDE-ov radni prostor s widgetima, panelima i radnom povrÅ¡inom." 222 228 223 229 #. +> trunk stable … … 304 310 #: panelcontroller.cpp:191 305 311 msgid "Press left mouse button and drag to a screen edge to change panel edge" 306 msgstr "Pritisnite lijevi gumb miÅ¡a i vucite prema rubu zaslona kako biste promijenili rub panela" 312 msgstr "" 313 "Pritisnite lijevi gumb miÅ¡a i vucite prema rubu zaslona kako biste " 314 "promijenili rub panela" 307 315 308 316 #. +> trunk stable … … 314 322 #: panelcontroller.cpp:197 315 323 msgid "Press left mouse button and drag vertically to change panel height" 316 msgstr "Pritisnite lijevi gumb miÅ¡a i vucite vertikalno kako biste promijenili visinu panela" 324 msgstr "" 325 "Pritisnite lijevi gumb miÅ¡a i vucite vertikalno kako biste promijenili visinu " 326 "panela" 317 327 318 328 #. +> trunk stable … … 324 334 #: panelcontroller.cpp:206 325 335 msgid "Show more options about panel alignment, visibility and other settings" 326 msgstr "PrikaÅŸi viÅ¡e opcija o poravnanju panela, vidljivosti i drugim postavkama" 336 msgstr "" 337 "PrikaÅŸi viÅ¡e opcija o poravnanju panela, vidljivosti i drugim postavkama" 327 338 328 339 #. +> trunk stable … … 344 355 #: panelcontroller.cpp:275 345 356 msgid "Add a spacer to the panel useful to add some space between two widgets" 346 msgstr "Dodaj razmak u panel koji se koristi za stvaranje prostora izmeÄu widgeta" 357 msgstr "" 358 "Dodaj razmak u panel koji se koristi za stvaranje prostora izmeÄu widgeta" 347 359 348 360 #. +> trunk stable … … 381 393 #: plasmaapp.cpp:1350 382 394 #, kde-format 383 msgid "A new widget has become available on the network:<br><b>%1</b> - <i>%2</i>" 395 msgid "" 396 "A new widget has become available on the network:<br><b>%1</b> - <i>%2</i>" 384 397 msgstr "Novi widget je postao dostupan na mreÅŸi:<br><b>%1</b> â <i>%2</i>" 385 398 386 399 #. +> trunk stable 387 400 #: plasmaapp.cpp:1361 388 #, fuzzy389 401 #| msgid "Add to current activity" 390 402 msgid "Unlock and add to current activity" 391 msgstr " Dodajtrenutnu aktivnost"403 msgstr "OtkljuÄaj i dodaj u trenutnu aktivnost" 392 404 393 405 #. +> trunk stable … … 398 410 #. +> trunk stable 399 411 #: plasmaapp.cpp:1425 400 #, fuzzy401 412 msgid "Run applications" 402 msgstr " Dodajaplikacije"413 msgstr "Pokreni aplikacije" 403 414 404 415 #. +> trunk stable 405 416 #: plasmaapp.cpp:1426 406 417 msgid "This activity template requests to run the following applications" 407 msgstr " "418 msgstr "Ovaj predloÅŸak aktivnosti zahtijeva pokretanje sljedeÄih aplikacija" 408 419 409 420 #. +> trunk stable 410 421 #: plasmaapp.cpp:1427 411 #, fuzzy412 422 msgid "Run selected" 413 msgstr " Sve odabrano"423 msgstr "Pokreni odabrane" 414 424 415 425 #. +> trunk stable 416 426 #: plasmaapp.cpp:1428 417 #, fuzzy418 427 msgid "Run none" 419 msgstr "N aÄin rada rada"428 msgstr "NiÅ¡ta ne pokreÄi" 420 429 421 430 #. +> trunk stable -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/plasma_applet_folderview.po
r1123 r1129 5 5 # Andrej DundoviÄ <adundovi@gmail.com>, 2009. 6 6 # Marko Dimjasevic <marko@dimjasevic.net>, 2010. 7 # Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>, 2011. 7 8 msgid "" 8 9 msgstr "" … … 10 11 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 11 12 "POT-Creation-Date: 2011-07-08 10:23+0200\n" 12 "PO-Revision-Date: 201 0-07-22 18:42+0200\n"13 "Last-Translator: Marko Dimja sevic<marko@dimjasevic.net>\n"13 "PO-Revision-Date: 2011-07-12 17:59+0200\n" 14 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 14 15 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" 15 16 "MIME-Version: 1.0\n" … … 17 18 "Content-Transfer-Encoding: 8bit\n" 18 19 "Language: hr\n" 19 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 20 "X-Generator: Lokalize 1.0\n" 20 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 21 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 22 "X-Generator: Lokalize 1.2\n" 21 23 "X-Environment: kde\n" 22 24 "X-Accelerator-Marker: &\n" … … 25 27 #. +> trunk stable 26 28 #: folderview.cpp:616 27 #, fuzzy28 29 msgid "Title" 29 30 msgstr "Naslov" … … 32 33 #: folderview.cpp:618 folderview.cpp:620 folderview.cpp:2030 33 34 #: folderview.cpp:2032 34 #, fuzzy35 35 msgid "None" 36 msgstr "Ni jedan"36 msgstr "NiÅ¡ta" 37 37 38 38 #. +> trunk stable 39 39 #: folderview.cpp:618 folderview.cpp:621 folderview.cpp:2034 40 #, fuzzy41 40 msgid "Default" 42 msgstr " UobiÄajeno"41 msgstr "Zadano" 43 42 44 43 #. +> trunk stable 45 44 #: folderview.cpp:618 folderview.cpp:622 folderview.cpp:2037 46 #, fuzzy47 45 msgid "Full path" 48 msgstr " Å irina &celog zaslona"46 msgstr "Cijela putanja" 49 47 50 48 #. +> trunk stable … … 76 74 #. +> trunk stable 77 75 #: folderview.cpp:678 78 msgctxt "Title of the page that lets the user choose which location should the folderview show" 76 msgctxt "" 77 "Title of the page that lets the user choose which location should the " 78 "folderview show" 79 79 msgid "Location" 80 80 msgstr "Mjesto" … … 82 82 #. +> trunk stable 83 83 #: folderview.cpp:679 84 msgctxt "Title of the page that lets the user choose how the folderview should be shown" 84 msgctxt "" 85 "Title of the page that lets the user choose how the folderview should be shown" 85 86 msgid "Display" 86 87 msgstr "Prikaz" … … 88 89 #. +> trunk stable 89 90 #: folderview.cpp:680 90 msgctxt "Title of the page that lets the user choose how to filter the folderview contents" 91 msgctxt "" 92 "Title of the page that lets the user choose how to filter the folderview " 93 "contents" 91 94 msgid "Filter" 92 95 msgstr "Filtar" … … 246 249 #. +> trunk stable 247 250 #: folderviewDisplayConfig.ui:116 248 msgid "Use this control to choose if you want the icons to be arranged top to bottom starting on the left side of the view, or arranged left to right starting at the top of the view." 249 msgstr "Koristite ovu kontrolu za odabir razmjeÅ¡taja ikona. Åœelite li da se ikone razmjeste odozgo prema dolje s lijeve strane pogleda ili s lijeva na desno s poÄetkom na vrhu?" 251 msgid "" 252 "Use this control to choose if you want the icons to be arranged top to bottom " 253 "starting on the left side of the view, or arranged left to right starting at " 254 "the top of the view." 255 msgstr "" 256 "Koristite ovu kontrolu za odabir razmjeÅ¡taja ikona. Åœelite li da se ikone " 257 "razmjeste odozgo prema dolje s lijeve strane pogleda ili s lijeva na desno s " 258 "poÄetkom na vrhu?" 250 259 251 260 #. i18n: ectx: property (text), widget (QLabel, label) … … 258 267 #. +> trunk stable 259 268 #: folderviewDisplayConfig.ui:136 260 msgid "Use this control to choose the criteria by which the icons will be sorted in the view." 261 msgstr "Koristite ovu kontrolu za odabir kriterija po kojem Äe se ikone sortirati u prikazu." 269 msgid "" 270 "Use this control to choose the criteria by which the icons will be sorted in " 271 "the view." 272 msgstr "" 273 "Koristite ovu kontrolu za odabir kriterija po kojem Äe se ikone sortirati u " 274 "prikazu." 262 275 263 276 #. i18n: ectx: property (text), widget (QLabel, label_4) … … 276 289 #. +> trunk stable 277 290 #: folderviewDisplayConfig.ui:181 278 msgid "Use this slider to increase or decrease the size of the icons in the view." 291 msgid "" 292 "Use this slider to increase or decrease the size of the icons in the view." 279 293 msgstr "Koristite ovaj klizaÄ za poveÄanje/smanjenje veliÄine ikona u pogledu." 280 294 … … 294 308 #. +> trunk stable 295 309 #: folderviewDisplayConfig.ui:224 296 msgid "Check this option if you want to see previews of the file contents in the icons." 297 msgstr "UkljuÄite ovu opciju ako ÅŸelite vidjeti pretpreglede sadrÅŸaja datoteka u ikonama." 310 msgid "" 311 "Check this option if you want to see previews of the file contents in the " 312 "icons." 313 msgstr "" 314 "UkljuÄite ovu opciju ako ÅŸelite vidjeti pretpreglede sadrÅŸaja datoteka u " 315 "ikonama." 298 316 299 317 #. i18n: ectx: property (whatsThis), widget (QPushButton, previewsAdvanced) 300 318 #. +> trunk stable 301 319 #: folderviewDisplayConfig.ui:234 302 msgid "Click this button to choose for which types of files previews will be shown." 303 msgstr "Kliknite na ovaj gumb da biste odabrali koje za koje tipove datoteka Äe biti prikazani pretpregledi." 320 msgid "" 321 "Click this button to choose for which types of files previews will be shown." 322 msgstr "" 323 "Kliknite na ovaj gumb da biste odabrali koje za koje tipove datoteka Äe biti " 324 "prikazani pretpregledi." 304 325 305 326 #. i18n: ectx: property (text), widget (QPushButton, previewsAdvanced) … … 321 342 "Check this option if you do not want the icons to be moveable in the view.\n" 322 343 "\n" 323 "This option is useful if you want to avoid accidentally moving the icons while interacting with them." 344 "This option is useful if you want to avoid accidentally moving the icons " 345 "while interacting with them." 324 346 msgstr "" 325 347 "UkljuÄite ovu opciju ako ne ÅŸelite da se ikone mogu premjestati po pogledu.\n" 326 348 "\n" 327 "Ova opcija je korisna ako ÅŸelite sprijeÄiti nehotiÄno pomicanje ikona dok klikate po njima." 349 "Ova opcija je korisna ako ÅŸelite sprijeÄiti nehotiÄno pomicanje ikona dok " 350 "klikate po njima." 328 351 329 352 #. i18n: ectx: property (text), widget (QLabel, label_12) … … 339 362 "Check this option if you want the icons to be arranged in a grid.\n" 340 363 "\n" 341 "When this option is checked, icons will automatically snap to the nearest grid cell when you move them around in the view." 364 "When this option is checked, icons will automatically snap to the nearest " 365 "grid cell when you move them around in the view." 342 366 msgstr "" 343 367 "UkljuÄite ovu opciju ako ÅŸelite da se ikone razmjeste po mreÅŸi.\n" 344 368 "\n" 345 "Kad je ta opcija ukljuÄena, ikone automatski skoÄe u najbliÅŸu Äeliju mreÅŸe dok ih pomiÄete po pogledu." 369 "Kad je ta opcija ukljuÄena, ikone automatski skoÄe u najbliÅŸu Äeliju mreÅŸe " 370 "dok ih pomiÄete po pogledu." 346 371 347 372 #. i18n: ectx: property (text), widget (QLabel, label_9) … … 360 385 #. +> trunk stable 361 386 #: folderviewDisplayConfig.ui:341 362 msgid "Use this control to choose how many lines of text will be shown below the icons." 363 msgstr "Koristite ovu kontrolu za odabir koliko linija teksta Äe se prikazati ispod ikona." 387 msgid "" 388 "Use this control to choose how many lines of text will be shown below the " 389 "icons." 390 msgstr "" 391 "Koristite ovu kontrolu za odabir koliko linija teksta Äe se prikazati ispod " 392 "ikona." 364 393 365 394 #. i18n: ectx: property (specialValueText), widget (KIntSpinBox, numLinesEdit) … … 384 413 #. +> trunk stable 385 414 #: folderviewDisplayConfig.ui:389 386 msgid "Click this button to choose the color which is used for the text labels in the view." 387 msgstr "Kliknite na ovaj gumb da biste odabrali boju koja Äe biti koriÅ¡tena za natpise u pogledu." 415 msgid "" 416 "Click this button to choose the color which is used for the text labels in " 417 "the view." 418 msgstr "" 419 "Kliknite na ovaj gumb da biste odabrali boju koja Äe biti koriÅ¡tena za " 420 "natpise u pogledu." 388 421 389 422 #. i18n: ectx: property (text), widget (QLabel, label_10) … … 397 430 #: folderviewDisplayConfig.ui:416 398 431 msgid "" 399 "<html><body><p>Check this option if you want the text labels to cast a shadow on the background.</p>\n" 432 "<html><body><p>Check this option if you want the text labels to cast a shadow " 433 "on the background.</p>\n" 400 434 "<p></p>\n" 401 "<p>Shadows help make the text easier to read by making it stand out more from the background.</p>\n" 435 "<p>Shadows help make the text easier to read by making it stand out more from " 436 "the background.</p>\n" 402 437 "<p></p>\n" 403 "<p><i>Note that with dark text colors, this option will cause the text to glow with a bright halo, instead of casting a shadow.</i></p></body></html>" 404 msgstr "" 405 "<html><body><p>Odaberite ovu opciju ako ÅŸelite da natpisi bacaju sjenu na pozadinu.</p>\n" 438 "<p><i>Note that with dark text colors, this option will cause the text to " 439 "glow with a bright halo, instead of casting a shadow.</i></p></body></html>" 440 msgstr "" 441 "<html><body><p>Odaberite ovu opciju ako ÅŸelite da natpisi bacaju sjenu na " 442 "pozadinu.</p>\n" 406 443 "<p></p>\n" 407 "<p>Sjene olakÅ¡avaju Äitanje teksta jer tekst izgleda kao da je \"bliÅŸe\" od pozadine.</p>\n" 444 "<p>Sjene olakÅ¡avaju Äitanje teksta jer tekst izgleda kao da je \"bliÅŸe\" od " 445 "pozadine.</p>\n" 408 446 "<p></p>\n" 409 "<p><i>Primijetite da Äe sa tamnim bojama teksta ovaj efekt izazvati svijetljenje teksta umjesto bacanja sjene.</i></p></body></html>" 447 "<p><i>Primijetite da Äe sa tamnim bojama teksta ovaj efekt izazvati " 448 "svijetljenje teksta umjesto bacanja sjene.</i></p></body></html>" 410 449 411 450 #. i18n: ectx: property (toolTip), widget (QComboBox, filterType) … … 413 452 #: folderviewFilterConfig.ui:34 414 453 msgid "" 415 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n" 416 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n" 454 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3." 455 "org/TR/REC-html40/strict.dtd\">\n" 456 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">" 457 "\n" 417 458 "p, li { white-space: pre-wrap; }\n" 418 "</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; font-weight:400; font-style:normal;\">\n" 419 "<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">If you have selected \"Show Files Matching\" or \"Hide Files Matching\", only the files matching BOTH the conditions will be shown or hidden respectively.</p>\n" 420 "<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">For example, if you have \"*\" as your pattern, but have nothing selected in the MIME types, no files will be shown.</p></body></html>" 421 msgstr "" 422 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n" 423 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n" 459 "</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; " 460 "font-weight:400; font-style:normal;\">\n" 461 "<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; " 462 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\">If you have selected " 463 "\"Show Files Matching\" or \"Hide Files Matching\", only the files matching " 464 "BOTH the conditions will be shown or hidden respectively.</p>\n" 465 "<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; " 466 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\">For example, if you " 467 "have \"*\" as your pattern, but have nothing selected in the MIME types, no " 468 "files will be shown.</p></body></html>" 469 msgstr "" 470 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3." 471 "org/TR/REC-html40/strict.dtd\">\n" 472 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">" 473 "\n" 424 474 "p, li { white-space: pre-wrap; }\n" 425 "</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; font-weight:400; font-style:normal;\">\n" 426 "<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Ako ste odabrali \"PrikaÅŸi datoteke koje se podudaraju s\" ili \"Sakrij datoteke koje se podudaraju s\", samo Äe datoteke koje se podudaraju s oba uvjeta biti prikazane ili sakrivene.</p>\n" 427 "<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Na primjer, ako imate \"*\" kao izraz, ali niste niÅ¡ta odabrali u mimetipovima, niÅ¡ta neÄe biti prikazano.</p></body></html>" 475 "</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; " 476 "font-weight:400; font-style:normal;\">\n" 477 "<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; " 478 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Ako ste odabrali " 479 "\"PrikaÅŸi datoteke koje se podudaraju s\" ili \"Sakrij datoteke koje se " 480 "podudaraju s\", samo Äe datoteke koje se podudaraju s oba uvjeta biti " 481 "prikazane ili sakrivene.</p>\n" 482 "<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; " 483 "margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Na primjer, ako " 484 "imate \"*\" kao izraz, ali niste niÅ¡ta odabrali u mimetipovima, niÅ¡ta neÄe " 485 "biti prikazano.</p></body></html>" 428 486 429 487 #. i18n: ectx: property (text), item, widget (QComboBox, filterType) … … 461 519 #: folderviewFilterConfig.ui:112 462 520 msgid "" 463 "Note that if you have selected \"Show Files Matching\" or \"Hide Files Matching\",\n" 464 "only the files matching BOTH the conditions will be shown or hidden respectively.\n" 465 "For example, if you have \"*\" as your pattern, but have nothing selected in the MIME types, no files will be shown." 466 msgstr "" 467 "Primijetite da ko ste odabrali \"PrikaÅŸi datoteke koje se podudaraju s\" ili \"Sakrij datoteke koje se podudaraju s\", samo Äe datoteke koje se podudaraju s oba uvjeta biti prikazane ili sakrivene.\n" 521 "Note that if you have selected \"Show Files Matching\" or \"Hide Files " 522 "Matching\",\n" 523 "only the files matching BOTH the conditions will be shown or hidden " 524 "respectively.\n" 525 "For example, if you have \"*\" as your pattern, but have nothing selected in " 526 "the MIME types, no files will be shown." 527 msgstr "" 528 "Primijetite da ko ste odabrali \"PrikaÅŸi datoteke koje se podudaraju s\" ili " 529 "\"Sakrij datoteke koje se podudaraju s\", samo Äe datoteke koje se podudaraju " 530 "s oba uvjeta biti prikazane ili sakrivene.\n" 468 531 "\n" 469 "Na primjer, ako imate \"*\" kao izraz, ali niste niÅ¡ta odabrali u mimetipovima, niÅ¡ta neÄe biti prikazano." 532 "Na primjer, ako imate \"*\" kao izraz, ali niste niÅ¡ta odabrali u " 533 "mimetipovima, niÅ¡ta neÄe biti prikazano." 470 534 471 535 #. i18n: ectx: property (text), widget (QLabel, label) … … 502 566 #. +> trunk stable 503 567 #: folderviewFilterConfig.ui:175 504 msgid "Space-separated list of extensions, e.g. *.txt *.od* to display only office- and text-files" 505 msgstr "Popis ekstenzija odvojen razmakom, npr. *.txt *.od* za prikaz samo tekstualnih i uredskih datoteka" 568 msgid "" 569 "Space-separated list of extensions, e.g. *.txt *.od* to display only office- " 570 "and text-files" 571 msgstr "" 572 "Popis ekstenzija odvojen razmakom, npr. *.txt *.od* za prikaz samo " 573 "tekstualnih i uredskih datoteka" 506 574 507 575 #. i18n: ectx: property (clickMessage), widget (KLineEdit, filterFilesPattern) … … 571 639 #. +> trunk stable 572 640 #: tooltipwidget.cpp:143 573 #, fuzzy,kde-format641 #, kde-format 574 642 #| msgid "1 MPixel" 575 643 #| msgid_plural "%1 MPixels" 576 644 msgid "%1 MPixels" 577 msgstr "%1 MegaPi ksel"645 msgstr "%1 MegaPixela" 578 646 579 647 #. +> trunk stable -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/plasma_applet_launcher.po
r1123 r1129 5 5 # Andrej Dundovic <adundovi@gmail.com>, 2009, 2010. 6 6 # Marko Dimjasevic <marko@dimjasevic.net>, 2010. 7 # Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>, 2011. 7 8 msgid "" 8 9 msgstr "" … … 10 11 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 11 12 "POT-Creation-Date: 2011-07-08 10:23+0200\n" 12 "PO-Revision-Date: 201 0-11-06 12:51+0100\n"13 "Last-Translator: Marko Dimja sevic<marko@dimjasevic.net>\n"13 "PO-Revision-Date: 2011-07-12 18:00+0200\n" 14 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 14 15 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" 15 16 "MIME-Version: 1.0\n" … … 17 18 "Content-Transfer-Encoding: 8bit\n" 18 19 "Language: hr\n" 19 "X-Generator: Lokalize 1.1\n" 20 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 20 "X-Generator: Lokalize 1.2\n" 21 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 22 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 21 23 "X-Environment: kde\n" 22 24 "X-Accelerator-Marker: &\n" … … 40 42 #. +> trunk stable 41 43 #: applet/applet.cpp:85 42 msgid "Favorites, applications, computer places, recently used items and desktop sessions" 43 msgstr "Omiljeno, aplikacije, mjesta na raÄunalu, nedavno koriÅ¡tene stvari i sjednice radne povrÅ¡ine" 44 msgid "" 45 "Favorites, applications, computer places, recently used items and desktop " 46 "sessions" 47 msgstr "" 48 "Omiljeno, aplikacije, mjesta na raÄunalu, nedavno koriÅ¡tene stvari i sjednice " 49 "radne povrÅ¡ine" 44 50 45 51 #. +> trunk stable … … 110 116 #. +> trunk stable 111 117 #: core/leavemodel.cpp:55 112 #, fuzzy113 118 #| msgid "Lock Screen" 114 119 msgid "Lock screen" … … 117 122 #. +> trunk stable 118 123 #: core/leavemodel.cpp:57 119 #, fuzzy120 124 msgid "Switch user" 121 125 msgstr "Zamijeni korisnika" … … 144 148 #. +> trunk stable 145 149 #: core/leavemodel.cpp:67 146 #, fuzzy147 150 msgid "Restart computer" 148 msgstr "Ponov no pokretanje &raÄunala"151 msgstr "Ponovo pokreni raÄunalo" 149 152 150 153 #. +> trunk stable … … 412 415 #. +> trunk stable 413 416 #: ui/contextmenufactory.cpp:236 414 #, fuzzy415 417 msgid "Uninstall" 416 msgstr " Odinstaliraj"418 msgstr "Ukloni" 417 419 418 420 #. +> trunk stable -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/plasma_applet_system-monitor.po
r1123 r1129 4 4 # Andrej DundoviÄ <adundovi@gmail.com>, 2009. 5 5 # Andrej Dundovic <adundovi@gmail.com>, 2010. 6 # Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>, 2011. 6 7 msgid "" 7 8 msgstr "" … … 9 10 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 10 11 "POT-Creation-Date: 2011-07-08 10:23+0200\n" 11 "PO-Revision-Date: 201 0-02-21 10:30+0100\n"12 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"12 "PO-Revision-Date: 2011-07-12 18:00+0200\n" 13 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 13 14 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" 14 15 "MIME-Version: 1.0\n" … … 16 17 "Content-Transfer-Encoding: 8bit\n" 17 18 "Language: hr\n" 18 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 19 "X-Generator: Lokalize 1.0\n" 19 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 20 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 21 "X-Generator: Lokalize 1.2\n" 20 22 "X-Environment: kde\n" 21 23 "X-Accelerator-Marker: &\n" … … 188 190 #. +> trunk stable 189 191 #: temperature.cpp:97 190 #, fuzzy191 192 msgid "Offset" 192 193 msgstr "Pomak:" -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/plasma_engine_weather.po
r1123 r1129 11 11 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 12 12 "POT-Creation-Date: 2011-07-08 10:23+0200\n" 13 "PO-Revision-Date: 2011-0 4-15 08:43+0200\n"13 "PO-Revision-Date: 2011-07-12 18:01+0200\n" 14 14 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 15 15 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" … … 19 19 "Language: hr\n" 20 20 "X-Generator: Lokalize 1.2\n" 21 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 21 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 22 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 22 23 "X-Environment: kde\n" 23 24 "X-Accelerator-Marker: &\n" … … 2809 2810 #. +> trunk stable 2810 2811 #: ions/bbcukmet/ion_bbcukmet.cpp:923 ions/envcan/ion_envcan.cpp:1680 2811 #, fuzzy2812 2812 #| msgid "Sat" 2813 2813 msgctxt "Short for Saturday" … … 2817 2817 #. +> trunk stable 2818 2818 #: ions/bbcukmet/ion_bbcukmet.cpp:927 ions/envcan/ion_envcan.cpp:1684 2819 #, fuzzy2820 2819 #| msgid "Sun" 2821 2820 msgctxt "Short for Sunday" … … 2825 2824 #. +> trunk stable 2826 2825 #: ions/bbcukmet/ion_bbcukmet.cpp:931 ions/envcan/ion_envcan.cpp:1688 2827 #, fuzzy2828 2826 #| msgid "Mon" 2829 2827 msgctxt "Short for Monday" … … 2833 2831 #. +> trunk stable 2834 2832 #: ions/bbcukmet/ion_bbcukmet.cpp:935 ions/envcan/ion_envcan.cpp:1692 2835 #, fuzzy2836 2833 #| msgid "Tue" 2837 2834 msgctxt "Short for Tuesday" … … 2841 2838 #. +> trunk stable 2842 2839 #: ions/bbcukmet/ion_bbcukmet.cpp:939 ions/envcan/ion_envcan.cpp:1696 2843 #, fuzzy2844 2840 #| msgid "Wed" 2845 2841 msgctxt "Short for Wednesday" … … 2849 2845 #. +> trunk stable 2850 2846 #: ions/bbcukmet/ion_bbcukmet.cpp:943 ions/envcan/ion_envcan.cpp:1700 2851 #, fuzzy2852 2847 #| msgid "Thu" 2853 2848 msgctxt "Short for Thursday" … … 2857 2852 #. +> trunk stable 2858 2853 #: ions/bbcukmet/ion_bbcukmet.cpp:946 ions/envcan/ion_envcan.cpp:1703 2859 #, fuzzy2860 2854 #| msgid "Fri" 2861 2855 msgctxt "Short for Friday" -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/plasmagenericshell.po
r1123 r1129 5 5 # Andrej Dundovic <adundovi@gmail.com>, 2009, 2010. 6 6 # Marko Dimjasevic <marko@dimjasevic.net>, 2010. 7 # Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>, 2011. 7 8 msgid "" 8 9 msgstr "" … … 10 11 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 11 12 "POT-Creation-Date: 2011-07-08 10:23+0200\n" 12 "PO-Revision-Date: 201 0-11-06 13:25+0100\n"13 "Last-Translator: Marko Dimja sevic<marko@dimjasevic.net>\n"13 "PO-Revision-Date: 2011-07-12 18:02+0200\n" 14 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 14 15 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" 15 16 "MIME-Version: 1.0\n" … … 17 18 "Content-Transfer-Encoding: 8bit\n" 18 19 "Language: hr\n" 19 "X-Generator: Lokalize 1.1\n" 20 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 20 "X-Generator: Lokalize 1.2\n" 21 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 22 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 21 23 "X-Environment: kde\n" 22 24 "X-Accelerator-Marker: &\n" … … 45 47 #. +> trunk stable 46 48 #: backgrounddialog.cpp:224 47 msgid "This picture of a monitor contains a preview of what the current settings will look like on your desktop." 48 msgstr "Slika zaslona sadrÅŸi prikaz na koji Äe naÄin trenutne postavke izgledati na vaÅ¡oj radnoj povrÅ¡ini." 49 msgid "" 50 "This picture of a monitor contains a preview of what the current settings " 51 "will look like on your desktop." 52 msgstr "" 53 "Slika zaslona sadrÅŸi prikaz na koji Äe naÄin trenutne postavke izgledati na " 54 "vaÅ¡oj radnoj povrÅ¡ini." 49 55 50 56 #. +> trunk stable … … 145 151 #. +> trunk stable 146 152 #: mouseinputbutton.cpp:71 147 msgid "Hold down the modifier keys you want, then click a mouse button or scroll a mouse wheel here" 148 msgstr "DrÅŸite modifikatorsku tipku koju ÅŸelite, zatim ovdje pritisnite gumb miÅ¡a ili zavrtite kotaÄiÄ miÅ¡a" 153 msgid "" 154 "Hold down the modifier keys you want, then click a mouse button or scroll a " 155 "mouse wheel here" 156 msgstr "" 157 "DrÅŸite modifikatorsku tipku koju ÅŸelite, zatim ovdje pritisnite gumb miÅ¡a ili " 158 "zavrtite kotaÄiÄ miÅ¡a" 149 159 150 160 #. +> trunk stable … … 201 211 #. +> trunk stable 202 212 #: scripting/i18n.cpp:33 203 #, fuzzy204 213 msgid "i18n() takes at least one argument" 205 msgstr "i18n() uzima barem jedan argument"214 msgstr "i18n() treba barem jedan argument" 206 215 207 216 #. +> trunk stable 208 217 #: scripting/i18n.cpp:52 209 #, fuzzy210 218 msgid "i18nc() takes at least two arguments" 211 msgstr "i18nc() uzima barem 2argumenta"219 msgstr "i18nc() treba barem dva argumenta" 212 220 213 221 #. +> trunk stable 214 222 #: scripting/i18n.cpp:72 215 #, fuzzy216 223 msgid "i18np() takes at least two arguments" 217 msgstr "i18np() uzima barem 2argumenta"224 msgstr "i18np() treba barem dva argumenta" 218 225 219 226 #. +> trunk stable 220 227 #: scripting/i18n.cpp:97 221 #, fuzzy222 228 msgid "i18ncp() takes at least three arguments" 223 msgstr "i18ncp() uzima barem 3argumenta"229 msgstr "i18ncp() treba barem tri argumenta" 224 230 225 231 #. +> trunk stable … … 288 294 #: widgetsexplorer/appletsfiltering.cpp:321 289 295 #, kde-format 290 msgctxt "%1 is a type of widgets, as defined by e.g. some plasma-packagestructure-*.desktop files" 296 msgctxt "" 297 "%1 is a type of widgets, as defined by e.g. some plasma-packagestructure-*." 298 "desktop files" 291 299 msgid "Download New %1" 292 300 msgstr "Skini novi %1" -
kde-croatia/kde4/summit/hr/summit/messages/kdebase/plasmapkg.po
r1123 r1129 4 4 # Andrej Dundovic <adundovi@gmail.com>, 2009, 2010. 5 5 # Marko Dimjasevic <marko@dimjasevic.net>, 2010. 6 # Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>, 2011. 6 7 msgid "" 7 8 msgstr "" … … 9 10 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 10 11 "POT-Creation-Date: 2011-07-08 10:23+0200\n" 11 "PO-Revision-Date: 201 0-11-06 13:31+0100\n"12 "Last-Translator: Marko Dimja sevic<marko@dimjasevic.net>\n"12 "PO-Revision-Date: 2011-07-12 18:06+0200\n" 13 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 13 14 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" 14 15 "MIME-Version: 1.0\n" … … 16 17 "Content-Transfer-Encoding: 8bit\n" 17 18 "Language: hr\n" 18 "X-Generator: Lokalize 1.1\n" 19 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 19 "X-Generator: Lokalize 1.2\n" 20 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 21 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 20 22 "X-Environment: kde\n" 21 23 "X-Accelerator-Marker: &\n" … … 30 32 msgctxt "EMAIL OF TRANSLATORS" 31 33 msgid "Your emails" 32 msgstr "zarko.pintar@gmail.com, DoDoEntertainment@gmail.com, adundovi@gmail.com" 34 msgstr "" 35 "zarko.pintar@gmail.com, DoDoEntertainment@gmail.com, adundovi@gmail.com" 33 36 34 37 #. +> trunk stable … … 39 42 #. +> trunk stable 40 43 #: main.cpp:80 41 #, fuzzy42 44 msgid "Addon Name" 43 msgstr " Ime zvuka"45 msgstr "Naziv dodatka" 44 46 45 47 #. +> trunk stable 46 48 #: main.cpp:81 47 #, fuzzy48 49 msgid "Service Type" 49 50 msgstr "Tip usluge" … … 51 52 #. +> trunk stable 52 53 #: main.cpp:82 53 #, fuzzy54 54 msgid "Path" 55 55 msgstr "Putanja" … … 67 67 #. +> trunk stable 68 68 #: main.cpp:126 69 #, fuzzy70 69 msgid "DataEngine" 71 msgstr "Pod rÅ¡ke za podatke"70 msgstr "Podatkovni mehanizam" 72 71 73 72 #. +> trunk stable 74 73 #: main.cpp:127 75 #, fuzzy76 74 #| msgctxt "package type" 77 75 #| msgid "layout-template" 78 76 msgid "Layout Template" 79 msgstr " predloÅŸak-izgleda"77 msgstr "PredloÅŸak izgleda" 80 78 81 79 #. +> trunk stable 82 80 #: main.cpp:128 83 #, fuzzy84 81 msgid "Plasmoid" 85 msgstr " plasmoid"82 msgstr "Plasmoid" 86 83 87 84 #. +> trunk stable 88 85 #: main.cpp:129 89 #, fuzzy90 86 #| msgctxt "package type" 91 87 #| msgid "runner" 92 88 msgid "Runner" 93 msgstr " pokretaÄ"89 msgstr "PokretaÄ" 94 90 95 91 #. +> trunk stable 96 92 #: main.cpp:130 97 #, fuzzy98 93 msgid "Theme" 99 94 msgstr "Tema" … … 101 96 #. +> trunk stable 102 97 #: main.cpp:131 103 #, fuzzy104 98 msgid "Wallpaper Images" 105 msgstr "Sl jedeÄa slika podloge"99 msgstr "Slike za pozadinu" 106 100 107 101 #. +> trunk stable 108 102 #: main.cpp:132 109 #, fuzzy110 103 #| msgctxt "package type" 111 104 #| msgid "wallpaperplugin" 112 105 msgid "Wallpaper Plugin" 113 msgstr " prikljuÄakpodloge"106 msgstr "PrikljuÄak za pozadinsku sliku" 114 107 115 108 #. +> trunk stable … … 146 139 #: main.cpp:184 147 140 msgid "For install or remove, operates on packages installed for all users." 148 msgstr "Za instalaciju ili uklanjanje, radi s paketima instaliranima za sve korisnike." 141 msgstr "" 142 "Za instalaciju ili uklanjanje, radi s paketima instaliranima za sve korisnike." 149 143 150 144 #. +> trunk stable 151 145 #: main.cpp:190 152 msgctxt "theme, wallpaper, etc. are keywords, but they may be translated, as both versions are recognized by the application (if translated, should be same as messages with 'package type' context below)" 153 msgid "The type of package, e.g. theme, wallpaper, plasmoid, dataengine, runner, layout-template, etc." 154 msgstr "Vrsta paketa, npr. tema, podloga, plasmoid, podatkovni mehanizam (dataengine), pokretaÄ, predloÅŸak-izgleda itd." 146 msgctxt "" 147 "theme, wallpaper, etc. are keywords, but they may be translated, as both " 148 "versions are recognized by the application (if translated, should be same as " 149 "messages with 'package type' context below)" 150 msgid "" 151 "The type of package, e.g. theme, wallpaper, plasmoid, dataengine, runner, " 152 "layout-template, etc." 153 msgstr "" 154 "Vrsta paketa, npr. tema, podloga, plasmoid, podatkovni mehanizam " 155 "(dataengine), pokretaÄ, predloÅŸak-izgleda itd." 155 156 156 157 #. +> trunk stable … … 184 185 #. +> trunk stable 185 186 #: main.cpp:203 186 msgid "Absolute path to the package root. If not supplied, then the standard data directories for this KDE session will be searched instead." 187 msgstr "Apsolutna putanja do korijena paketa. Ako nije zadana, tada Äe biti pretraÅŸeni standardni direktoriji podataka za trenutnu KDE sjednicu." 187 msgid "" 188 "Absolute path to the package root. If not supplied, then the standard data " 189 "directories for this KDE session will be searched instead." 190 msgstr "" 191 "Apsolutna putanja do korijena paketa. Ako nije zadana, tada Äe biti " 192 "pretraÅŸeni standardni direktoriji podataka za trenutnu KDE sjednicu." 188 193 189 194 #. +> trunk stable … … 243 248 #. +> trunk stable 244 249 #: main.cpp:329 245 msgctxt "The user entered conflicting options packageroot and global, this is the error message telling the user he can use only one" 246 msgid "The packageroot and global options conflict each other, please select only one." 247 msgstr "Korijen paketa i globalne opcije se meÄusobno sukobljavaju. Molim odaberite samo jedno." 250 msgctxt "" 251 "The user entered conflicting options packageroot and global, this is the " 252 "error message telling the user he can use only one" 253 msgid "" 254 "The packageroot and global options conflict each other, please select only " 255 "one." 256 msgstr "" 257 "Korijen paketa i globalne opcije se meÄusobno sukobljavaju. Molim odaberite " 258 "samo jedno." 248 259 249 260 #. +> trunk stable … … 279 290 #. +> trunk stable 280 291 #: main.cpp:374 281 msgctxt "No option was given, this is the error message telling the user he needs at least one, do not translate install, remove, upgrade nor list" 292 msgctxt "" 293 "No option was given, this is the error message telling the user he needs at " 294 "least one, do not translate install, remove, upgrade nor list" 282 295 msgid "One of install, remove, upgrade or list is required." 283 296 msgstr "Potrebno je jedno od install, remove, upgrade ili list." -
kde-croatia/kde4/summit/hr/summit/messages/kdelibs/kdecalendarsystems.po
r1123 r1129 13 13 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 14 14 "POT-Creation-Date: 2011-07-08 10:24+0200\n" 15 "PO-Revision-Date: 2011-0 5-05 10:21+0200\n"15 "PO-Revision-Date: 2011-07-12 17:17+0200\n" 16 16 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" 17 17 "Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n" … … 20 20 "Content-Transfer-Encoding: 8bit\n" 21 21 "Language: hr\n" 22 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 22 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 23 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 23 24 "X-Generator: Lokalize 1.2\n" 24 25 "X-Poedit-Language: Croatian\n" … … 39 40 msgctxt "@item Calendar system" 40 41 msgid "Gregorian" 41 msgstr "Gr uzijski"42 msgstr "Gregorijanski" 42 43 43 44 #. +> trunk stable … … 57 58 msgctxt "@item Calendar system" 58 59 msgid "Gregorian (Proleptic)" 59 msgstr "Gr uzijski (Proleptski)"60 msgstr "Gregorijanski (Proleptski)" 60 61 61 62 #. +> trunk stable … … 138 139 #: kcalendarsystemcoptic.cpp:52 139 140 #, c-format 140 msgctxt "(kdedt-format) Coptic, AM, full era year format used for %EY, e.g. 2000 AM" 141 msgctxt "" 142 "(kdedt-format) Coptic, AM, full era year format used for %EY, e.g. 2000 AM" 141 143 msgid "%Ey %EC" 142 144 msgstr "%Ey %EC" … … 900 902 #: kcalendarsystemethiopian.cpp:56 901 903 #, c-format 902 msgctxt "(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM" 904 msgctxt "" 905 "(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM" 903 906 msgid "%Ey %EC" 904 907 msgstr "%Ey %EC" … … 1660 1663 #: kcalendarsystemgregorian.cpp:66 kcalendarsystemqdate.cpp:96 1661 1664 #, c-format 1662 msgctxt "(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC" 1665 msgctxt "" 1666 "(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC" 1663 1667 msgid "%Ey %EC" 1664 1668 msgstr "%Ey %EC" … … 1694 1698 #: kcalendarsystemqdate.cpp:106 1695 1699 #, c-format 1696 msgctxt "(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD" 1700 msgctxt "" 1701 "(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD" 1697 1702 msgid "%Ey %EC" 1698 1703 msgstr "%Ey %EC" … … 2354 2359 #: kcalendarsystemhebrew.cpp:291 2355 2360 #, c-format 2356 msgctxt "(kdedt-format) Hebrew, AM, full era year format used for %EY, e.g. 2000 AM" 2361 msgctxt "" 2362 "(kdedt-format) Hebrew, AM, full era year format used for %EY, e.g. 2000 AM" 2357 2363 msgid "%Ey %EC" 2358 2364 msgstr "%Ey %EC" … … 2917 2923 #: kcalendarsystemindiannational.cpp:76 2918 2924 #, c-format 2919 msgctxt "(kdedt-format) Indian National, SE, full era year format used for %EY, e.g. 2000 SE" 2925 msgctxt "" 2926 "(kdedt-format) Indian National, SE, full era year format used for %EY, e.g. " 2927 "2000 SE" 2920 2928 msgid "%Ey %EC" 2921 2929 msgstr "%Ey %EC" … … 3631 3639 #: kcalendarsystemislamiccivil.cpp:74 3632 3640 #, c-format 3633 msgctxt "(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH" 3641 msgctxt "" 3642 "(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH" 3634 3643 msgid "%Ey %EC" 3635 3644 msgstr "%Ey %EC" … … 4280 4289 #: kcalendarsystemjalali.cpp:82 4281 4290 #, c-format 4282 msgctxt "(kdedt-format) Jalali, AP, full era year format used for %EY, e.g. 2000 AP" 4291 msgctxt "" 4292 "(kdedt-format) Jalali, AP, full era year format used for %EY, e.g. 2000 AP" 4283 4293 msgid "%Ey %EC" 4284 4294 msgstr "%Ey %EC" … … 4955 4965 #: kcalendarsystemjapanese.cpp:70 4956 4966 #, c-format 4957 msgctxt "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year = 1, e.g. Meiji 1" 4967 msgctxt "" 4968 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year = 1, " 4969 "e.g. Meiji 1" 4958 4970 msgid "%EC Gannen" 4959 4971 msgstr "%EC Gannen" … … 4962 4974 #: kcalendarsystemjapanese.cpp:72 4963 4975 #, c-format 4964 msgctxt "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year > 1, e.g. Meiji 22" 4976 msgctxt "" 4977 "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year > 1, " 4978 "e.g. Meiji 22" 4965 4979 msgid "%EC %Ey" 4966 4980 msgstr "%EC %Ey" … … 4975 4989 #: kcalendarsystemjapanese.cpp:77 4976 4990 #, c-format 4977 msgctxt "(kdedt-format) Japanese, TaishÅ, full era year format used for %EY, year = 1, e.g. TaishÅ 1" 4991 msgctxt "" 4992 "(kdedt-format) Japanese, TaishÅ, full era year format used for %EY, year = 1, " 4993 "e.g. TaishÅ 1" 4978 4994 msgid "%EC Gannen" 4979 4995 msgstr "%EC Gannen" … … 4982 4998 #: kcalendarsystemjapanese.cpp:79 4983 4999 #, c-format 4984 msgctxt "(kdedt-format) Japanese, TaishÅ, full era year format used for %EY, year > 1, e.g. TaishÅ 22" 5000 msgctxt "" 5001 "(kdedt-format) Japanese, TaishÅ, full era year format used for %EY, year > 1, " 5002 "e.g. TaishÅ 22" 4985 5003 msgid "%EC %Ey" 4986 5004 msgstr "%EC %Ey" … … 4995 5013 #: kcalendarsystemjapanese.cpp:84 4996 5014 #, c-format 4997 msgctxt "(kdedt-format) Japanese, ShÅwa, full era year format used for %EY, year = 1, e.g. ShÅwa 1" 5015 msgctxt "" 5016 "(kdedt-format) Japanese, ShÅwa, full era year format used for %EY, year = 1, " 5017 "e.g. ShÅwa 1" 4998 5018 msgid "%EC Gannen" 4999 5019 msgstr "%EC Gannen" … … 5002 5022 #: kcalendarsystemjapanese.cpp:86 5003 5023 #, c-format 5004 msgctxt "(kdedt-format) Japanese, ShÅwa, full era year format used for %EY, year > 1, e.g. ShÅwa 22" 5024 msgctxt "" 5025 "(kdedt-format) Japanese, ShÅwa, full era year format used for %EY, year > 1, " 5026 "e.g. ShÅwa 22" 5005 5027 msgid "%EC %Ey" 5006 5028 msgstr "%EC %Ey" … … 5015 5037 #: kcalendarsystemjapanese.cpp:91 5016 5038 #, c-format 5017 msgctxt "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year = 1, e.g. Heisei 1" 5039 msgctxt "" 5040 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year = 1, " 5041 "e.g. Heisei 1" 5018 5042 msgid "%EC Gannen" 5019 5043 msgstr "%EC Gannen" … … 5022 5046 #: kcalendarsystemjapanese.cpp:93 5023 5047 #, c-format 5024 msgctxt "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year > 1, e.g. Heisei 22" 5048 msgctxt "" 5049 "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year > 1, " 5050 "e.g. Heisei 22" 5025 5051 msgid "%EC %Ey" 5026 5052 msgstr "%EC %Ey" … … 5059 5085 #: kcalendarsystemjulian.cpp:88 5060 5086 #, c-format 5061 msgctxt "(kdedt-format) Julian, BC, full era year format used for %EY, e.g. 2000 BC" 5087 msgctxt "" 5088 "(kdedt-format) Julian, BC, full era year format used for %EY, e.g. 2000 BC" 5062 5089 msgid "%Ey %EC" 5063 5090 msgstr "%Ey %EC" … … 5090 5117 #: kcalendarsystemjulian.cpp:98 5091 5118 #, c-format 5092 msgctxt "(kdedt-format) Julian, AD, full era year format used for %EY, e.g. 2000 AD" 5119 msgctxt "" 5120 "(kdedt-format) Julian, AD, full era year format used for %EY, e.g. 2000 AD" 5093 5121 msgid "%Ey %EC" 5094 5122 msgstr "%Ey %EC" … … 5729 5757 #: kcalendarsystemminguo.cpp:63 5730 5758 #, c-format 5731 msgctxt "(kdedt-format) Taiwan, ROC, full era year format used for %EY, e.g. ROC 99" 5759 msgctxt "" 5760 "(kdedt-format) Taiwan, ROC, full era year format used for %EY, e.g. ROC 99" 5732 5761 msgid "%EC %Ey" 5733 5762 msgstr "%EC %Ey" … … 5748 5777 #: kcalendarsystemthai.cpp:64 5749 5778 #, c-format 5750 msgctxt "(kdedt-format) Thai, BE, full era year format used for %EY, e.g. 2000 BE" 5779 msgctxt "" 5780 "(kdedt-format) Thai, BE, full era year format used for %EY, e.g. 2000 BE" 5751 5781 msgid "%Ey %EC" 5752 5782 msgstr "%Ey %EC"
Note: See TracChangeset
for help on using the changeset viewer.