Changeset 1129


Ignore:
Timestamp:
Jul 12, 2011, 6:07:34 PM (14 years ago)
Author:
marko@…
Message:

Prevođenje u kdebaseu

Location:
kde-croatia/kde4/summit/hr/summit/messages
Files:
26 edited

Legend:

Unmodified
Added
Removed
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcm_platform.po

    r1128 r1129  
    99"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    1010"POT-Creation-Date: 2011-07-08 10:22+0200\n"
    11 "PO-Revision-Date: 2011-07-11 22:07+0200\n"
     11"PO-Revision-Date: 2011-07-12 16:36+0200\n"
    1212"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
    1313"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
     
    1717"Language: hr\n"
    1818"X-Generator: Lokalize 1.2\n"
    19 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     19"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     20"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    2021"X-Environment: kde\n"
    2122"X-Accelerator-Marker: &\n"
     
    5455#. +> trunk stable
    5556#: platform.ui:41
    56 #, fuzzy
    5757#| msgctxt "tooltip for option in switching Windows Desktop shells"
    5858#| msgid "Native Windows Explorer shell"
    5959msgid "Native Windows Explorer shell"
    60 msgstr "Izvorna ljuska prozorskog preglednika"
     60msgstr "Izvorna ljuska Windows Explorera"
    6161
    6262#. i18n: whatsThis for option in switching Windows Desktop shells
     
    6767#| msgctxt "whatsThis for option in switching Windows Desktop shells"
    6868#| msgid "This is the standard Windows Desktop shell. Choose this if you want to return your system to the default desktop."
    69 msgid "This is the standard Windows Desktop shell. Choose this if you want to return your system to the default desktop."
    70 msgstr "Ovo je standardna ljuska radne povrÅ¡ine Windowsa. Izaberite ovo ukoliko ÅŸelite vratiti vaÅ¡ sustav na zadanu radnu povrÅ¡inu."
     69msgid ""
     70"This is the standard Windows Desktop shell. Choose this if you want to return "
     71"your system to the default desktop."
     72msgstr ""
     73"Ovo je standardna ljuska radne povrÅ¡ine Windowsa. Izaberite ovo ukoliko "
     74"ÅŸelite vratiti vaÅ¡ sustav na zadanu radnu povrÅ¡inu."
    7175
    7276#. i18n: radio button to choose Windows Desktop shell
     
    8791#. +> trunk stable
    8892#: platform.ui:61
    89 #, fuzzy
    9093#| msgctxt "tooltip for option in switching Windows Desktop shells"
    9194#| msgid "Use the KDE desktop shell, as it is seen on Linux."
    9295msgid "Use the KDE desktop shell, as it is seen on Linux."
    93 msgstr "Koristite KDE ljusku radne povrÅ¡ine kao Å¡to je viđeno na Linuxu."
     96msgstr "Koristi KDE-ovu ljusku radne povrÅ¡ine kakva je i u GNU/Linuxu."
    9497
    9598#. i18n: whatsThis for option in switching Windows Desktop shells
     
    100103#| msgctxt "whatsThis for option in switching Windows Desktop shells"
    101104#| msgid "Choose this option if you would like to use the Plasma desktop shell for your Windows system."
    102 msgid "Choose this option if you would like to use the Plasma desktop shell for your Windows system."
    103 msgstr "Izaberite ovu opciju ako ÅŸelite koristiti ljusku radne povrÅ¡ine Plasma na vaÅ¡em Windows sustavu."
     105msgid ""
     106"Choose this option if you would like to use the Plasma desktop shell for your "
     107"Windows system."
     108msgstr ""
     109"Izaberite ovu opciju ako ÅŸelite koristiti ljusku radne povrÅ¡ine Plasma na "
     110"vaÅ¡em Windows sustavu."
    104111
    105112#. i18n: radio button to choose Windows Desktop shell
     
    120127#. +> trunk stable
    121128#: platform.ui:81
    122 #, fuzzy
    123129#| msgctxt "tooltip for option in switching Windows Desktop shells"
    124130#| msgid "Your custom desktop shell"
     
    133139#| msgctxt "whatsThis for option in switching Windows Desktop shells"
    134140#| msgid "Choose this and press the <i>\"Setup...\"</i> button to configure you custom desktop shell. Not recommended for the average user."
    135 msgid "Choose this and press the <i>\"Setup...\"</i> button to configure you custom desktop shell. Not recommended for the average user."
    136 msgstr "Odaberite ovo i pritisnite gumb <i>\"Postavke...\"</i> za podeÅ¡avanje vaÅ¡e prilagođene ljuske radne povrÅ¡ine. Nije preporučljivo prosječnim korisnicima."
     141msgid ""
     142"Choose this and press the <i>\"Setup...\"</i> button to configure you custom "
     143"desktop shell. Not recommended for the average user."
     144msgstr ""
     145"Odaberite ovo i pritisnite gumb <i>\"Postavke...\"</i> za podeÅ¡avanje vaÅ¡e "
     146"prilagođene ljuske radne povrÅ¡ine. Nije preporučljivo prosječnim korisnicima."
    137147
    138148#. i18n: radio button to chose Windows Desktop shell
     
    146156#. +> trunk stable
    147157#: platform.ui:94
    148 msgid "This shell is reserved for the user's custom shell. Press the \"Setup\" button to setup your favorite shell."
    149 msgstr "Ova ljuska je rezervirana za korisnički prilagođenu ljusku. Pritisnite gumb \"Postavke...\" da podesite vaÅ¡u omiljenu ljusku."
     158msgid ""
     159"This shell is reserved for the user's custom shell. Press the \"Setup\" "
     160"button to setup your favorite shell."
     161msgstr ""
     162"Ova ljuska je rezervirana za korisnički prilagođenu ljusku. Pritisnite gumb "
     163"\"Postavke...\" da podesite vaÅ¡u omiljenu ljusku."
    150164
    151165#. i18n: tooltip for button to setup custom Desktop shell
     
    153167#. +> trunk stable
    154168#: platform.ui:109
    155 #, fuzzy
    156169#| msgctxt "tooltip for button to setup custom Desktop shell"
    157170#| msgid "Press to setup your custom desktop shell"
     
    166179#| msgctxt "whatsThis for button to setup custom Desktop shells"
    167180#| msgid "Press this and a configuration dialog will appear to allow you to configure your custom desktop shell."
    168 msgid "Press this and a configuration dialog will appear to allow you to configure your custom desktop shell."
    169 msgstr "Pritisnite ovo i pojavit će se konfiguracijski dijalog koji će vam dopustiti da podesite vaÅ¡u prilagođenu ljusku radne povrÅ¡ine."
     181msgid ""
     182"Press this and a configuration dialog will appear to allow you to configure "
     183"your custom desktop shell."
     184msgstr ""
     185"Pritisnite ovo i pojavit će se konfiguracijski dijalog koji će vam dopustiti "
     186"da podesite vaÅ¡u prilagođenu ljusku radne povrÅ¡ine."
    170187
    171188#. i18n: ectx: property (text), widget (QPushButton, btnShellSetup)
     
    185202#. +> trunk stable
    186203#: platform.ui:161
    187 #, fuzzy
    188204#| msgctxt "tooltip for checkbox"
    189205#| msgid "This will enable automatic regeneration of Windows' Start menu entries for KDE applications"
    190 msgid "This will enable automatic regeneration of Windows' Start menu entries for KDE applications"
    191 msgstr "Ovo će omogućiti automatsku regeneraciju stavki Windows Start izbornika sa KDE aplikacijama "
     206msgid ""
     207"This will enable automatic regeneration of Windows' Start menu entries for "
     208"KDE applications"
     209msgstr ""
     210"Ovo će omogućiti automatsko obnavljanje stavki u  Start izborniku Windowsa za "
     211"aplikacije KDE-a"
    192212
    193213#. i18n: whatsThis tooltip
     
    198218#| msgctxt "whatsThis tooltip"
    199219#| msgid "This option defines if Windows' Start menu entries should be regenerated or not. By default start menu entries are regenerated automatically, but you may wish to disable it if you have issues with that."
    200 msgid "This option defines if Windows' Start menu entries should be regenerated or not. By default start menu entries are regenerated automatically, but you may wish to disable it if you have issues with that."
    201 msgstr "Ova opcija određuje da li će stavke Windowsovog Start izbornika biti regenerirane ili ne. Zadano je da se stavke izbornika regeneriraju automatski, ali moÅŸda to ÅŸelite isključiti ukoliko s time imate problema.  "
     220msgid ""
     221"This option defines if Windows' Start menu entries should be regenerated or "
     222"not. By default start menu entries are regenerated automatically, but you may "
     223"wish to disable it if you have issues with that."
     224msgstr ""
     225"Ova opcija određuje da li će stavke Windowsovog Start izbornika biti "
     226"regenerirane ili ne. Zadano je da se stavke izbornika regeneriraju "
     227"automatski, ali moÅŸda to ÅŸelite isključiti ukoliko s time imate problema.  "
    202228
    203229#. i18n: checkbox caption in System Integration options
     
    212238#. +> trunk stable
    213239#: platform.ui:177
    214 #, fuzzy
    215240#| msgctxt "tooltip for checkbox"
    216241#| msgid "Use native Windows file dialogs instead of KDE ones"
     
    225250#| msgctxt "whatsThis tooltip"
    226251#| msgid "Choose this option to make KDE applications use the standard Windows Open/Save file dialogs, instead of those normally used in KDE."
    227 msgid "Choose this option to make KDE applications use the standard Windows Open/Save file dialogs, instead of those normally used in KDE."
    228 msgstr "Izaberite ovu opciju kako bi KDE aplikacije koristile uobičajene Windows Otvori/Spemi datotečne dijaloge umjesto onih normalnih koriÅ¡tenih u KDE-u."
     252msgid ""
     253"Choose this option to make KDE applications use the standard Windows "
     254"Open/Save file dialogs, instead of those normally used in KDE."
     255msgstr ""
     256"Izaberite ovu opciju kako bi KDE aplikacije koristile uobičajene Windows "
     257"Otvori/Spemi datotečne dijaloge umjesto onih normalnih koriÅ¡tenih u KDE-u."
    229258
    230259#. i18n: checkbox caption in System Integration options
     
    239268#. +> trunk stable
    240269#: platform.ui:199
    241 #, fuzzy
    242270#| msgctxt "tooltip for checkbox"
    243271#| msgid "Install System Settings into the Windows Control Panel."
    244272msgid "Install System Settings into the Windows Control Panel."
    245 msgstr "Instaliraj \"Postavke sustava\" u kontrolni panel Windowsa."
     273msgstr "Instaliraj Postavke sustava u kontrolni panel Windowsa."
    246274
    247275#. i18n: whatsThis tooltip
     
    252280#| msgctxt "whatsThis tooltip"
    253281#| msgid "This will install the KDE 'System Settings' as an element in the Windows Control Panel.<br><b>Caution: This option tweaks your Windows registry.</b>"
    254 msgid "This will install the KDE 'System Settings' as an element in the Windows Control Panel.<br><b>Caution: This option tweaks your Windows registry.</b>"
    255 msgstr "Ovo će instalirati KDE-ove 'Postavke sustava' kao element kontrolnog panela Windowsa.<br><b>Oprez: Ova opcija zadire u vaÅ¡ Windows registar.</b>"
     282msgid ""
     283"This will install the KDE 'System Settings' as an element in the Windows "
     284"Control Panel.<br><b>Caution: This option tweaks your Windows registry.</b>"
     285msgstr ""
     286"Ovo će instalirati KDE-ove 'Postavke sustava' kao element kontrolnog panela "
     287"Windowsa.<br><b>Oprez: Ova opcija zadire u vaÅ¡ Windows registar.</b>"
    256288
    257289#. i18n: checkbox caption in System Integration options
     
    266298#. +> trunk stable
    267299#: platform.ui:212
    268 #, fuzzy
    269300#| msgctxt "tooltip for checkbox"
    270301#| msgid "Install Oxygen cursors as Windows cursor schemes"
    271302msgid "Install Oxygen cursors as Windows cursor schemes"
    272 msgstr "Instaliraj Oxygen pokazivače kao Windows sheme pokazvača."
     303msgstr "Instaliraj Oxygen pokazivače kao sheme pokazvača u Windowsu."
    273304
    274305#. i18n: whatsThis tooltip
     
    279310#| msgctxt "whatsThis tooltip"
    280311#| msgid "This will install the Oxygen cursors into your system and combine them as a cursor theme.<br><b>Caution: This option tweaks your Windows registry.</b>"
    281 msgid "This will install the Oxygen cursors into your system and combine them as a cursor theme.<br><b>Caution: This option tweaks your Windows registry.</b>"
    282 msgstr "Ovo će instalirati Oxygen pokazivače u vaÅ¡ sustav i objediniti ih kao temu pokazivača.<br><b>Oprez: Ova opcija zadire u vaÅ¡ Windows registar.</b>"
     312msgid ""
     313"This will install the Oxygen cursors into your system and combine them as a "
     314"cursor theme.<br><b>Caution: This option tweaks your Windows registry.</b>"
     315msgstr ""
     316"Ovo će instalirati Oxygen pokazivače u vaÅ¡ sustav i objediniti ih kao temu "
     317"pokazivača.<br><b>Oprez: Ova opcija zadire u vaÅ¡ Windows registar.</b>"
    283318
    284319#. i18n: checkbox caption in System Integration options
     
    293328#. +> trunk stable
    294329#: platform.ui:225
    295 #, fuzzy
    296330#| msgctxt "tooltip for checkbox"
    297331#| msgid "This option installs KDE wallpapers into your \"My Pictures\" directory"
    298332msgid "This option installs KDE wallpapers into your \"My Pictures\" directory"
    299 msgstr "Ova opcija instalira KDE pozadinske slike u vaÅ¡ \"My Pictures\" direktorij"
     333msgstr ""
     334"Ova će opcija instalirati pozadinske slike KDE-a u vaÅ¡ direktorij \"My "
     335"Pictures\""
    300336
    301337#. i18n: whatsThis tooltip
     
    306342#| msgctxt "whatsThis tooltip"
    307343#| msgid "This will install KDE wallpapers into the <i>\"My Pictures\"</i> directory so they can be used as your Windows wallpaper. If the checkbox is set to half-checked then it means that there are new wallpapers available to update.<br> The wallpaper aspect ratio will be selected according to your current screen resolution."
    308 msgid "This will install KDE wallpapers into the <i>\"My Pictures\"</i> directory so they can be used as your Windows wallpaper. If the checkbox is set to half-checked then it means that there are new wallpapers available to update.<br> The wallpaper aspect ratio will be selected according to your current screen resolution."
    309 msgstr "Ovo će instalirati KDE-ove pozadinske slike u direktorij <i>\"Moje Slike\"</i> kako bi se mogle koristiti kao vaÅ¡e Windows pozadinske slike. Ako je odabirni okvir označen na pola, znači da postoji novih pozadinskih slika dostupnih kod aÅŸuriranja.<br> Omjer Å¡irine i visine pozadinske slike biti će odabran prema vaÅ¡oj trenutnoj rezoluciji zaslona."
     344msgid ""
     345"This will install KDE wallpapers into the <i>\"My Pictures\"</i> directory so "
     346"they can be used as your Windows wallpaper. If the checkbox is set to "
     347"half-checked then it means that there are new wallpapers available to update."
     348"<br> The wallpaper aspect ratio will be selected according to your current "
     349"screen resolution."
     350msgstr ""
     351"Ovo će instalirati KDE-ove pozadinske slike u direktorij <i>\"Moje Slike\"</i>"
     352" kako bi se mogle koristiti kao vaÅ¡e Windows pozadinske slike. Ako je "
     353"odabirni okvir označen na pola, znači da postoji novih pozadinskih slika "
     354"dostupnih kod aÅŸuriranja.<br> Omjer Å¡irine i visine pozadinske slike biti će "
     355"odabran prema vaÅ¡oj trenutnoj rezoluciji zaslona."
    310356
    311357#. i18n: checkbox caption in System Integration options
     
    320366#. +> trunk stable
    321367#: platform.ui:238
    322 #, fuzzy
    323368#| msgctxt "tooltip for checkbox"
    324369#| msgid "This will make essential KDE processes run at user login"
    325370msgid "This will make essential KDE processes run at user login"
    326 msgstr "Ovo će pokrenuti bitne KDE procese prilikom prijave u sustav"
     371msgstr "Ovo će pokrenuti bitne procese KDE-a prilikom prijave u sustav"
    327372
    328373#. i18n: whatsThis tooltip
     
    333378#| msgctxt "whatsThis tooltip"
    334379#| msgid "Enabling this option will start essential KDE processes at user login. Normally these processes are started when you first start a KDE application, thereby delaying the actual application launch.<br>It is recommended to enable this option to make your applications launch faster for the first time.<br><b>Caution: This option tweaks your Windows registry.</b>"
    335 msgid "Enabling this option will start essential KDE processes at user login. Normally these processes are started when you first start a KDE application, thereby delaying the actual application launch.<br>It is recommended to enable this option to make your applications launch faster for the first time.<br><b>Caution: This option tweaks your Windows registry.</b>"
    336 msgstr "Omogućavanjem ove opcije KDE procesi će se pokrenuti prilikom prijave u sutav. Obično se ovi procesi pokeću kada pokrenete prvu KDE aplikaciju unutar korisničke sesije, Å¡to odugovlači samo pokretanje aplikacije.<br>Preporuča se da uključite ovu opciju kako bi učinili pokretanje vaÅ¡ih aplikacija prvi put brÅŸim.<br><b>Oprez: Ova opcija zadire u vaÅ¡ Windows registar.</b>"
     380msgid ""
     381"Enabling this option will start essential KDE processes at user login. "
     382"Normally these processes are started when you first start a KDE application, "
     383"thereby delaying the actual application launch.<br>It is recommended to "
     384"enable this option to make your applications launch faster for the first time."
     385"<br><b>Caution: This option tweaks your Windows registry.</b>"
     386msgstr ""
     387"Omogućavanjem ove opcije KDE procesi će se pokrenuti prilikom prijave u sutav."
     388" Obično se ovi procesi pokeću kada pokrenete prvu KDE aplikaciju unutar "
     389"korisničke sesije, Å¡to odugovlači samo pokretanje aplikacije.<br>Preporuča se "
     390"da uključite ovu opciju kako bi učinili pokretanje vaÅ¡ih aplikacija prvi put "
     391"brÅŸim.<br><b>Oprez: Ova opcija zadire u vaÅ¡ Windows registar.</b>"
    337392
    338393#. i18n: checkbox caption in System Integration options
     
    355410#. +> trunk stable
    356411#: shellEdit.cpp:24
    357 #, fuzzy
    358412#| msgid "This shell is reserved for the user's custom shell. Press the \"Setup\" button to setup your favorite shell."
    359 msgid "This shell is reserved for user's custom shell. Press \"Setup\" button to setup your favourite shell."
    360 msgstr "Ova ljuska je rezervirana za korisnički prilagođenu ljusku. Pritisnite gumb \"Postavke...\" da podesite vaÅ¡u omiljenu ljusku."
     413msgid ""
     414"This shell is reserved for user's custom shell. Press \"Setup\" button to "
     415"setup your favourite shell."
     416msgstr ""
     417"Ova je ljuska rezervirana za korisnički prilagođenu ljusku. Pritisnite gumb "
     418"\"Postavke\" kako biste podesili vaÅ¡u omiljenu ljusku."
    361419
    362420#. i18n: ectx: property (windowTitle), widget (QDialog, ShellEditDlg)
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmcolors.po

    r1123 r1129  
    1111"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    1212"POT-Creation-Date: 2011-07-08 10:22+0200\n"
    13 "PO-Revision-Date: 2011-03-18 18:21+0100\n"
     13"PO-Revision-Date: 2011-07-12 16:39+0200\n"
    1414"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
    1515"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
     
    1818"Content-Transfer-Encoding: 8bit\n"
    1919"Language: hr\n"
    20 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     20"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     21"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    2122"X-Generator: Lokalize 1.2\n"
    2223"X-Environment: kde\n"
     
    3233msgctxt "EMAIL OF TRANSLATORS"
    3334msgid "Your emails"
    34 msgstr "renato@translator-shop.org, DoDoEntertainment@gmail.com, adundovi@gmail.com"
     35msgstr ""
     36"renato@translator-shop.org, DoDoEntertainment@gmail.com, adundovi@gmail.com"
    3537
    3638#. i18n: ectx: attribute (title), widget (QWidget, pageColors)
     
    9799"The scheme you have selected appears to be a KDE3 scheme.\n"
    98100"\n"
    99 "KDE will attempt to import this scheme, however many color roles have been added since KDE3. Some manual work will likely be required.\n"
     101"KDE will attempt to import this scheme, however many color roles have been "
     102"added since KDE3. Some manual work will likely be required.\n"
    100103"\n"
    101104"This scheme will not be saved automatically."
     
    103106"Shema koju ste uvezli čini se kao KDE3 shema.\n"
    104107"\n"
    105 "KDE će pokuÅ¡ati uvesti ovu shemu, međutim od KDE3 dodane su nove uloge boja. Vjerojatno će biti potrebno dodatno ručno podeÅ¡avanje.\n"
     108"KDE će pokuÅ¡ati uvesti ovu shemu, međutim od KDE3 dodane su nove uloge boja. "
     109"Vjerojatno će biti potrebno dodatno ručno podeÅ¡avanje.\n"
    106110"\n"
    107111"Ova shema neće biti spremljena automatski."
     
    523527#. +> trunk stable
    524528#: colorsettings.ui:605
    525 #, fuzzy
    526529#| msgid "Active Titlebar Text"
    527530msgid "Active Titlebar Secondary"
    528 msgstr "Tekst aktivne naslovne trake"
     531msgstr "Druga aktivna naslovna traka"
    529532
    530533#. i18n: ectx: property (text), item, widget (QTableWidget, commonColorTable)
     
    543546#. +> trunk stable
    544547#: colorsettings.ui:620
    545 #, fuzzy
    546548#| msgid "Inactive Titlebar Text"
    547549msgid "Inactive Titlebar Secondary"
    548 msgstr "Tekst neaktivne naslovne trake"
     550msgstr "Druga neaktivna naslovna traka"
    549551
    550552#. i18n: ectx: attribute (title), widget (QWidget, pageInactice)
     
    11131115msgid ""
    11141116"Link Text on Link Background\n"
    1115 "(Note: Link Background is derived from Link Text and cannot be separately configured at this time)"
     1117"(Note: Link Background is derived from Link Text and cannot be separately "
     1118"configured at this time)"
    11161119msgstr ""
    11171120"Tekst poveznice na pozadini poveznice\n"
    1118 "(Napomena: Pozadina poveznice je izvedena iz teksta poveznice i ne moÅŸe biti odvojeno konfigurirana u ovom trenutku)"
     1121"(Napomena: Pozadina poveznice je izvedena iz teksta poveznice i ne moÅŸe biti "
     1122"odvojeno konfigurirana u ovom trenutku)"
    11191123
    11201124#. i18n: ectx: property (toolTip), widget (QLabel, labelBack4)
     
    11231127msgid ""
    11241128"Visited Text on Visited Background\n"
    1125 "(Note: Visited Background is derived from Visited Text and cannot be separately configured at this time)"
     1129"(Note: Visited Background is derived from Visited Text and cannot be "
     1130"separately configured at this time)"
    11261131msgstr ""
    11271132"Tekst posjećene poveznice na pozadini posjećene poveznice\n"
    1128 "(Napomena: Posjećena poveznica je izvedena iz posjećenog teksta poveznice i trenutno ne moÅŸe biti odvojeno konfigurirana)"
     1133"(Napomena: Posjećena poveznica je izvedena iz posjećenog teksta poveznice i "
     1134"trenutno ne moÅŸe biti odvojeno konfigurirana)"
    11291135
    11301136#. i18n: ectx: property (toolTip), widget (QLabel, labelBack2)
     
    11331139msgid ""
    11341140"Active Text on Active Background\n"
    1135 "(Note: Active Background is derived from Active Text and cannot be separately configured at this time)"
     1141"(Note: Active Background is derived from Active Text and cannot be separately "
     1142"configured at this time)"
    11361143msgstr ""
    11371144"Aktivni tekst na aktivnoj pozadini\n"
    1138 "(Napomena: Aktivna pozadina je izvedena iz aktivnog teksta i trenutno ne moÅŸe biti odvojeno konfigurirana)"
     1145"(Napomena: Aktivna pozadina je izvedena iz aktivnog teksta i trenutno ne moÅŸe "
     1146"biti odvojeno konfigurirana)"
    11391147
    11401148#. i18n: ectx: property (toolTip), widget (QLabel, labelBack1)
     
    11571165msgid ""
    11581166"Negative Text on Negative Background\n"
    1159 "(Note: Negative Background is derived from Negative Text and cannot be separately configured at this time)"
     1167"(Note: Negative Background is derived from Negative Text and cannot be "
     1168"separately configured at this time)"
    11601169msgstr ""
    11611170"Negativno tekst na negativnoj pozadini\n"
    1162 "(Napomena: Negativna pozadina je izvedena iz negativnog teksta i trenutno ne moÅŸe biti odvojeno konfigurirana)"
     1171"(Napomena: Negativna pozadina je izvedena iz negativnog teksta i trenutno ne "
     1172"moÅŸe biti odvojeno konfigurirana)"
    11631173
    11641174#. i18n: ectx: property (toolTip), widget (QLabel, labelBack6)
     
    11671177msgid ""
    11681178"Neutral Text on Neutral Background\n"
    1169 "(Note: Neutral Background is derived from Neutral Text and cannot be separately configured at this time)"
     1179"(Note: Neutral Background is derived from Neutral Text and cannot be "
     1180"separately configured at this time)"
    11701181msgstr ""
    11711182"Neutralni tekst na neutralnoj pozadini\n"
    1172 "(Napomena: Neutralna pozadina je izvedena iz neutralnog teksta i trenutno ne moÅŸe biti odvojeno konfigurirana)"
     1183"(Napomena: Neutralna pozadina je izvedena iz neutralnog teksta i trenutno ne "
     1184"moÅŸe biti odvojeno konfigurirana)"
    11731185
    11741186#. i18n: ectx: property (toolTip), widget (QLabel, labelBack7)
     
    11771189msgid ""
    11781190"Positive Text on Positive Background\n"
    1179 "(Note: Positive Background is derived from Positive Text and cannot be separately configured at this time)"
     1191"(Note: Positive Background is derived from Positive Text and cannot be "
     1192"separately configured at this time)"
    11801193msgstr ""
    11811194"Pozitivan tekst na pozitivnoj pozadini\n"
    1182 "(Napomena: Pozitivna pozadina je izvedena iz pozitivnog teksta i trenutno ne moÅŸe biti odvojeno konfigurirana)"
     1195"(Napomena: Pozitivna pozadina je izvedena iz pozitivnog teksta i trenutno ne "
     1196"moÅŸe biti odvojeno konfigurirana)"
    11831197
    11841198#. i18n: ectx: property (toolTip), widget (QLabel, labelFore9)
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcminput.po

    r1123 r1129  
    44# Andrej Dundovic <adundovi@gmail.com>, 2010.
    55# Marko Dimjasevic <marko@dimjasevic.net>, 2011.
     6# Marko DimjaÅ¡ević <marko@dimjasevic.net>, 2011.
    67msgid ""
    78msgstr ""
     
    910"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    1011"POT-Creation-Date: 2011-07-08 10:22+0200\n"
    11 "PO-Revision-Date: 2011-02-26 10:26+0100\n"
    12 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     12"PO-Revision-Date: 2011-07-12 16:40+0200\n"
     13"Last-Translator: Marko DimjaÅ¡ević <marko@dimjasevic.net>\n"
    1314"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
    1415"MIME-Version: 1.0\n"
     
    1617"Content-Transfer-Encoding: 8bit\n"
    1718"Language: hr\n"
    18 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     19"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     20"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    1921"X-Generator: Lokalize 1.2\n"
    2022"X-Poedit-Bookmarks: 42,-1,-1,-1,-1,-1,-1,-1,-1,-1\n"
     
    134136#. +> trunk stable
    135137#: kmousedlg.ui:72
    136 msgid "Change the direction of scrolling for the mouse wheel or the 4th and 5th mouse buttons."
    137 msgstr "Promjena smjera klizanja za kotačić miÅ¡a ili za četvrtu ili petu tipku miÅ¡a."
     138msgid ""
     139"Change the direction of scrolling for the mouse wheel or the 4th and 5th "
     140"mouse buttons."
     141msgstr ""
     142"Promjena smjera klizanja za kotačić miÅ¡a ili za četvrtu ili petu tipku miÅ¡a."
    138143
    139144#. i18n: ectx: property (text), widget (QCheckBox, cbScrollPolarity)
     
    195200#. +> trunk stable
    196201#: logitechmouse.cpp:226
    197 msgid "RF channel 1 has been set. Please press Connect button on mouse to re-establish link"
    198 msgstr "RF kanal 1 je podeÅ¡en. Pritisnite tipku za povezivanje na vaÅ¡em miÅ¡u da biste ponovo uspostavili vezu."
     202msgid ""
     203"RF channel 1 has been set. Please press Connect button on mouse to "
     204"re-establish link"
     205msgstr ""
     206"RF kanal 1 je podeÅ¡en. Pritisnite tipku za povezivanje na vaÅ¡em miÅ¡u da biste "
     207"ponovo uspostavili vezu."
    199208
    200209#. +> trunk stable
     
    205214#. +> trunk stable
    206215#: logitechmouse.cpp:230
    207 msgid "RF channel 2 has been set. Please press Connect button on mouse to re-establish link"
    208 msgstr "RF kanal 2 je podeÅ¡en. Pritisnite tipku za povezivanje na vaÅ¡em miÅ¡u da biste ponovo uspostavili vezu."
     216msgid ""
     217"RF channel 2 has been set. Please press Connect button on mouse to "
     218"re-establish link"
     219msgstr ""
     220"RF kanal 2 je podeÅ¡en. Pritisnite tipku za povezivanje na vaÅ¡em miÅ¡u da biste "
     221"ponovo uspostavili vezu."
    209222
    210223#. +> trunk stable
     
    340353#. +> trunk stable
    341354#: logitechmouse_base.ui:107
    342 msgid "You have a Logitech Mouse connected, and libusb was found at compile time, but it was not possible to access this mouse. This is probably caused by a permissions problem - you should consult the manual on how to fix this."
    343 msgstr "Priključen je miÅ¡ Logitech Mouse i tijekom sastavljanja upravljačkih programa pronađena je datoteka libusb, ali pristupanje miÅ¡u nije bilo moguće. Vjerojatan uzrok je problem s dopuÅ¡tenjima. Proučite priručnik radi rjeÅ¡avanja ovog problema."
     355msgid ""
     356"You have a Logitech Mouse connected, and libusb was found at compile time, "
     357"but it was not possible to access this mouse. This is probably caused by a "
     358"permissions problem - you should consult the manual on how to fix this."
     359msgstr ""
     360"Priključen je miÅ¡ Logitech Mouse i tijekom sastavljanja upravljačkih programa "
     361"pronađena je datoteka libusb, ali pristupanje miÅ¡u nije bilo moguće. "
     362"Vjerojatan uzrok je problem s dopuÅ¡tenjima. Proučite priručnik radi "
     363"rjeÅ¡avanja ovog problema."
    344364
    345365#. +> trunk stable
    346366#: mouse.cpp:91
    347 msgid "<h1>Mouse</h1> This module allows you to choose various options for the way in which your pointing device works. Your pointing device may be a mouse, trackball, or some other hardware that performs a similar function."
    348 msgstr "<h1>MiÅ¡</h1> Ovaj vam modul omogućuje podeÅ¡avanje raznih opcija načina na koje vaÅ¡ pokazivač funkcionira. Uređaj pokazivača moÅŸe biti miÅ¡, kugla za praćenje ili bilo koji drugi hardver slične namjene."
     367msgid ""
     368"<h1>Mouse</h1> This module allows you to choose various options for the way "
     369"in which your pointing device works. Your pointing device may be a mouse, "
     370"trackball, or some other hardware that performs a similar function."
     371msgstr ""
     372"<h1>MiÅ¡</h1> Ovaj vam modul omogućuje podeÅ¡avanje raznih opcija načina na "
     373"koje vaÅ¡ pokazivač funkcionira. Uređaj pokazivača moÅŸe biti miÅ¡, kugla za "
     374"praćenje ili bilo koji drugi hardver slične namjene."
    349375
    350376#. +> trunk stable
     
    355381#. +> trunk stable
    356382#: mouse.cpp:120
    357 msgid "If you are left-handed, you may prefer to swap the functions of the left and right buttons on your pointing device by choosing the 'left-handed' option. If your pointing device has more than two buttons, only those that function as the left and right buttons are affected. For example, if you have a three-button mouse, the middle button is unaffected."
    358 msgstr "Ako ste ljevoruki mogli biste ÅŸeljeti zamijeniti funkcije lijeve i desne tipke miÅ¡a pomoću odabira opcije \"Ljevoruk\". Ako vaÅ¡ miÅ¡ ima viÅ¡e od dvije tipke, ova će opcija utjecati samo na tipke koje funkcioniraju kao lijeva i desna. Na primjer, ako imate miÅ¡a s tri tipke, funkcioniranje srednje tipke neće biti izmijenjeno."
     383msgid ""
     384"If you are left-handed, you may prefer to swap the functions of the left and "
     385"right buttons on your pointing device by choosing the 'left-handed' option. "
     386"If your pointing device has more than two buttons, only those that function "
     387"as the left and right buttons are affected. For example, if you have a "
     388"three-button mouse, the middle button is unaffected."
     389msgstr ""
     390"Ako ste ljevoruki mogli biste ÅŸeljeti zamijeniti funkcije lijeve i desne "
     391"tipke miÅ¡a pomoću odabira opcije \"Ljevoruk\". Ako vaÅ¡ miÅ¡ ima viÅ¡e od dvije "
     392"tipke, ova će opcija utjecati samo na tipke koje funkcioniraju kao lijeva i "
     393"desna. Na primjer, ako imate miÅ¡a s tri tipke, funkcioniranje srednje tipke "
     394"neće biti izmijenjeno."
    359395
    360396#. +> trunk stable
    361397#: mouse.cpp:130
    362 msgid "The default behavior in KDE is to select and activate icons with a single click of the left button on your pointing device. This behavior is consistent with what you would expect when you click links in most web browsers. If you would prefer to select with a single click, and activate with a double click, check this option."
    363 msgstr "Zadano ponaÅ¡anje unutar KDE-a je odabir i aktiviranje ikona jednim klikom lijeve tipke vaÅ¡eg miÅ¡a, Å¡to je slično onome u pretraÅŸivačima za internet. Ako ÅŸelite odabiranje s jednim, a aktiviranje s dva klika, označite ovu opciju."
     398msgid ""
     399"The default behavior in KDE is to select and activate icons with a single "
     400"click of the left button on your pointing device. This behavior is consistent "
     401"with what you would expect when you click links in most web browsers. If you "
     402"would prefer to select with a single click, and activate with a double click, "
     403"check this option."
     404msgstr ""
     405"Zadano ponaÅ¡anje unutar KDE-a je odabir i aktiviranje ikona jednim klikom "
     406"lijeve tipke vaÅ¡eg miÅ¡a, Å¡to je slično onome u pretraÅŸivačima za internet. "
     407"Ako ÅŸelite odabiranje s jednim, a aktiviranje s dva klika, označite ovu "
     408"opciju."
    364409
    365410#. +> trunk stable
     
    370415#. +> trunk stable
    371416#: mouse.cpp:144
    372 msgid "If you check this option, pausing the mouse pointer over an icon on the screen will automatically select that icon. This may be useful when single clicks activate icons, and you want only to select the icon without activating it."
    373 msgstr "Odabiranjem ove opcije, dulje zadrÅŸavanje pokazivača iznad ikone automatski će odabrati ikonu. To je korisno ako upotrebljavate jedan klik za aktiviranje ikona, ali je ne ÅŸelite pokrenuti, nego samo odabrati."
     417msgid ""
     418"If you check this option, pausing the mouse pointer over an icon on the "
     419"screen will automatically select that icon. This may be useful when single "
     420"clicks activate icons, and you want only to select the icon without "
     421"activating it."
     422msgstr ""
     423"Odabiranjem ove opcije, dulje zadrÅŸavanje pokazivača iznad ikone automatski "
     424"će odabrati ikonu. To je korisno ako upotrebljavate jedan klik za aktiviranje "
     425"ikona, ali je ne ÅŸelite pokrenuti, nego samo odabrati."
    374426
    375427#. +> trunk stable
    376428#: mouse.cpp:150
    377 msgid "If you have checked the option to automatically select icons, this slider allows you to select how long the mouse pointer must be paused over the icon before it is selected."
    378 msgstr "Odabiranjem opcije automatskog odabira ikona, ovaj klizač omogućuje podeÅ¡avanje razdoblja tijekom kojeg pokazivač miÅ¡a mora biti iznad ikone da bi ona bila odabrana."
     429msgid ""
     430"If you have checked the option to automatically select icons, this slider "
     431"allows you to select how long the mouse pointer must be paused over the icon "
     432"before it is selected."
     433msgstr ""
     434"Odabiranjem opcije automatskog odabira ikona, ovaj klizač omogućuje "
     435"podeÅ¡avanje razdoblja tijekom kojeg pokazivač miÅ¡a mora biti iznad ikone da "
     436"bi ona bila odabrana."
    379437
    380438#. +> trunk stable
     
    395453#. +> trunk stable
    396454#: mouse.cpp:195
    397 msgid "<p>This option allows you to change the relationship between the distance that the mouse pointer moves on the screen and the relative movement of the physical device itself (which may be a mouse, trackball, or some other pointing device.)</p><p> A high value for the acceleration will lead to large movements of the mouse pointer on the screen even when you only make a small movement with the physical device. Selecting very high values may result in the mouse pointer flying across the screen, making it hard to control.</p>"
    398 msgstr "<p>Ova opcija omogućuje vam izmjenu omjera između udaljenosti koju pokazivač miÅ¡a prijeđe na zaslonu i relativne kretnje samog miÅ¡a ili bilo kojeg uređaja za pokazivanje.</p><p>Velika vrijednost ubrzavanja prouzrokovat će velike pomake pokazivača na zaslonu čak i u slučaju malenih kretnji samog uređaja. Odabir jako velikih vrijednosti moÅŸe izazvati prebrzo kretanje pokazivača kojim je teÅ¡ko upravljati.</p>"
     455msgid ""
     456"<p>This option allows you to change the relationship between the distance "
     457"that the mouse pointer moves on the screen and the relative movement of the "
     458"physical device itself (which may be a mouse, trackball, or some other "
     459"pointing device.)</p><p> A high value for the acceleration will lead to large "
     460"movements of the mouse pointer on the screen even when you only make a small "
     461"movement with the physical device. Selecting very high values may result in "
     462"the mouse pointer flying across the screen, making it hard to control.</p>"
     463msgstr ""
     464"<p>Ova opcija omogućuje vam izmjenu omjera između udaljenosti koju pokazivač "
     465"miÅ¡a prijeđe na zaslonu i relativne kretnje samog miÅ¡a ili bilo kojeg uređaja "
     466"za pokazivanje.</p><p>Velika vrijednost ubrzavanja prouzrokovat će velike "
     467"pomake pokazivača na zaslonu čak i u slučaju malenih kretnji samog uređaja. "
     468"Odabir jako velikih vrijednosti moÅŸe izazvati prebrzo kretanje pokazivača "
     469"kojim je teÅ¡ko upravljati.</p>"
    399470
    400471#. +> trunk stable
     
    405476#. +> trunk stable
    406477#: mouse.cpp:215
    407 msgid "<p>The threshold is the smallest distance that the mouse pointer must move on the screen before acceleration has any effect. If the movement is smaller than the threshold, the mouse pointer moves as if the acceleration was set to 1X;</p><p> thus, when you make small movements with the physical device, there is no acceleration at all, giving you a greater degree of control over the mouse pointer. With larger movements of the physical device, you can move the mouse pointer rapidly to different areas on the screen.</p>"
    408 msgstr "<p>Prag je najmanja udaljenost koju pokazivač miÅ¡a mora prijeći na zaslonu prije no Å¡to ubrzavanje dobije na učinku. Ako je pomak manji od praga, pokazivač miÅ¡a pomicat će se kao da je ubrzavanje postavljeno na 1x.</p><p>Na taj način, u slučaju manjih kretnji samim uređajem, ne postoji nikakvo ubrzavanje i postiÅŸete veću upravljivost nad pokazivačem. Uz velike kretnje samim uređajem pokazivač moÅŸete brzo premjestiti u različite dijelove zaslona.</p>"
     478msgid ""
     479"<p>The threshold is the smallest distance that the mouse pointer must move on "
     480"the screen before acceleration has any effect. If the movement is smaller "
     481"than the threshold, the mouse pointer moves as if the acceleration was set to "
     482"1X;</p><p> thus, when you make small movements with the physical device, "
     483"there is no acceleration at all, giving you a greater degree of control over "
     484"the mouse pointer. With larger movements of the physical device, you can move "
     485"the mouse pointer rapidly to different areas on the screen.</p>"
     486msgstr ""
     487"<p>Prag je najmanja udaljenost koju pokazivač miÅ¡a mora prijeći na zaslonu "
     488"prije no Å¡to ubrzavanje dobije na učinku. Ako je pomak manji od praga, "
     489"pokazivač miÅ¡a pomicat će se kao da je ubrzavanje postavljeno na 1x.</p><p>Na "
     490"taj način, u slučaju manjih kretnji samim uređajem, ne postoji nikakvo "
     491"ubrzavanje i postiÅŸete veću upravljivost nad pokazivačem. Uz velike kretnje "
     492"samim uređajem pokazivač moÅŸete brzo premjestiti u različite dijelove zaslona."
     493"</p>"
    409494
    410495#. +> trunk stable
     
    420505#. +> trunk stable
    421506#: mouse.cpp:235
    422 msgid "The double click interval is the maximal time (in milliseconds) between two mouse clicks which turns them into a double click. If the second click happens later than this time interval after the first click, they are recognized as two separate clicks."
    423 msgstr "Razdoblje za dvostruki klik je najdulje vrijeme koje moÅŸe proteći između dva klika, a da se oni protumače kao dvostruki klik. Ako drugi put kliknete nakon navedenog razdoblja, tad se klikovi prepoznaju kao dva zasebna klikanja."
     507msgid ""
     508"The double click interval is the maximal time (in milliseconds) between two "
     509"mouse clicks which turns them into a double click. If the second click "
     510"happens later than this time interval after the first click, they are "
     511"recognized as two separate clicks."
     512msgstr ""
     513"Razdoblje za dvostruki klik je najdulje vrijeme koje moÅŸe proteći između dva "
     514"klika, a da se oni protumače kao dvostruki klik. Ako drugi put kliknete nakon "
     515"navedenog razdoblja, tad se klikovi prepoznaju kao dva zasebna klikanja."
    424516
    425517#. +> trunk stable
     
    430522#. +> trunk stable
    431523#: mouse.cpp:250
    432 msgid "If you click with the mouse (e.g. in a multi-line editor) and begin to move the mouse within the drag start time, a drag operation will be initiated."
    433 msgstr "Ako kliknete miÅ¡em i započnete ga prevlačiti unutar navedenog razdoblja, tad će započeti prevlačenje (npr. s premjeÅ¡tanjem odabranog teksta u uređivaču teksta)."
     524msgid ""
     525"If you click with the mouse (e.g. in a multi-line editor) and begin to move "
     526"the mouse within the drag start time, a drag operation will be initiated."
     527msgstr ""
     528"Ako kliknete miÅ¡em i započnete ga prevlačiti unutar navedenog razdoblja, tad "
     529"će započeti prevlačenje (npr. s premjeÅ¡tanjem odabranog teksta u uređivaču "
     530"teksta)."
    434531
    435532#. +> trunk stable
     
    440537#. +> trunk stable
    441538#: mouse.cpp:263
    442 msgid "If you click with the mouse and begin to move the mouse at least the drag start distance, a drag operation will be initiated."
    443 msgstr "Ako kliknete i pomaknete miÅ¡a najmanje za navedeni broj točkica, započet će se s prevlačenjem."
     539msgid ""
     540"If you click with the mouse and begin to move the mouse at least the drag "
     541"start distance, a drag operation will be initiated."
     542msgstr ""
     543"Ako kliknete i pomaknete miÅ¡a najmanje za navedeni broj točkica, započet će "
     544"se s prevlačenjem."
    444545
    445546#. +> trunk stable
     
    450551#. +> trunk stable
    451552#: mouse.cpp:276
    452 msgid "If you use the wheel of a mouse, this value determines the number of lines to scroll for each wheel movement. Note that if this number exceeds the number of visible lines, it will be ignored and the wheel movement will be handled as a page up/down movement."
    453 msgstr "Ako upotrebljavate kotačić miÅ¡a ova vrijednost određuje broj redaka koji će biti pomaknuti za svaki pomak kotačića. Napomena: Ako je ovaj broj veći od broja vidljivih redaka, zadani broj će biti zanemaren, a pomak kotačića izvodit će kretanje stranicu naprijed i natrag."
     553msgid ""
     554"If you use the wheel of a mouse, this value determines the number of lines to "
     555"scroll for each wheel movement. Note that if this number exceeds the number "
     556"of visible lines, it will be ignored and the wheel movement will be handled "
     557"as a page up/down movement."
     558msgstr ""
     559"Ako upotrebljavate kotačić miÅ¡a ova vrijednost određuje broj redaka koji će "
     560"biti pomaknuti za svaki pomak kotačića. Napomena: Ako je ovaj broj veći od "
     561"broja vidljivih redaka, zadani broj će biti zanemaren, a pomak kotačića "
     562"izvodit će kretanje stranicu naprijed i natrag."
    454563
    455564#. +> trunk stable
     
    583692#: xcursor/themepage.cpp:312
    584693#, kde-format
    585 msgid "Unable to download the cursor theme archive; please check that the address %1 is correct."
    586 msgstr "Nije moguće pronaći arhivu teme pokazivača. Provjerite je li adresa %1 ispravna."
     694msgid ""
     695"Unable to download the cursor theme archive; please check that the address %1 "
     696"is correct."
     697msgstr ""
     698"Nije moguće pronaći arhivu teme pokazivača. Provjerite je li adresa %1 "
     699"ispravna."
    587700
    588701#. +> trunk stable
     
    594707#. +> trunk stable
    595708#: xcursor/themepage.cpp:336
    596 msgid "<qt>You cannot delete the theme you are currently using.<br />You have to switch to another theme first.</qt>"
    597 msgstr "<qt>Ne moÅŸete izbrisati temu koju trenutno koristite.<br /> Prvo morate promijeniti na neku drugu temu.</qt>"
     709msgid ""
     710"<qt>You cannot delete the theme you are currently using.<br />You have to "
     711"switch to another theme first.</qt>"
     712msgstr ""
     713"<qt>Ne moÅŸete izbrisati temu koju trenutno koristite.<br /> Prvo morate "
     714"promijeniti na neku drugu temu.</qt>"
    598715
    599716#. +> trunk stable
    600717#: xcursor/themepage.cpp:342
    601718#, kde-format
    602 msgid "<qt>Are you sure you want to remove the <i>%1</i> cursor theme?<br />This will delete all the files installed by this theme.</qt>"
    603 msgstr "<qt>Jeste li sigurni da ÅŸelite ukloniti temu pokazivača <i>%1</i>?<br />Na ovaj ćete način izbrisati sve datoteke koje je ova tema instalirala.</qt>"
     719msgid ""
     720"<qt>Are you sure you want to remove the <i>%1</i> cursor theme?<br />This "
     721"will delete all the files installed by this theme.</qt>"
     722msgstr ""
     723"<qt>Jeste li sigurni da ÅŸelite ukloniti temu pokazivača <i>%1</i>?<br />Na "
     724"ovaj ćete način izbrisati sve datoteke koje je ova tema instalirala.</qt>"
    604725
    605726#. +> trunk stable
     
    611732#: xcursor/themepage.cpp:405
    612733#, kde-format
    613 msgid "A theme named %1 already exists in your icon theme folder. Do you want replace it with this one?"
    614 msgstr "Tema naziva %1 već postoji u vaÅ¡oj mapi tema ikona. Åœelite li ju zamijeniti ovom temom?"
     734msgid ""
     735"A theme named %1 already exists in your icon theme folder. Do you want "
     736"replace it with this one?"
     737msgstr ""
     738"Tema naziva %1 već postoji u vaÅ¡oj mapi tema ikona. Åœelite li ju zamijeniti "
     739"ovom temom?"
    615740
    616741#. +> trunk stable
     
    623748#: xcursor/themepage.ui:17
    624749msgid "Select the cursor theme you want to use (hover preview to test cursor):"
    625 msgstr "Odaberite temu pokazivača koju ÅŸelite upotrebljavati (za pregled namjestite pokazivač):"
     750msgstr ""
     751"Odaberite temu pokazivača koju ÅŸelite upotrebljavati (za pregled namjestite "
     752"pokazivač):"
    626753
    627754#. i18n: ectx: property (toolTip), widget (KPushButton, installKnsButton)
    628755#. +> trunk stable
    629756#: xcursor/themepage.ui:56
    630 #, fuzzy
    631757msgid "Get new color schemes from the Internet"
    632 msgstr "Skini nove sheme boja s Interneta"
     758msgstr "Dohvati nove sheme boja s Interneta"
    633759
    634760#. i18n: ectx: property (text), widget (KPushButton, installKnsButton)
    635761#. +> trunk stable
    636762#: xcursor/themepage.ui:59
    637 #, fuzzy
    638763msgid "Get New Theme..."
    639 msgstr "Dohvati novu temu
"
     764msgstr "Dohvati novu temu..."
    640765
    641766#. i18n: ectx: property (text), widget (KPushButton, installButton)
    642767#. +> trunk stable
    643768#: xcursor/themepage.ui:66
    644 #, fuzzy
    645769msgid "Install From File..."
    646 msgstr "Iz datoteke 
"
     770msgstr "Instaliraj iz datoteke..."
    647771
    648772#. i18n: ectx: property (text), widget (KPushButton, removeButton)
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmkio.po

    r1123 r1129  
    55# Marko Dimjasevic <marko@dimjasevic.net>, 2010, 2011.
    66# Andrej Dundovic <adundovi@gmail.com>, 2010.
     7# Marko DimjaÅ¡ević <marko@dimjasevic.net>, 2011.
    78msgid ""
    89msgstr ""
     
    1011"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    1112"POT-Creation-Date: 2011-07-08 10:22+0200\n"
    12 "PO-Revision-Date: 2011-03-04 18:46+0100\n"
    13 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     13"PO-Revision-Date: 2011-07-12 16:53+0200\n"
     14"Last-Translator: Marko DimjaÅ¡ević <marko@dimjasevic.net>\n"
    1415"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
    1516"MIME-Version: 1.0\n"
     
    1718"Content-Transfer-Encoding: 8bit\n"
    1819"Language: hr\n"
    19 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     20"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     21"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    2022"X-Generator: Lokalize 1.2\n"
    2123"X-Environment: kde\n"
     
    2527#. +> trunk stable
    2628#: bookmarks.cpp:108
    27 msgid "<h1>My Bookmarks</h1><p>This module lets you configure the bookmarks home page.</p><p>The bookmarks home page is accessible at <a href=\"bookmarks:/\">bookmarks:/</a>.</p>"
    28 msgstr "<h1>Moje oznake</h1> <p>Ovaj modul Vam omogućuje konfiguraciju naslovne strane oznaka</p> <p>Naslovna strana oznaka je dostubna na <a href=\"bookmarks:/\">bookmarks:/</a>.</p>"
     29msgid ""
     30"<h1>My Bookmarks</h1><p>This module lets you configure the bookmarks home "
     31"page.</p><p>The bookmarks home page is accessible at <a href=\"bookmarks:/\">"
     32"bookmarks:/</a>.</p>"
     33msgstr ""
     34"<h1>Moje oznake</h1> <p>Ovaj modul Vam omogućuje konfiguraciju naslovne "
     35"strane oznaka</p> <p>Naslovna strana oznaka je dostubna na <a "
     36"href=\"bookmarks:/\">bookmarks:/</a>.</p>"
    2937
    3038#. i18n: ectx: property (title), widget (QGroupBox, groupBox)
     
    3846#: bookmarks.ui:23
    3947msgid ""
    40 "If this option is unchecked, bookmarks at the root of the hierarchy (not in a folder) are not displayed.\n"
     48"If this option is unchecked, bookmarks at the root of the hierarchy (not in a "
     49"folder) are not displayed.\n"
    4150"If checked, they are gathered in a \"root\" folder."
    4251msgstr ""
    43 "Ako je ova opcija isključena, oznake na vrhu hijerarhije (koje nisu ni u jednom direktoriju) neće biti prikazane.\n"
     52"Ako je ova opcija isključena, oznake na vrhu hijerarhije (koje nisu ni u "
     53"jednom direktoriju) neće biti prikazane.\n"
    4454"Ako je uključena, one će biti prikazane u direktoriju \"korijen\" (\"root\")."
    4555
     
    5464#: bookmarks.ui:37
    5565msgid ""
    56 "Sub-folders are shown within their parent by default. If you activate this option, sub-folders are displayed on their own.\n"
    57 "It looks less nice but it may help if you have a very big folder you want to spread in two columns."
    58 msgstr ""
    59 "Poddirektoriji su uobičajeno prikazani unutar svojih roditelja. Ako aktivirate ovu opciju, podfolderi će biti prikazani samostalno.\n"
    60 "MoÅŸda će izgledati loÅ¡ije, ali moÅŸe Vam pomoći ako imate jako veliki direktorij koji ÅŸelite podijeliti u dva stupca."
     66"Sub-folders are shown within their parent by default. If you activate this "
     67"option, sub-folders are displayed on their own.\n"
     68"It looks less nice but it may help if you have a very big folder you want to "
     69"spread in two columns."
     70msgstr ""
     71"Poddirektoriji su uobičajeno prikazani unutar svojih roditelja. Ako "
     72"aktivirate ovu opciju, podfolderi će biti prikazani samostalno.\n"
     73"MoÅŸda će izgledati loÅ¡ije, ali moÅŸe Vam pomoći ako imate jako veliki "
     74"direktorij koji ÅŸelite podijeliti u dva stupca."
    6175
    6276#. i18n: ectx: property (text), widget (QCheckBox, cbFlattenTree)
     
    6983#. +> trunk stable
    7084#: bookmarks.ui:47
    71 msgid "Show a box with KDE places (Home, Network, ...). Useful if you use konqueror as a file manager."
    72 msgstr "PrikaÅŸi kućicu sa KDE mjestima (Osobna mapa, MreÅŸa,
). Korisno ako koristite konqueror kao upravitelj datoteka."
     85msgid ""
     86"Show a box with KDE places (Home, Network, ...). Useful if you use konqueror "
     87"as a file manager."
     88msgstr ""
     89"PrikaÅŸi kućicu sa KDE mjestima (Osobna mapa, MreÅŸa,
). Korisno ako koristite "
     90"konqueror kao upravitelj datoteka."
    7391
    7492#. i18n: ectx: property (text), widget (QCheckBox, cbShowPlaces)
     
    87105#. +> trunk stable
    88106#: bookmarks.ui:71
    89 msgid "Folders are automatically distributed in several columns. The optimal number of columns depends on the width of the konqueror window and the number of bookmarks you have."
    90 msgstr "Direktoriji se automatski raspoređuju u viÅ¡e stupaca. Optimalni broj stupaca ovisi o Å¡irini prozora Konquerora i broju oznaka koje imate."
     107msgid ""
     108"Folders are automatically distributed in several columns. The optimal number "
     109"of columns depends on the width of the konqueror window and the number of "
     110"bookmarks you have."
     111msgstr ""
     112"Direktoriji se automatski raspoređuju u viÅ¡e stupaca. Optimalni broj stupaca "
     113"ovisi o Å¡irini prozora Konquerora i broju oznaka koje imate."
    91114
    92115#. i18n: ectx: property (text), widget (QLabel, label)
     
    100123#: bookmarks.ui:109
    101124msgid "Disable it on slow system to disable background images."
    102 msgstr "Onemogućite ovo na sporim sustavima da biste onesposobili pozadinske slike."
     125msgstr ""
     126"Onemogućite ovo na sporim sustavima da biste onesposobili pozadinske slike."
    103127
    104128#. i18n: ectx: property (text), widget (QCheckBox, cbShowBackgrounds)
     
    146170#. +> trunk stable
    147171#: cache.cpp:111
    148 msgid "<h1>Cache</h1><p>This module lets you configure your cache settings.</p><p>The cache is an internal memory in Konqueror where recently read web pages are stored. If you want to retrieve a web page again that you have recently read, it will not be downloaded from the Internet, but rather retrieved from the cache, which is a lot faster.</p>"
    149 msgstr "<h1>Predmemorija</h1> <p>Ovaj modul Vam omogućuje konfiguraciju postavki predmemorije</p> <p>Predmemorija je interna memorija u Konqueroru gdje su spremljene nedavno otvorene web stranice. Ako ÅŸelite ponovo kasnije otvoriti web stranicu koju ste nedavno otvarali, ona viÅ¡e neće biti skidana s Interneta, nego će biti izvučena iz prememorije, Å¡to je puno brÅŸe.</p>"
     172msgid ""
     173"<h1>Cache</h1><p>This module lets you configure your cache settings.</p><p>"
     174"The cache is an internal memory in Konqueror where recently read web pages "
     175"are stored. If you want to retrieve a web page again that you have recently "
     176"read, it will not be downloaded from the Internet, but rather retrieved from "
     177"the cache, which is a lot faster.</p>"
     178msgstr ""
     179"<h1>Predmemorija</h1> <p>Ovaj modul Vam omogućuje konfiguraciju postavki "
     180"predmemorije</p> <p>Predmemorija je interna memorija u Konqueroru gdje su "
     181"spremljene nedavno otvorene web stranice. Ako ÅŸelite ponovo kasnije otvoriti "
     182"web stranicu koju ste nedavno otvarali, ona viÅ¡e neće biti skidana s "
     183"Interneta, nego će biti izvučena iz prememorije, Å¡to je puno brÅŸe.</p>"
    150184
    151185#. i18n: ectx: property (whatsThis), widget (QCheckBox, cbUseCache)
    152186#. +> trunk stable
    153187#: cache.ui:17
    154 msgid "Check this box if you want the web pages you visit to be stored on your hard disk for quicker access. The stored pages will only be updated as needed instead of on every visit to that site. This is especially useful if you have a slow connection to the Internet."
    155 msgstr "Označite ovu kućicu ako ÅŸelite da web stranice koje gledate budu pohranjene na vaÅ¡em tvrdom disku za brÅŸi pristup istima. Tako će pristup njima biti neÅ¡to brÅŸi jer će se s mreÅŸe učitavati samo one koje nemate na disku, Å¡to je vrlo zgodno ako imate sporiju vezu prema internetu."
     188msgid ""
     189"Check this box if you want the web pages you visit to be stored on your hard "
     190"disk for quicker access. The stored pages will only be updated as needed "
     191"instead of on every visit to that site. This is especially useful if you have "
     192"a slow connection to the Internet."
     193msgstr ""
     194"Označite ovu kućicu ako ÅŸelite da web stranice koje gledate budu pohranjene "
     195"na vaÅ¡em tvrdom disku za brÅŸi pristup istima. Tako će pristup njima biti "
     196"neÅ¡to brÅŸi jer će se s mreÅŸe učitavati samo one koje nemate na disku, Å¡to je "
     197"vrlo zgodno ako imate sporiju vezu prema internetu."
    156198
    157199#. i18n: ectx: property (text), widget (QCheckBox, cbUseCache)
     
    171213#. +> trunk stable
    172214#: cache.ui:52
    173 msgid "Verify whether the cached web page is valid before attempting to fetch the web page again."
    174 msgstr "Provjeri je li spremljena web stranica ispravna prije nego je pokuÅ¡aÅ¡ dohvatiti ponovno."
     215msgid ""
     216"Verify whether the cached web page is valid before attempting to fetch the "
     217"web page again."
     218msgstr ""
     219"Provjeri je li spremljena web stranica ispravna prije nego je pokuÅ¡aÅ¡ "
     220"dohvatiti ponovno."
    175221
    176222#. i18n: ectx: property (text), widget (QRadioButton, rbVerifyCache)
     
    183229#. +> trunk stable
    184230#: cache.ui:62
    185 msgid "Always use documents from the cache when available. You can still use the reload button to synchronize the cache with the remote host."
    186 msgstr "Ova opcija omogućuje da dokumenti uvijek budu učitani iz priručne memorije ukoliko omogućeno.Uvijek moÅŸete upotrijebiti gumb za ponovno učitavanje stranice sa udaljenog računala."
     231msgid ""
     232"Always use documents from the cache when available. You can still use the "
     233"reload button to synchronize the cache with the remote host."
     234msgstr ""
     235"Ova opcija omogućuje da dokumenti uvijek budu učitani iz priručne memorije "
     236"ukoliko omogućeno.Uvijek moÅŸete upotrijebiti gumb za ponovno učitavanje "
     237"stranice sa udaljenog računala."
    187238
    188239#. i18n: ectx: property (text), widget (QRadioButton, rbCacheIfPossible)
     
    195246#. +> trunk stable
    196247#: cache.ui:72
    197 msgid "Do not fetch web pages that are not already stored in the cache. Offline mode prevents you from viewing pages that you have not previously visited."
    198 msgstr "Ne dohvaćaj web stranice koje već nisu pohranjene u međuspremniku. NeumreÅŸeni način rada sprečava sprečava vas u gledanjustranica koje niste prethodno posjetili."
     248msgid ""
     249"Do not fetch web pages that are not already stored in the cache. Offline mode "
     250"prevents you from viewing pages that you have not previously visited."
     251msgstr ""
     252"Ne dohvaćaj web stranice koje već nisu pohranjene u međuspremniku. NeumreÅŸeni "
     253"način rada sprečava sprečava vas u gledanjustranica koje niste prethodno "
     254"posjetili."
    199255
    200256#. i18n: ectx: property (text), widget (QRadioButton, rbOfflineMode)
     
    234290msgid ""
    235291"<qt>\n"
    236 "Enter the name of the environment variable, e.g. <b>HTTP_PROXY</b>, used to store the address of the HTTP proxy server.<p>\n"
    237 "Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt automatic discovery of this variable.</p>\n"
    238 "</qt>"
    239 msgstr ""
    240 "<qt>\n"
    241 "Unesite ime varijable okoline, npr. <b>HTTP_PROXY</b>, koja će se koristiti za spremanje adrese HTTP posredničkog posluÅŸitelja. <p>\n"
    242 "Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da biste pokrenuli automatsko otkrivanje te varijable.\n"
     292"Enter the name of the environment variable, e.g. <b>HTTP_PROXY</b>, used to "
     293"store the address of the HTTP proxy server.<p>\n"
     294"Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt "
     295"automatic discovery of this variable.</p>\n"
     296"</qt>"
     297msgstr ""
     298"<qt>\n"
     299"Unesite ime varijable okoline, npr. <b>HTTP_PROXY</b>, koja će se koristiti "
     300"za spremanje adrese HTTP posredničkog posluÅŸitelja. <p>\n"
     301"Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da "
     302"biste pokrenuli automatsko otkrivanje te varijable.\n"
    243303"</qt>"
    244304
     
    261321msgid ""
    262322"<qt>\n"
    263 "Enter the name of the environment variable, e.g. <b>HTTPS_PROXY</b>, used to store the address of the HTTPS proxy server.<p>\n"
    264 "Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt an automatic discovery of this variable.</p>\n"
    265 "</qt>"
    266 msgstr ""
    267 "<qt>\n"
    268 "Unesite ime varijable okoline, npr. <b>HTTP_PROXY</b>, koja će se koristiti za spremanje adrese HTTP posredničkog posluÅŸitelja. <p>\n"
    269 "Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da biste pokrenuli automatsko otkrivanje te varijable.\n"
     323"Enter the name of the environment variable, e.g. <b>HTTPS_PROXY</b>, used to "
     324"store the address of the HTTPS proxy server.<p>\n"
     325"Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt "
     326"an automatic discovery of this variable.</p>\n"
     327"</qt>"
     328msgstr ""
     329"<qt>\n"
     330"Unesite ime varijable okoline, npr. <b>HTTP_PROXY</b>, koja će se koristiti "
     331"za spremanje adrese HTTP posredničkog posluÅŸitelja. <p>\n"
     332"Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da "
     333"biste pokrenuli automatsko otkrivanje te varijable.\n"
    270334"</qt>"
    271335
     
    288352msgid ""
    289353"<qt>\n"
    290 "Enter the name of the environment variable, e.g. <b>FTP_PROXY</b>, used to store the address of the FTP proxy server.<p>\n"
    291 "Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt an automatic discovery of this variable.</p>\n"
    292 "</qt>"
    293 msgstr ""
    294 "<qt>\n"
    295 "Unesite ime varijable okoline, npr. <b>FTP_PROXY</b>, koja će se koristiti za spremanje adrese FTP posredničkog posluÅŸitelja. <p>\n"
    296 "Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da biste pokrenuli automatsko otkrivanje te varijable.\n"
     354"Enter the name of the environment variable, e.g. <b>FTP_PROXY</b>, used to "
     355"store the address of the FTP proxy server.<p>\n"
     356"Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt "
     357"an automatic discovery of this variable.</p>\n"
     358"</qt>"
     359msgstr ""
     360"<qt>\n"
     361"Unesite ime varijable okoline, npr. <b>FTP_PROXY</b>, koja će se koristiti za "
     362"spremanje adrese FTP posredničkog posluÅŸitelja. <p>\n"
     363"Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da "
     364"biste pokrenuli automatsko otkrivanje te varijable.\n"
    297365"</qt>"
    298366
     
    309377msgid ""
    310378"<qt>\n"
    311 "Enter the environment variable, e.g. <b>NO_PROXY</b>, used to store the addresses of sites for which the proxy server should not be used.<p>\n"
    312 "Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt an automatic discovery of this variable.\n"
    313 "</qt>"
    314 msgstr ""
    315 "<qt>\n"
    316 "Unesite ime varijable okoline, npr. <b>NO_PROXY</b>, koja će se koristiti za spremanje adrese web stranica za koje neće biti koriÅ¡ten posrednički posluÅŸitelj. <p>\n"
    317 "Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da biste pokrenuli automatsko otkrivanje te varijable.\n"
     379"Enter the environment variable, e.g. <b>NO_PROXY</b>, used to store the "
     380"addresses of sites for which the proxy server should not be used.<p>\n"
     381"Alternatively, you can click on the <b>\"Auto Detect\"</b> button to attempt "
     382"an automatic discovery of this variable.\n"
     383"</qt>"
     384msgstr ""
     385"<qt>\n"
     386"Unesite ime varijable okoline, npr. <b>NO_PROXY</b>, koja će se koristiti za "
     387"spremanje adrese web stranica za koje neće biti koriÅ¡ten posrednički "
     388"posluÅŸitelj. <p>\n"
     389"Alternativno, moÅŸete kliknuti na gumb <b>\"Automatsko otkrivanje\"</b> da "
     390"biste pokrenuli automatsko otkrivanje te varijable.\n"
    318391"</qt>"
    319392
     
    333406#. +> trunk stable
    334407#: envvarproxy.ui:181
    335 msgid "<qt>Verify whether or not the environment variable names you supplied are valid. If an environment variable is not found, the associated labels will be <b>highlighted</b> to indicate that they are invalid.</qt>"
    336 msgstr "<qt>Kliknite na ovaj gumb za brzu provjeru jesu li okoliÅ¡ne varijable koje ste napisali ispravne. Ako to nije slučaj, odnosno ako neka varijabla nije nađena onda će ona biti osvjetljena, kako bi znali gdje je greÅ¡ka.</qt>"
     408msgid ""
     409"<qt>Verify whether or not the environment variable names you supplied are "
     410"valid. If an environment variable is not found, the associated labels will be "
     411"<b>highlighted</b> to indicate that they are invalid.</qt>"
     412msgstr ""
     413"<qt>Kliknite na ovaj gumb za brzu provjeru jesu li okoliÅ¡ne varijable koje "
     414"ste napisali ispravne. Ako to nije slučaj, odnosno ako neka varijabla nije "
     415"nađena onda će ona biti osvjetljena, kako bi znali gdje je greÅ¡ka.</qt>"
    337416
    338417#. i18n: ectx: property (text), widget (QPushButton, pbVerify)
     
    345424#. +> trunk stable
    346425#: envvarproxy.ui:191
    347 msgid "<qt>Attempt automatic discovery of the environment variables used for setting system wide proxy information.<p> This feature works by searching for commonly used variable names such as HTTP_PROXY, FTP_PROXY and NO_PROXY.</qt>"
    348 msgstr "<qt>PokuÅ¡aj automatskog otkrivanja varijabli okoline koje se koriste za postavljanje sustavskih informacija o posrednicima. <p>Ova mogućnost radi za pretragu često koriÅ¡tenih varijabli poput HTTP_PROXY, FTP_PROXY i NO_PROXY.</qt>"
     426msgid ""
     427"<qt>Attempt automatic discovery of the environment variables used for setting "
     428"system wide proxy information.<p> This feature works by searching for "
     429"commonly used variable names such as HTTP_PROXY, FTP_PROXY and NO_PROXY.</qt>"
     430msgstr ""
     431"<qt>PokuÅ¡aj automatskog otkrivanja varijabli okoline koje se koriste za "
     432"postavljanje sustavskih informacija o posrednicima. <p>Ova mogućnost radi za "
     433"pretragu često koriÅ¡tenih varijabli poput HTTP_PROXY, FTP_PROXY i NO_PROXY.<"
     434"/qt>"
    349435
    350436#. i18n: ectx: property (text), widget (QPushButton, pbDetect)
     
    375461#. +> trunk stable
    376462#: kcookiesmain.cpp:88
    377 msgid "<p><h1>Cookies</h1> Cookies contain information that Konqueror (or other KDE applications using the HTTP protocol) stores on your computer, initiated by a remote Internet server. This means that a web server can store information about you and your browsing activities on your machine for later use. You might consider this an invasion of privacy.</p><p> However, cookies are useful in certain situations. For example, they are often used by Internet shops, so you can 'put things into a shopping basket'. Some sites require you have a browser that supports cookies.</p><p> Because most people want a compromise between privacy and the benefits cookies offer, KDE offers you the ability to customize the way it handles cookies. So you might want to set KDE's default policy to ask you whenever a server wants to set a cookie, allowing you to decide. For your favorite shopping web sites that you trust, you might want to set the policy to accept, then you can access the web sites without being prompted every time KDE receives a cookie.</p>"
    378 msgstr "<p> <h1>Kolačići</h1>  Kolačići sadrÅŸe informacije koje Konqueror (ili druga KDE aplikacija koja koristi HTTP protokol) spremi na VaÅ¡e računalo, a poslane su od udaljenog Internet posluÅŸitelja. To znači da web posluÅŸitelj moÅŸe spremiti informacije o Vama i vaÅ¡im aktivnostima na Internetu na VaÅ¡e računalo za kasniju upotrebu. Ovo moÅŸete smatrati naruÅ¡avanjem privatnosti.</p> <p>Međutim, kolačići su korisni u nekim situacijama. Na primjer, često se koriste u Internet dućanima, gdje moÅŸete 'staviti stvari u koÅ¡aricu'. Neke web stranice zahtijevaju pregledavanje preglednikom koji podrÅŸava kolačiće.</p> <p>Budući da većina ljudi ÅŸeli kompromis između privatnosti i prednosti koje kolačići nude, KDE Vam nudi mogućnost da odredite naćin upravljanja kolačićima. Tako moÅŸda ÅŸelite postaviti KDE-ovu uobičajenu politiku da Vas se pita svaki put kad posluÅŸitelj ÅŸeli postaviti kolačić, Å¡to Vam omogućuje odlučivanje. Za VaÅ¡e omiljene Internet dućane kojima vjerujete, moÅŸda ÅŸelite postaviti politiku da se prihvaćaju svi kolačići, pa ćete tada moći pristupati tim web stranicama bez da Vas se svaki put pita kada KDE primi kolačić-</p>"
     463msgid ""
     464"<p><h1>Cookies</h1> Cookies contain information that Konqueror (or other KDE "
     465"applications using the HTTP protocol) stores on your computer, initiated by a "
     466"remote Internet server. This means that a web server can store information "
     467"about you and your browsing activities on your machine for later use. You "
     468"might consider this an invasion of privacy.</p><p> However, cookies are "
     469"useful in certain situations. For example, they are often used by Internet "
     470"shops, so you can 'put things into a shopping basket'. Some sites require you "
     471"have a browser that supports cookies.</p><p> Because most people want a "
     472"compromise between privacy and the benefits cookies offer, KDE offers you the "
     473"ability to customize the way it handles cookies. So you might want to set "
     474"KDE's default policy to ask you whenever a server wants to set a cookie, "
     475"allowing you to decide. For your favorite shopping web sites that you trust, "
     476"you might want to set the policy to accept, then you can access the web sites "
     477"without being prompted every time KDE receives a cookie.</p>"
     478msgstr ""
     479"<p> <h1>Kolačići</h1>  Kolačići sadrÅŸe informacije koje Konqueror (ili druga "
     480"KDE aplikacija koja koristi HTTP protokol) spremi na VaÅ¡e računalo, a poslane "
     481"su od udaljenog Internet posluÅŸitelja. To znači da web posluÅŸitelj moÅŸe "
     482"spremiti informacije o Vama i vaÅ¡im aktivnostima na Internetu na VaÅ¡e "
     483"računalo za kasniju upotrebu. Ovo moÅŸete smatrati naruÅ¡avanjem privatnosti.<"
     484"/p> <p>Međutim, kolačići su korisni u nekim situacijama. Na primjer, često se "
     485"koriste u Internet dućanima, gdje moÅŸete 'staviti stvari u koÅ¡aricu'. Neke "
     486"web stranice zahtijevaju pregledavanje preglednikom koji podrÅŸava kolačiće.<"
     487"/p> <p>Budući da većina ljudi ÅŸeli kompromis između privatnosti i prednosti "
     488"koje kolačići nude, KDE Vam nudi mogućnost da odredite naćin upravljanja "
     489"kolačićima. Tako moÅŸda ÅŸelite postaviti KDE-ovu uobičajenu politiku da Vas se "
     490"pita svaki put kad posluÅŸitelj ÅŸeli postaviti kolačić, Å¡to Vam omogućuje "
     491"odlučivanje. Za VaÅ¡e omiljene Internet dućane kojima vjerujete, moÅŸda ÅŸelite "
     492"postaviti politiku da se prihvaćaju svi kolačići, pa ćete tada moći "
     493"pristupati tim web stranicama bez da Vas se svaki put pita kada KDE primi "
     494"kolačić-</p>"
    379495
    380496#. +> trunk stable
     
    405521#. +> trunk stable
    406522#: kcookiesmanagement.cpp:242
    407 msgid "Unable to retrieve information about the cookies stored on your computer."
    408 msgstr "Dohvaćanje informacija o cookie-ima spremljenim na vaÅ¡em računalu nije uspjelo."
     523msgid ""
     524"Unable to retrieve information about the cookies stored on your computer."
     525msgstr ""
     526"Dohvaćanje informacija o cookie-ima spremljenim na vaÅ¡em računalu nije "
     527"uspjelo."
    409528
    410529#. +> trunk stable
     
    515634#. +> trunk stable
    516635#: kcookiespolicies.cpp:178
    517 #, fuzzy
    518636#| msgid "New Cookie Policy"
    519637msgctxt "@title:window"
     
    523641#. +> trunk stable
    524642#: kcookiespolicies.cpp:217
    525 #, fuzzy
    526643#| msgid "Change Cookie Policy"
    527644msgctxt "@title:window"
    528645msgid "Change Cookie Policy"
    529 msgstr "Promjeni pravila za kolačiće"
     646msgstr "Promijeni pravila za kolačiće"
    530647
    531648#. +> trunk stable
    532649#: kcookiespolicies.cpp:242
    533650#, kde-format
    534 msgid "<qt>A policy already exists for<center><b>%1</b></center>Do you want to replace it?</qt>"
    535 msgstr "<qt>Politika već postoji za <center><b>%1</b></center> Åœelite li ju zamijeniti?</qt>"
     651msgid ""
     652"<qt>A policy already exists for<center><b>%1</b></center>Do you want to "
     653"replace it?</qt>"
     654msgstr ""
     655"<qt>Politika već postoji za <center><b>%1</b></center> Åœelite li ju "
     656"zamijeniti?</qt>"
    536657
    537658#. +> trunk stable
    538659#: kcookiespolicies.cpp:246
    539 #, fuzzy
    540660#| msgid "Duplicate Policy"
    541661msgctxt "@title:window"
    542662msgid "Duplicate Policy"
    543 msgstr "Podvostruči pravilo"
     663msgstr "Duplikat pravila"
    544664
    545665#. +> trunk stable
     
    559679#. +> trunk stable
    560680#: kcookiespolicies.cpp:464
    561 msgid "<p><h1>Cookies</h1> Cookies contain information that Konqueror (or any other KDE application using the HTTP protocol) stores on your computer from a remote Internet server. This means that a web server can store information about you and your browsing activities on your machine for later use. You might consider this an invasion of privacy.</p><p>However, cookies are useful in certain situations. For example, they are often used by Internet shops, so you can 'put things into a shopping basket'. Some sites require you have a browser that supports cookies.</p><p>Because most people want a compromise between privacy and the benefits cookies offer, KDE offers you the ability to customize the way it handles cookies. You might, for example want to set KDE's default policy to ask you whenever a server wants to set a cookie or simply reject or accept everything. For example, you might choose to accept all cookies from your favorite shopping web site. For this all you have to do is either browse to that particular site and when you are presented with the cookie dialog box, click on <i> This domain </i> under the 'apply to' tab and choose accept or simply specify the name of the site in the <i> Domain Specific Policy </i> tab and set it to accept. This enables you to receive cookies from trusted web sites without being asked every time KDE receives a cookie.</p>"
    562 msgstr "<p> <h1>Kolačići</h1>  Kolačići sadrÅŸe informacije koje Konqueror (ili druga KDE aplikacija koja koristi HTTP protokol) spremi na VaÅ¡e računalo, a poslane su od udaljenog Internet posluÅŸitelja. To znači da web posluÅŸitelj moÅŸe spremiti informacije o Vama i vaÅ¡im aktivnostima na Internetu na VaÅ¡e računalo za kasniju upotrebu. Ovo moÅŸete smatrati naruÅ¡avanjem privatnosti.</p> <p>Međutim, kolačići su korisni u nekim situacijama. Na primjer, često se koriste u Internet dućanima, gdje moÅŸete 'staviti stvari u koÅ¡aricu'. Neke web stranice zahtijevaju pregledavanje preglednikom koji podrÅŸava kolačiće.</p> <p>Budući da većina ljudi ÅŸeli kompromis između privatnosti i prednosti koje kolačići nude, KDE Vam nudi mogućnost da odredite naćin upravljanja kolačićima. MoÅŸete, na primjer postaviti KDE-ovu uobičajenu politiku da Vas se pita svaki put kad KDE primi kolačić ili da se jednostavno svi kolačići prihvate ili odbiju. Na primjer, moÅŸete odrediti da se uvijek prihvate svi kolačići sa vaÅ¡eg omiljenog Internet dućana. Da biste to postavili, sve Å¡to moate učiniti jest ili otići na ÅŸeljenu stranicu i kad Vas se pita za kolačić, kliknite na <i>Ovu domenu</i> u kartici 'primijeni na' i odaberite 'prihvati' ili jednostavno definirajte ime web stranice u kartici <i>Politika određene domene</i> i postavite da se prihvaća. To će omogućiti prihvaćanje kolačića iz povjerenih web stranica bez da Vas se pita svaki put kad KDE primi kolačić.</p>"
     681msgid ""
     682"<p><h1>Cookies</h1> Cookies contain information that Konqueror (or any other "
     683"KDE application using the HTTP protocol) stores on your computer from a "
     684"remote Internet server. This means that a web server can store information "
     685"about you and your browsing activities on your machine for later use. You "
     686"might consider this an invasion of privacy.</p><p>However, cookies are useful "
     687"in certain situations. For example, they are often used by Internet shops, so "
     688"you can 'put things into a shopping basket'. Some sites require you have a "
     689"browser that supports cookies.</p><p>Because most people want a compromise "
     690"between privacy and the benefits cookies offer, KDE offers you the ability to "
     691"customize the way it handles cookies. You might, for example want to set "
     692"KDE's default policy to ask you whenever a server wants to set a cookie or "
     693"simply reject or accept everything. For example, you might choose to accept "
     694"all cookies from your favorite shopping web site. For this all you have to do "
     695"is either browse to that particular site and when you are presented with the "
     696"cookie dialog box, click on <i> This domain </i> under the 'apply to' tab and "
     697"choose accept or simply specify the name of the site in the <i> Domain "
     698"Specific Policy </i> tab and set it to accept. This enables you to receive "
     699"cookies from trusted web sites without being asked every time KDE receives a "
     700"cookie.</p>"
     701msgstr ""
     702"<p> <h1>Kolačići</h1>  Kolačići sadrÅŸe informacije koje Konqueror (ili druga "
     703"KDE aplikacija koja koristi HTTP protokol) spremi na VaÅ¡e računalo, a poslane "
     704"su od udaljenog Internet posluÅŸitelja. To znači da web posluÅŸitelj moÅŸe "
     705"spremiti informacije o Vama i vaÅ¡im aktivnostima na Internetu na VaÅ¡e "
     706"računalo za kasniju upotrebu. Ovo moÅŸete smatrati naruÅ¡avanjem privatnosti.<"
     707"/p> <p>Međutim, kolačići su korisni u nekim situacijama. Na primjer, često se "
     708"koriste u Internet dućanima, gdje moÅŸete 'staviti stvari u koÅ¡aricu'. Neke "
     709"web stranice zahtijevaju pregledavanje preglednikom koji podrÅŸava kolačiće.<"
     710"/p> <p>Budući da većina ljudi ÅŸeli kompromis između privatnosti i prednosti "
     711"koje kolačići nude, KDE Vam nudi mogućnost da odredite naćin upravljanja "
     712"kolačićima. MoÅŸete, na primjer postaviti KDE-ovu uobičajenu politiku da Vas "
     713"se pita svaki put kad KDE primi kolačić ili da se jednostavno svi kolačići "
     714"prihvate ili odbiju. Na primjer, moÅŸete odrediti da se uvijek prihvate svi "
     715"kolačići sa vaÅ¡eg omiljenog Internet dućana. Da biste to postavili, sve Å¡to "
     716"moate učiniti jest ili otići na ÅŸeljenu stranicu i kad Vas se pita za "
     717"kolačić, kliknite na <i>Ovu domenu</i> u kartici 'primijeni na' i odaberite "
     718"'prihvati' ili jednostavno definirajte ime web stranice u kartici <i>Politika "
     719"određene domene</i> i postavite da se prihvaća. To će omogućiti prihvaćanje "
     720"kolačića iz povjerenih web stranica bez da Vas se pita svaki put kad KDE "
     721"primi kolačić.</p>"
    563722
    564723#. i18n: ectx: property (whatsThis), widget (QCheckBox, cbEnableCookies)
     
    567726msgid ""
    568727"<qt>\n"
    569 "<p>Enable cookie support. Normally you will want to have cookie support enabled and customize it to suit your privacy needs.</p><p>\n"
    570 "Please note that disabling cookie support might make many web sites unbrowsable.</p>\n"
    571 "</qt>"
    572 msgstr ""
    573 "<qt>\n"
    574 "<p>Uključi podrÅ¡ku za kolačiće. Obično se ÅŸeli imati podrÅ¡ku za kolačiće koja se moÅŸe namjestiti potrebama korisnika.</p><p>\n"
    575 "Imajte na umu da isključivanje podrÅ¡ke za kolačiće čini mnoge web stranice neupotrebljivim.</p>\n"
     728"<p>Enable cookie support. Normally you will want to have cookie support "
     729"enabled and customize it to suit your privacy needs.</p><p>\n"
     730"Please note that disabling cookie support might make many web sites "
     731"unbrowsable.</p>\n"
     732"</qt>"
     733msgstr ""
     734"<qt>\n"
     735"<p>Uključi podrÅ¡ku za kolačiće. Obično se ÅŸeli imati podrÅ¡ku za kolačiće koja "
     736"se moÅŸe namjestiti potrebama korisnika.</p><p>\n"
     737"Imajte na umu da isključivanje podrÅ¡ke za kolačiće čini mnoge web stranice "
     738"neupotrebljivim.</p>\n"
    576739" </qt>"
    577740
     
    587750msgid ""
    588751"<qt>\n"
    589 "Reject the so called third-party cookies. These are cookies that originate from a site other than the one you are currently browsing. For example, if you visit <b>www.foobar.com</b> while this option is on, only cookies that originate from www.foobar.com will be processed per your settings. Cookies from any other site will be rejected. This reduces the chances of site operators compiling a profile about your daily browsing habits.\n"
    590 "</qt>"
    591 msgstr ""
    592 "<qt>\n"
    593 "Odbijanje tzv. \"third-party\" kolačića. Ovi kolačići stiÅŸu sa drugih stranica od onih koje trenutno pregledavate. Na primjer, ako posjetite <b>www.klik.hr</b>, a ova opcija je uključena, samo kolačići koji stiÅŸu sa tih stranica bit će obrađeni prema vaÅ¡im postavkama. Kolačići s bilo koje druge adrese bit će odbijeni. Ova opcija smanjuje mogućnost vlasnika stranica da izrade profil vaÅ¡ih dnevnih navika pregledavanja web stranica.\n"
     752"Reject the so called third-party cookies. These are cookies that originate "
     753"from a site other than the one you are currently browsing. For example, if "
     754"you visit <b>www.foobar.com</b> while this option is on, only cookies that "
     755"originate from www.foobar.com will be processed per your settings. Cookies "
     756"from any other site will be rejected. This reduces the chances of site "
     757"operators compiling a profile about your daily browsing habits.\n"
     758"</qt>"
     759msgstr ""
     760"<qt>\n"
     761"Odbijanje tzv. \"third-party\" kolačića. Ovi kolačići stiÅŸu sa drugih "
     762"stranica od onih koje trenutno pregledavate. Na primjer, ako posjetite <b>www."
     763"klik.hr</b>, a ova opcija je uključena, samo kolačići koji stiÅŸu sa tih "
     764"stranica bit će obrađeni prema vaÅ¡im postavkama. Kolačići s bilo koje druge "
     765"adrese bit će odbijeni. Ova opcija smanjuje mogućnost vlasnika stranica da "
     766"izrade profil vaÅ¡ih dnevnih navika pregledavanja web stranica.\n"
    594767"</qt>"
    595768
     
    605778msgid ""
    606779"<qt>\n"
    607 "<p>Automatically accept temporary cookies meant to expire at the end of the current session. Such cookies will not be stored in your computer's hard drive or storage device. Instead, they are deleted when you close all applications (e.g. your browser) that use them.</p><p>\n"
    608 "<u>NOTE:</u> Checking this option along with the next one will override your default as well as site specific cookie policies. However, doing so also increases your privacy since all cookies will be removed when the current session ends.</p>\n"
    609 "</qt>"
    610 msgstr ""
    611 "<qt>\n"
    612 "<p>Automatski prihvati privremene kolačiće koji su određeni da isteknu na kraju trenutne sjednice. Takvi kolačići neće biti spremljeni na disk VaÅ¡eg računala. Umjesto toga, oni će biti izbrisani kad pozatvorite sve aplikacije (npr. VaÅ¡ web preglednik) koje ih koriste.</p> <p>\n"
    613 "<u>NAPOMENA:</u>Uključivanje ove opcije zajedno sa sljedećom će nadvladati vaÅ¡u uobičajenu kao i politiku specifičnih web stranica. Međutim, to će također i povećati razinu privatnosti jer će svi kolačići biti izbrisani kad trenutna sjednica zavrÅ¡i.</p> \n"
     780"<p>Automatically accept temporary cookies meant to expire at the end of the "
     781"current session. Such cookies will not be stored in your computer's hard "
     782"drive or storage device. Instead, they are deleted when you close all "
     783"applications (e.g. your browser) that use them.</p><p>\n"
     784"<u>NOTE:</u> Checking this option along with the next one will override your "
     785"default as well as site specific cookie policies. However, doing so also "
     786"increases your privacy since all cookies will be removed when the current "
     787"session ends.</p>\n"
     788"</qt>"
     789msgstr ""
     790"<qt>\n"
     791"<p>Automatski prihvati privremene kolačiće koji su određeni da isteknu na "
     792"kraju trenutne sjednice. Takvi kolačići neće biti spremljeni na disk VaÅ¡eg "
     793"računala. Umjesto toga, oni će biti izbrisani kad pozatvorite sve aplikacije "
     794"(npr. VaÅ¡ web preglednik) koje ih koriste.</p> <p>\n"
     795"<u>NAPOMENA:</u>Uključivanje ove opcije zajedno sa sljedećom će nadvladati "
     796"vaÅ¡u uobičajenu kao i politiku specifičnih web stranica. Međutim, to će "
     797"također i povećati razinu privatnosti jer će svi kolačići biti izbrisani kad "
     798"trenutna sjednica zavrÅ¡i.</p> \n"
    614799"</qt>"
    615800
     
    625810msgid ""
    626811"<qt>\n"
    627 "<p>Treat all cookies as session cookies. Session cookies are small pieces of data that are temporarily stored in your computer's memory until you quit or close all applications (e.g. your browser) that use them. Unlike regular cookies, session cookies are never stored on your hard drive or other storage medium.</p><p>\n"
    628 "<u>NOTE:</u> Checking this option along with the previous one will override your default as well as site specific cookie policies. However, doing so also increases your privacy since all cookies will be removed when the current session ends.</p>\n"
    629 "</qt>"
    630 msgstr ""
    631 "<qt>\n"
    632 "<p>Tretiraj sve kolačiće kao kolačiće sjednice. Kolačići sjednice su mali komadići podataka koji su privremeno spremljeni na vaÅ¡em računalu dok god ne zatvorite sve aplikacije koje ih koriste (npr. web preglednik). Za razliku od običnih kolačića, kolačići sesije se nikad ne spremaju na vaÅ¡ tvrdi disk ili bilo koji drugi medij.</p><p>\n"
    633 "<u>NAPOMENA:</u> Zajedno s prethodnom opcijom, ova opcija zanemaruje vaÅ¡u uobičajenu politiku manipuliranja kolačićima, kao i sve politike specifične za određene stranice. Međutim, to također povećava nivo vaÅ¡e privatnosti, obzirom da će svi kolačići biti izbrisani kada prekinete trenutnu sesiju.</p></qt>"
     812"<p>Treat all cookies as session cookies. Session cookies are small pieces of "
     813"data that are temporarily stored in your computer's memory until you quit or "
     814"close all applications (e.g. your browser) that use them. Unlike regular "
     815"cookies, session cookies are never stored on your hard drive or other storage "
     816"medium.</p><p>\n"
     817"<u>NOTE:</u> Checking this option along with the previous one will override "
     818"your default as well as site specific cookie policies. However, doing so also "
     819"increases your privacy since all cookies will be removed when the current "
     820"session ends.</p>\n"
     821"</qt>"
     822msgstr ""
     823"<qt>\n"
     824"<p>Tretiraj sve kolačiće kao kolačiće sjednice. Kolačići sjednice su mali "
     825"komadići podataka koji su privremeno spremljeni na vaÅ¡em računalu dok god ne "
     826"zatvorite sve aplikacije koje ih koriste (npr. web preglednik). Za razliku od "
     827"običnih kolačića, kolačići sesije se nikad ne spremaju na vaÅ¡ tvrdi disk ili "
     828"bilo koji drugi medij.</p><p>\n"
     829"<u>NAPOMENA:</u> Zajedno s prethodnom opcijom, ova opcija zanemaruje vaÅ¡u "
     830"uobičajenu politiku manipuliranja kolačićima, kao i sve politike specifične "
     831"za određene stranice. Međutim, to također povećava nivo vaÅ¡e privatnosti, "
     832"obzirom da će svi kolačići biti izbrisani kada prekinete trenutnu sesiju.</p>"
     833"</qt>"
    634834
    635835#. i18n: ectx: property (text), widget (QCheckBox, cbIgnoreCookieExpirationDate)
     
    646846"Determines how cookies received from a remote machine will be handled: \n"
    647847"<ul>\n"
    648 "<li><b>Ask</b> will cause KDE to ask for your confirmation whenever a server wants to set a cookie.</li>\n"
    649 "<li><b>Accept</b> will cause cookies to be accepted without prompting you.</li>\n"
    650 "<li><b>Reject</b> will cause the cookiejar to refuse all cookies it receives.</li>\n"
     848"<li><b>Ask</b> will cause KDE to ask for your confirmation whenever a server "
     849"wants to set a cookie.</li>\n"
     850"<li><b>Accept</b> will cause cookies to be accepted without prompting you.<"
     851"/li>\n"
     852"<li><b>Reject</b> will cause the cookiejar to refuse all cookies it receives."
     853"</li>\n"
    651854"</ul><p>\n"
    652 "<u>NOTE:</u> Domain specific policies, which can be set below, always take precedence over the default policy.</p>\n"
     855"<u>NOTE:</u> Domain specific policies, which can be set below, always take "
     856"precedence over the default policy.</p>\n"
    653857"</qt>"
    654858msgstr ""
     
    656860"Određuje kako će se postupati s kolačićima koji su primljeni:\n"
    657861"<ul>\n"
    658 "<li><b>Pitaj</b> opcija će učiniti da Vas KDE svaki put pita Å¡to učiniti s kolačićem kada ga se primi</li> \n"
    659 "<li><b>Prihvati</b> opcija će učiniti da se svi kolačići prihvate bez pitanja</li> \n"
    660 "<li><b>Odbih</b> opcija će učiniti da se svi kolačići odbiju bez pitanja</li> \n"
     862"<li><b>Pitaj</b> opcija će učiniti da Vas KDE svaki put pita Å¡to učiniti s "
     863"kolačićem kada ga se primi</li> \n"
     864"<li><b>Prihvati</b> opcija će učiniti da se svi kolačići prihvate bez "
     865"pitanja</li> \n"
     866"<li><b>Odbih</b> opcija će učiniti da se svi kolačići odbiju bez pitanja</li> "
     867"\n"
    661868"</ul> <p>\n"
    662 "<u>NAPOMENA:</u> Politike specifičnih domena, koje mogu biti postavljene dolje, uvijek imaju prednost pred uobičajenim postavkama.</p>\n"
     869"<u>NAPOMENA:</u> Politike specifičnih domena, koje mogu biti postavljene "
     870"dolje, uvijek imaju prednost pred uobičajenim postavkama.</p>\n"
    663871"</qt>"
    664872
     
    692900msgid ""
    693901"<qt>\n"
    694 "To add a new policy, simply click on the <b>Add...</b> button and supply the necessary information. To change an existing policy, use the <b>Change...</b> button and choose the new policy from the policy dialog box. Clicking on the <b>Delete</b> button will remove the currently selected policy causing the default policy setting to be used for that domain, whereas <b>Delete All</b> will remove all the site specific policies.\n"
    695 "</qt>"
    696 msgstr ""
    697 "<qt>\n"
    698 "Za dodavanje nove politike, jednostavno kliknite na gumb <b>Dodaj
</b> i dajte potrebne informacije. Da biste promijenili trenutnu politiku, jednostavno koristite gumb <b>Promijeni</b> i odaberite novu politiku iz dialoga sa politikama. Ako kliknete na gumb <b>IzbriÅ¡i</b>, onda ćete izbrisati trenutno postavljenu politiku pa će za tu domenu biti koriÅ¡tena uobičajena politika, dok će <b>IzbriÅ¡i sve</b> gumb izbrisati sve specifične politike.\n"
     902"To add a new policy, simply click on the <b>Add...</b> button and supply the "
     903"necessary information. To change an existing policy, use the <b>Change...</b> "
     904"button and choose the new policy from the policy dialog box. Clicking on the "
     905"<b>Delete</b> button will remove the currently selected policy causing the "
     906"default policy setting to be used for that domain, whereas <b>Delete All</b> "
     907"will remove all the site specific policies.\n"
     908"</qt>"
     909msgstr ""
     910"<qt>\n"
     911"Za dodavanje nove politike, jednostavno kliknite na gumb <b>Dodaj
</b> i "
     912"dajte potrebne informacije. Da biste promijenili trenutnu politiku, "
     913"jednostavno koristite gumb <b>Promijeni</b> i odaberite novu politiku iz "
     914"dialoga sa politikama. Ako kliknete na gumb <b>IzbriÅ¡i</b>, onda ćete "
     915"izbrisati trenutno postavljenu politiku pa će za tu domenu biti koriÅ¡tena "
     916"uobičajena politika, dok će <b>IzbriÅ¡i sve</b> gumb izbrisati sve specifične "
     917"politike.\n"
    699918"</qt>"
    700919
     
    725944msgid ""
    726945"<qt>\n"
    727 "List of sites for which you have set a specific cookie policy. Specific policies override the default policy setting for these sites.\n"
    728 "</qt>"
    729 msgstr ""
    730 "<qt>\n"
    731 "Popis stranica za koje ste postavili određenu politiku upravljanja kolačićima. Ove postavke vrijedit će umjesto podrazumijevanih za ove stranice.\n"
     946"List of sites for which you have set a specific cookie policy. Specific "
     947"policies override the default policy setting for these sites.\n"
     948"</qt>"
     949msgstr ""
     950"<qt>\n"
     951"Popis stranica za koje ste postavili određenu politiku upravljanja kolačićima."
     952" Ove postavke vrijedit će umjesto podrazumijevanih za ove stranice.\n"
    732953"</qt>"
    733954
     
    746967#. +> trunk stable
    747968#: kenvvarproxydlg.cpp:49
    748 #, fuzzy
    749969#| msgid "Variable Proxy Configuration"
    750970msgctxt "@title:window"
    751971msgid "Variable Proxy Configuration"
    752 msgstr "Postavke promjenjivog posrednika (proxy)"
     972msgstr "Postavke promjenjivog posrednika"
    753973
    754974#. +> trunk stable
     
    759979#. +> trunk stable
    760980#: kenvvarproxydlg.cpp:133 kenvvarproxydlg.cpp:295
    761 msgid "<qt>Make sure you entered the actual environment variable name rather than its value. For example, if the environment variable is <br /><b>HTTP_PROXY=http://localhost:3128</b><br /> you need to enter <b>HTTP_PROXY</b> here instead of the actual value http://localhost:3128.</qt>"
    762 msgstr "<qt>Osigurajte da ste unijeli ime varijable okoline, a ne njenu vrijednost. Na primjer, ako je varijabla okoline <br /> <b>HTTP_PROXY=http://localhost:3128</b><br />  morate unijeti <b>HTTP_PROXY</b>, a ne vrijednost http://localhost:3128.</qt>"
     981msgid ""
     982"<qt>Make sure you entered the actual environment variable name rather than "
     983"its value. For example, if the environment variable is <br /><b>"
     984"HTTP_PROXY=http://localhost:3128</b><br /> you need to enter <b>HTTP_PROXY</b>"
     985" here instead of the actual value http://localhost:3128.</qt>"
     986msgstr ""
     987"<qt>Osigurajte da ste unijeli ime varijable okoline, a ne njenu vrijednost. "
     988"Na primjer, ako je varijabla okoline <br /> <b>"
     989"HTTP_PROXY=http://localhost:3128</b><br />  morate unijeti <b>HTTP_PROXY</b>, "
     990"a ne vrijednost http://localhost:3128.</qt>"
    763991
    764992#. +> trunk stable
    765993#: kenvvarproxydlg.cpp:141 kenvvarproxydlg.cpp:303 kproxydlg.cpp:311
    766 #, fuzzy
    767994#| msgid "Invalid Proxy Setup"
    768995msgctxt "@title:window"
     
    7771004#. +> trunk stable
    7781005#: kenvvarproxydlg.cpp:146
    779 #, fuzzy
    7801006#| msgid "Proxy Setup"
    7811007msgctxt "@title:window"
    7821008msgid "Proxy Setup"
    783 msgstr "PodeÅ¡avanje proxy-a"
     1009msgstr "Postavljanje posrednika"
    7841010
    7851011#. +> trunk stable
    7861012#: kenvvarproxydlg.cpp:222
    787 msgid "Did not detect any environment variables commonly used to set system wide proxy information."
    788 msgstr "Nije bilo moguće pronaći nijednu od varijabli okoline koje se obično koriste za podeÅ¡avanje proxy-a!"
     1013msgid ""
     1014"Did not detect any environment variables commonly used to set system wide "
     1015"proxy information."
     1016msgstr ""
     1017"Nije bilo moguće pronaći nijednu od varijabli okoline koje se obično koriste "
     1018"za podeÅ¡avanje proxy-a!"
    7891019
    7901020#. +> trunk stable
    7911021#: kenvvarproxydlg.cpp:226
    792 msgid "<qt>To learn about the variable names the automatic detection process searches for, press OK, click on the quick help button on the window title bar of the previous dialog and then click on the \"<b>Auto Detect</b>\" button.</qt>"
    793 msgstr "<qt>Ako ÅŸelite saznati viÅ¡e o varijablama okruÅŸja koje ispituje automatsko pronalaÅŸenje, kliknite OK, u traci naslova prethodnog prozora kliknite gumb za brzu pomoć, te zatim kliknite gumb \"<b>Automatsko pronalaÅŸenje</b>\".</qt>"
     1022msgid ""
     1023"<qt>To learn about the variable names the automatic detection process "
     1024"searches for, press OK, click on the quick help button on the window title "
     1025"bar of the previous dialog and then click on the \"<b>Auto Detect</b>\" "
     1026"button.</qt>"
     1027msgstr ""
     1028"<qt>Ako ÅŸelite saznati viÅ¡e o varijablama okruÅŸja koje ispituje automatsko "
     1029"pronalaÅŸenje, kliknite OK, u traci naslova prethodnog prozora kliknite gumb "
     1030"za brzu pomoć, te zatim kliknite gumb \"<b>Automatsko pronalaÅŸenje</b>\".</qt>"
    7941031
    7951032#. +> trunk stable
    7961033#: kenvvarproxydlg.cpp:234
    797 #, fuzzy
    7981034#| msgid "Automatic Proxy Variable Detection"
    7991035msgctxt "@title:window"
    8001036msgid "Automatic Proxy Variable Detection"
    801 msgstr "Automatska detekcija Proxy varijabli"
     1037msgstr "Automatska detekcija posredničkih varijabli"
    8021038
    8031039#. i18n: ectx: label, entry (DisablePassiveMode), group (DesktopIcons)
     
    8101046#. +> trunk stable
    8111047#: kio_ftprc.kcfg:11
    812 msgid "When FTP connections are passive the client connects to the server, instead of the other way round, so firewalls do not block the connection; old FTP servers may not support Passive FTP though."
    813 msgstr "Kada su FTP veze pasivne, klijent se povezuje na posluÅŸitelj, umjesto obrnuto, tako da vatrozidi ne blokiraju vezu; stariji FTP posluÅŸitelji moÅŸda ne podrÅŸavaju pasivni FTP."
     1048msgid ""
     1049"When FTP connections are passive the client connects to the server, instead "
     1050"of the other way round, so firewalls do not block the connection; old FTP "
     1051"servers may not support Passive FTP though."
     1052msgstr ""
     1053"Kada su FTP veze pasivne, klijent se povezuje na posluÅŸitelj, umjesto "
     1054"obrnuto, tako da vatrozidi ne blokiraju vezu; stariji FTP posluÅŸitelji moÅŸda "
     1055"ne podrÅŸavaju pasivni FTP."
    8141056
    8151057#. i18n: ectx: label, entry (MarkPartial), group (DesktopIcons)
     
    8221064#. +> trunk stable
    8231065#: kio_ftprc.kcfg:17
    824 msgid "While a file is being uploaded its extension is \".part\". When fully uploaded it is renamed to its real name."
    825 msgstr "Dok se datoteka uploada njezina ekstenzija je \".part\". Kad upload zavrÅ¡i, datoteka se preimenuje u njeno pravo ime."
     1066msgid ""
     1067"While a file is being uploaded its extension is \".part\". When fully "
     1068"uploaded it is renamed to its real name."
     1069msgstr ""
     1070"Dok se datoteka uploada njezina ekstenzija je \".part\". Kad upload zavrÅ¡i, "
     1071"datoteka se preimenuje u njeno pravo ime."
    8261072
    8271073#. +> trunk stable
    8281074#: kmanualproxydlg.cpp:48
    829 #, fuzzy
    8301075#| msgid "Manual Proxy Configuration"
    8311076msgctxt "@title:window"
    8321077msgid "Manual Proxy Configuration"
    833 msgstr "Ručno podeÅ¡avanje proxy-a"
     1078msgstr "Ručno podeÅ¡avanje posrednika"
    8341079
    8351080#. +> trunk stable
    8361081#: kmanualproxydlg.cpp:273
    837 #, fuzzy
    8381082#| msgid "Invalid Proxy Setting"
    8391083msgctxt "@title:window"
     
    8431087#. +> trunk stable
    8441088#: kmanualproxydlg.cpp:274
    845 msgid "One or more of the specified proxy settings are invalid. The incorrect entries are highlighted."
    846 msgstr "Jedna ili viÅ¡e definiranih postavki posrednika su nevaljane. Netočne vrijednosti su označene."
     1089msgid ""
     1090"One or more of the specified proxy settings are invalid. The incorrect "
     1091"entries are highlighted."
     1092msgstr ""
     1093"Jedna ili viÅ¡e definiranih postavki posrednika su nevaljane. Netočne "
     1094"vrijednosti su označene."
    8471095
    8481096#. +> trunk stable
     
    8591107#. +> trunk stable
    8601108#: kmanualproxydlg.cpp:346
    861 #, fuzzy
    8621109#| msgid "Duplicate Entry"
    8631110msgctxt "@title:window"
    8641111msgid "Duplicate Entry"
    865 msgstr "Dupli unost"
     1112msgstr "Duplikat unosa"
    8661113
    8671114#. +> trunk stable
    8681115#: kmanualproxydlg.cpp:356
    869 #, fuzzy
    8701116#| msgid "New Exception"
    8711117msgctxt "@title:window"
    8721118msgid "New Exception"
    873 msgstr "Novi izuzetak"
     1119msgstr "Nova iznimka"
    8741120
    8751121#. +> trunk stable
    8761122#: kmanualproxydlg.cpp:363
    877 #, fuzzy
    8781123#| msgid "Change Exception"
    8791124msgctxt "@title:window"
    8801125msgid "Change Exception"
    881 msgstr "Promjeni izuzetak"
     1126msgstr "Promijeni iznimku"
    8821127
    8831128#. +> trunk stable
    8841129#: kmanualproxydlg.cpp:440
    885 #, fuzzy
    8861130#| msgid "Invalid Entry"
    8871131msgctxt "@title:window"
     
    8961140#. +> trunk stable
    8971141#: kmanualproxydlg.cpp:445
    898 msgid "<qt>Make sure none of the addresses or URLs you specified contain invalid or wildcard characters such as spaces, asterisks (*), or question marks(?).<br /><br /><u>Examples of VALID entries:</u><br /><code>http://mycompany.com, 192.168.10.1, mycompany.com, localhost, http://localhost</code><br /><br /><u>Examples of INVALID entries:</u><br /><code>http://my company.com, http:/mycompany,com file:/localhost</code></qt>"
    899 msgstr "<qt>Osigurajte da ni jedna od definiranih adresa ili URL-ova ne sadrÅŸi nevaljane znakove poput razmaka, zvjezdice (*) ili upitnika (?).<br /> <br /> <u>Primjeri VALJANIH unosa:</u><br /> <code>http://mycompany.com, 192.168.10.1, mycompany.com, localhost, http://localhost</code><br /><br /><u>Primjeri NEVALJANIH unosa:</u><br /> <code>http://my company.com, http:/mycompany,com file:/localhost</code></qt>"
     1142msgid ""
     1143"<qt>Make sure none of the addresses or URLs you specified contain invalid or "
     1144"wildcard characters such as spaces, asterisks (*), or question marks(?).<br />"
     1145"<br /><u>Examples of VALID entries:</u><br /><code>http://mycompany.com, 192."
     1146"168.10.1, mycompany.com, localhost, http://localhost</code><br /><br /><u>"
     1147"Examples of INVALID entries:</u><br /><code>http://my company.com, "
     1148"http:/mycompany,com file:/localhost</code></qt>"
     1149msgstr ""
     1150"<qt>Osigurajte da ni jedna od definiranih adresa ili URL-ova ne sadrÅŸi "
     1151"nevaljane znakove poput razmaka, zvjezdice (*) ili upitnika (?).<br /> <br /> "
     1152"<u>Primjeri VALJANIH unosa:</u><br /> <code>http://mycompany.com, 192.168.10."
     1153"1, mycompany.com, localhost, http://localhost</code><br /><br /><u>Primjeri "
     1154"NEVALJANIH unosa:</u><br /> <code>http://my company.com, http:/mycompany,com "
     1155"file:/localhost</code></qt>"
    9001156
    9011157#. +> trunk stable
    9021158#: kmanualproxydlg.cpp:466
    9031159msgid "Enter the URL or address that should use the above proxy settings:"
    904 msgstr "Unesite adresu ili URL za koji treba koristiti gornje postavke posrednika:"
     1160msgstr ""
     1161"Unesite adresu ili URL za koji treba koristiti gornje postavke posrednika:"
    9051162
    9061163#. +> trunk stable
    9071164#: kmanualproxydlg.cpp:469
    908 msgid "Enter the address or URL that should be excluded from using the above proxy settings:"
    909 msgstr "Unesite adresu ili URL za koji ne treba koristiti gornje postavke posrednika:"
     1165msgid ""
     1166"Enter the address or URL that should be excluded from using the above proxy "
     1167"settings:"
     1168msgstr ""
     1169"Unesite adresu ili URL za koji ne treba koristiti gornje postavke posrednika:"
    9101170
    9111171#. +> trunk stable
    9121172#: kmanualproxydlg.cpp:472
    913 msgid "<qt>Enter a valid address or URL.<br /><br /><b><u>NOTE:</u></b> Wildcard matching such as <code>*.kde.org</code> is not supported. If you want to match any host in the <code>.kde.org</code> domain, e.g. <code>printing.kde.org</code>, then simply enter <code>.kde.org</code>.</qt>"
    914 msgstr "<qt>Unesite valjanu adresu ili URL.<br/> <br /> <b><u>NAPOMENA:</u></b>KoriÅ¡tenje viÅ¡eznačnika poput <code>*.kde.org</code> nije podrÅŸano. Ako ÅŸelite podudarnost s bilo kojim posluÅŸiteljem u domeni <code>.kde.org</code>, npr. <code>printing.kde.org</code>, tada jednostavno unesite <code>.kde.org</code>.</qt>"
     1173msgid ""
     1174"<qt>Enter a valid address or URL.<br /><br /><b><u>NOTE:</u></b> Wildcard "
     1175"matching such as <code>*.kde.org</code> is not supported. If you want to "
     1176"match any host in the <code>.kde.org</code> domain, e.g. <code>printing.kde."
     1177"org</code>, then simply enter <code>.kde.org</code>.</qt>"
     1178msgstr ""
     1179"<qt>Unesite valjanu adresu ili URL.<br/> <br /> <b><u>NAPOMENA:</u></b>"
     1180"KoriÅ¡tenje viÅ¡eznačnika poput <code>*.kde.org</code> nije podrÅŸano. Ako "
     1181"ÅŸelite podudarnost s bilo kojim posluÅŸiteljem u domeni <code>.kde.org</code>, "
     1182"npr. <code>printing.kde.org</code>, tada jednostavno unesite <code>.kde.org<"
     1183"/code>.</qt>"
    9151184
    9161185#. +> trunk stable
    9171186#: kproxydlg.cpp:160
    918 msgid "The address of the automatic proxy configuration script is invalid. Please correct this problem before proceeding. Otherwise, your changes will be ignored."
    919 msgstr "<qt>Adresa automatskog podeÅ¡avanja posrednika nije ispravna! Molim vas ispravite greÅ¡ku prije daljnjeg rada. U suprotnom će sve izmjene biti zanemarene!</qt>"
     1187msgid ""
     1188"The address of the automatic proxy configuration script is invalid. Please "
     1189"correct this problem before proceeding. Otherwise, your changes will be "
     1190"ignored."
     1191msgstr ""
     1192"<qt>Adresa automatskog podeÅ¡avanja posrednika nije ispravna! Molim vas "
     1193"ispravite greÅ¡ku prije daljnjeg rada. U suprotnom će sve izmjene biti "
     1194"zanemarene!</qt>"
    9201195
    9211196#. +> trunk stable
    9221197#: kproxydlg.cpp:287
    923 msgid "<h1>Proxy</h1><p>A proxy server is an intermediate program that sits between your machine and the Internet and provides services such as web page caching and/or filtering.</p><p>Caching proxy servers give you faster access to sites you have already visited by locally storing or caching the content of those pages; filtering proxy servers, on the other hand, provide the ability to block out requests for ads, spam, or anything else you want to block.</p><p><u>Note:</u> Some proxy servers provide both services.</p>"
    924 msgstr "<h1>Posrednik</h1><p>PosluÅŸitelj-posrednik je posredovni program koji stoji između vaÅ¡eg računala i Interneta, te pruÅŸa usluge poput predmemoriranja web stranica ili filtriranja.</p><p>PosluÅŸitelji-posrednici za predmemoriranje Vam omogućuju brÅŸi pristup stranicama koje ste već posjetili tako da lokalno spreme ili predmemoriraju sadrÅŸaj tih stranica; s druge strane, filtrirajući posluÅŸitelji-posrednici Vam pruÅŸaju mogućnost blokiranja reklama ili bilo čega Å¡to Vas nervira.</p> <p><u>Napomena:</u>Neki posluÅŸitelji-posrednici pruÅŸaju obje usluge.</p>"
     1198msgid ""
     1199"<h1>Proxy</h1><p>A proxy server is an intermediate program that sits between "
     1200"your machine and the Internet and provides services such as web page caching "
     1201"and/or filtering.</p><p>Caching proxy servers give you faster access to sites "
     1202"you have already visited by locally storing or caching the content of those "
     1203"pages; filtering proxy servers, on the other hand, provide the ability to "
     1204"block out requests for ads, spam, or anything else you want to block.</p><p><"
     1205"u>Note:</u> Some proxy servers provide both services.</p>"
     1206msgstr ""
     1207"<h1>Posrednik</h1><p>PosluÅŸitelj-posrednik je posredovni program koji stoji "
     1208"između vaÅ¡eg računala i Interneta, te pruÅŸa usluge poput predmemoriranja web "
     1209"stranica ili filtriranja.</p><p>PosluÅŸitelji-posrednici za predmemoriranje "
     1210"Vam omogućuju brÅŸi pristup stranicama koje ste već posjetili tako da lokalno "
     1211"spreme ili predmemoriraju sadrÅŸaj tih stranica; s druge strane, filtrirajući "
     1212"posluÅŸitelji-posrednici Vam pruÅŸaju mogućnost blokiranja reklama ili bilo "
     1213"čega Å¡to Vas nervira.</p> <p><u>Napomena:</u>Neki posluÅŸitelji-posrednici "
     1214"pruÅŸaju obje usluge.</p>"
    9251215
    9261216#. +> trunk stable
    9271217#: kproxydlg.cpp:306
    928 msgid "<qt>The proxy settings you specified are invalid.<br /><br />Please click on the <b>Setup...</b> button and correct the problem before proceeding; otherwise your changes will be ignored.</qt>"
    929 msgstr "<qt>Posrednici nisu ispravno podeÅ¡eni! Molim kliknite na <b>PodeÅ¡avanje
</b> kako bi ste ispravili greÅ¡ke prije nastavka rada; u suprotnom će sve ostale promjene zanemarene!</qt>"
     1218msgid ""
     1219"<qt>The proxy settings you specified are invalid.<br /><br />Please click on "
     1220"the <b>Setup...</b> button and correct the problem before proceeding; "
     1221"otherwise your changes will be ignored.</qt>"
     1222msgstr ""
     1223"<qt>Posrednici nisu ispravno podeÅ¡eni! Molim kliknite na <b>PodeÅ¡avanje
</b> "
     1224"kako bi ste ispravili greÅ¡ke prije nastavka rada; u suprotnom će sve ostale "
     1225"promjene zanemarene!</qt>"
    9301226
    9311227#. i18n: ectx: property (whatsThis), widget (QWidget, KProxyDialogUI)
     
    9361232"Setup proxy configuration.\n"
    9371233"<p>\n"
    938 "A proxy server is an intermediate machine that sits between your computer and the Internet and provides services such as web page caching and filtering. Caching proxy servers give you faster access to web sites you have already visited by locally storing or caching those pages; filtering proxy servers usually provide the ability to block out requests for ads, spam, or anything else you want to block.\n"
     1234"A proxy server is an intermediate machine that sits between your computer and "
     1235"the Internet and provides services such as web page caching and filtering. "
     1236"Caching proxy servers give you faster access to web sites you have already "
     1237"visited by locally storing or caching those pages; filtering proxy servers "
     1238"usually provide the ability to block out requests for ads, spam, or anything "
     1239"else you want to block.\n"
    9391240"<p>\n"
    940 "If you are uncertain whether or not you need to use a proxy server to connect to the Internet, consult your Internet service provider's setup guide or your system administrator.\n"
     1241"If you are uncertain whether or not you need to use a proxy server to connect "
     1242"to the Internet, consult your Internet service provider's setup guide or your "
     1243"system administrator.\n"
    9411244"</qt>"
    9421245msgstr ""
     
    9441247"Podešavanje posluşitelja-posrednika.\n"
    9451248"<p>\n"
    946 "PosluÅŸitelj-posrednik je posredovno računalo koje stoji između VaÅ¡eg računala i Interneta, te pruÅŸa usluge poput predmemoriranja web stranica ili filtriranja. PosluÅŸitelji-posrednici za predmemoriranje Vam omogućuju brÅŸi pristup već posjećenim web stranicama tako da ih lokalno spremi ili predmemorira; filtrirajući posluÅŸitelji-posrednici obično omogućuju blokiranje reklama ili bilo čega Å¡to Vas nervira.\n"
     1249"PosluÅŸitelj-posrednik je posredovno računalo koje stoji između VaÅ¡eg računala "
     1250"i Interneta, te pruÅŸa usluge poput predmemoriranja web stranica ili "
     1251"filtriranja. PosluÅŸitelji-posrednici za predmemoriranje Vam omogućuju brÅŸi "
     1252"pristup već posjećenim web stranicama tako da ih lokalno spremi ili "
     1253"predmemorira; filtrirajući posluÅŸitelji-posrednici obično omogućuju "
     1254"blokiranje reklama ili bilo čega Å¡to Vas nervira.\n"
    9471255"<p>\n"
    948 "Ako niste sigurni treba li vam posluÅŸitelj-posrednik za pristup Internetu, provjerite upute vaÅ¡eg pruÅŸatelja Internet usluga ili potraÅŸite savjet vaÅ¡eg upravitelja sustava.\n"
     1256"Ako niste sigurni treba li vam posluÅŸitelj-posrednik za pristup Internetu, "
     1257"provjerite upute vaÅ¡eg pruÅŸatelja Internet usluga ili potraÅŸite savjet vaÅ¡eg "
     1258"upravitelja sustava.\n"
    9491259"</qt>"
    9501260
     
    9671277"<qt>\n"
    9681278"Automatically detect and configure the proxy settings.<p>\n"
    969 "Automatic detection is performed using the <b>Web Proxy Auto-Discovery Protocol (WPAD)</b>.<p>\n"
    970 "<b>NOTE:</b> This option might not work properly or not work at all in some UNIX/Linux distributions. If you encounter a problem when using this option, please check the FAQ section at http://konqueror.kde.org.\n"
     1279"Automatic detection is performed using the <b>Web Proxy Auto-Discovery "
     1280"Protocol (WPAD)</b>.<p>\n"
     1281"<b>NOTE:</b> This option might not work properly or not work at all in some "
     1282"UNIX/Linux distributions. If you encounter a problem when using this option, "
     1283"please check the FAQ section at http://konqueror.kde.org.\n"
    9711284"</qt>"
    9721285msgstr ""
    9731286"<qt>\n"
    9741287"Automatski otkrij i postavi postavke posrednika. <p>\n"
    975 "Automatsko otkrivanje se izvodi pomoću <b>Protokola za automatsko otkrivanje web posrednika (WPAD – Web Proxy Auto-Discovery Protocol)</b>. <p>\n"
    976 "<b>NAPOMENA:</b>Ova opcija moÅŸda neće pravilno ili u potpunosti raditi na nekim UNIX/Linux distribucijama. Ako naiđete na problem prilikom koriÅ¡tenja ove opcije, molim provjerite FAQ dio na http://konqueror.kde.org\n"
     1288"Automatsko otkrivanje se izvodi pomoću <b>Protokola za automatsko otkrivanje "
     1289"web posrednika (WPAD – Web Proxy Auto-Discovery Protocol)</b>. <p>\n"
     1290"<b>NAPOMENA:</b>Ova opcija moÅŸda neće pravilno ili u potpunosti raditi na "
     1291"nekim UNIX/Linux distribucijama. Ako naiđete na problem prilikom koriÅ¡tenja "
     1292"ove opcije, molim provjerite FAQ dio na http://konqueror.kde.org\n"
    9771293"</qt>"
    9781294
     
    9871303#: kproxydlg.ui:75
    9881304msgid "Use the specified proxy script URL to configure the proxy settings."
    989 msgstr "Koristi navedenu skriptu za podeÅ¡avanje postavki posluÅŸitelja-posrednika."
     1305msgstr ""
     1306"Koristi navedenu skriptu za podeÅ¡avanje postavki posluÅŸitelja-posrednika."
    9901307
    9911308#. i18n: ectx: property (text), widget (QRadioButton, rbAutoScript)
     
    10071324"<qt>\n"
    10081325"Use environment variables to configure the proxy settings.<p>\n"
    1009 "Environment variables such as <b>HTTP_PROXY</b> and <b>NO_PROXY</b> are usually used in multi-user UNIX installations, where both graphical and non-graphical applications need to share the same proxy configuration information.\n"
     1326"Environment variables such as <b>HTTP_PROXY</b> and <b>NO_PROXY</b> are "
     1327"usually used in multi-user UNIX installations, where both graphical and "
     1328"non-graphical applications need to share the same proxy configuration "
     1329"information.\n"
    10101330"</qt>"
    10111331msgstr ""
    10121332"<qt>\n"
    10131333"Koristi varijable okoline za podešavanje postavki posrednika.<p>\n"
    1014 "Varijable okoline poput <b>HTTP_PROXY</b> i <b>NO_PROXY</b> su često koriÅ¡tene u viÅ¡ekorisničkim instalacijama UNIX-a, gdje grafičke i negrafičke aplikacije trebaju dijeliti iste postavke posrednika.\n"
     1334"Varijable okoline poput <b>HTTP_PROXY</b> i <b>NO_PROXY</b> su često "
     1335"koriÅ¡tene u viÅ¡ekorisničkim instalacijama UNIX-a, gdje grafičke i negrafičke "
     1336"aplikacije trebaju dijeliti iste postavke posrednika.\n"
    10151337"</qt>"
    10161338
     
    10801402#: kproxydlg.ui:220
    10811403msgid "Use information specified here to login into proxy servers as needed."
    1082 msgstr "Koristi informacije definirane ovdje za prijavu na posluÅŸitelje-posrednike po potrebi."
     1404msgstr ""
     1405"Koristi informacije definirane ovdje za prijavu na posluÅŸitelje-posrednike po "
     1406"potrebi."
    10831407
    10841408#. i18n: ectx: property (text), widget (QRadioButton, rbPresetLogin)
     
    11191443"<qt>\n"
    11201444"Use persistent proxy connection.<p>\n"
    1121 "Although a persistent proxy connection is faster, note that it only works correctly with proxies that are fully HTTP 1.1 compliant. Do <b>not</b> use this option in combination with non-HTTP 1.1 compliant proxy servers such as JunkBuster and WWWOfle.\n"
    1122 "</qt>"
    1123 msgstr "KoriÅ¡tenje stalnih (persistent) Proxy konekcija je brÅŸe, ali radi sam sa ProxyposluÅŸiteljima koji su u potpunosti usklađeni sa HTTP 1.1 protokolom. <b>Nemojte</b> koristiti ovu opciju sa programima kao Å¡to su JunkBuster ili WWWOfle."
     1445"Although a persistent proxy connection is faster, note that it only works "
     1446"correctly with proxies that are fully HTTP 1.1 compliant. Do <b>not</b> use "
     1447"this option in combination with non-HTTP 1.1 compliant proxy servers such as "
     1448"JunkBuster and WWWOfle.\n"
     1449"</qt>"
     1450msgstr ""
     1451"KoriÅ¡tenje stalnih (persistent) Proxy konekcija je brÅŸe, ali radi sam sa "
     1452"ProxyposluÅŸiteljima koji su u potpunosti usklađeni sa HTTP 1.1 protokolom. <b>"
     1453"Nemojte</b> koristiti ovu opciju sa programima kao Å¡to su JunkBuster ili "
     1454"WWWOfle."
    11241455
    11251456#. i18n: ectx: property (text), widget (QCheckBox, cbPersConn)
     
    11311462#. +> trunk stable
    11321463#: ksaveioconfig.cpp:224 ksaveioconfig.cpp:240
    1133 #, fuzzy
    11341464#| msgid "Update Failed"
    11351465msgctxt "@title:window"
    11361466msgid "Update Failed"
    1137 msgstr "Neuspjelo osvjeÅŸavanje"
     1467msgstr "Neuspjelo aÅŸuriranje"
    11381468
    11391469#. +> trunk stable
    11401470#: ksaveioconfig.cpp:225
    1141 msgid "You have to restart the running applications for these changes to take effect."
     1471msgid ""
     1472"You have to restart the running applications for these changes to take effect."
    11421473msgstr "Morate restartati pokrenute programe da bi ove izmjene bile vidljive."
    11431474
     
    11741505#. +> trunk stable
    11751506#: manualproxy.ui:100
    1176 msgid "Enter the port number of the FTP proxy server. Default 8080. Another common value is 3128."
    1177 msgstr "Unesite broj priljučka (port-a) vaÅ¡eg HTTP posrednika. Obično se koristi 8080."
     1507msgid ""
     1508"Enter the port number of the FTP proxy server. Default 8080. Another common "
     1509"value is 3128."
     1510msgstr ""
     1511"Unesite broj priljučka (port-a) vaÅ¡eg HTTP posrednika. Obično se koristi 8080."
    11781512
    11791513#. i18n: ectx: property (whatsThis), widget (KIntSpinBox, sbHttps)
     
    11811515#. +> trunk stable
    11821516#: manualproxy.ui:110 manualproxy.ui:126
    1183 msgid "Enter the port number of the HTTP proxy server. Default is 8080. Another common value is 3128."
    1184 msgstr "Unesite broj priljučka (port-a) vaÅ¡eg HTTP posrednika (proxy). Obično se koristi 8080."
     1517msgid ""
     1518"Enter the port number of the HTTP proxy server. Default is 8080. Another "
     1519"common value is 3128."
     1520msgstr ""
     1521"Unesite broj priljučka (port-a) vaÅ¡eg HTTP posrednika (proxy). Obično se "
     1522"koristi 8080."
    11851523
    11861524#. i18n: ectx: property (text), widget (QCheckBox, cbSameProxy)
     
    12011539msgid ""
    12021540"<qt>\n"
    1203 "Reverse the use of the exception list. Checking this box will result in the proxy servers being used only when the requested URL matches one of the addresses listed here.<p>This feature is useful if all you want or need is to use a proxy server  for a few specific sites.<p>If you have more complex requirements you might want to use a configuration script.\n"
    1204 "</qt>"
    1205 msgstr ""
    1206 "<qt>\n"
    1207 "KoriÅ¡tenje popisa iznimaka unatrag. Ako uključite ovu opciju, onda će se posrednici koristiti samo kad će se zahtijevani URL-ovi podudarati s ovdje popisanim adresama. <p>Ova mogućnost je korisna ako samo ÅŸelite koristiti posrednika za nekoliko specifičnih stranica. <p>Ako imate kompliciranije potrebe, moÅŸda ćete htjeti koristiti konfiguracijsku skriptu.\n"
     1541"Reverse the use of the exception list. Checking this box will result in the "
     1542"proxy servers being used only when the requested URL matches one of the "
     1543"addresses listed here.<p>This feature is useful if all you want or need is to "
     1544"use a proxy server  for a few specific sites.<p>If you have more complex "
     1545"requirements you might want to use a configuration script.\n"
     1546"</qt>"
     1547msgstr ""
     1548"<qt>\n"
     1549"KoriÅ¡tenje popisa iznimaka unatrag. Ako uključite ovu opciju, onda će se "
     1550"posrednici koristiti samo kad će se zahtijevani URL-ovi podudarati s ovdje "
     1551"popisanim adresama. <p>Ova mogućnost je korisna ako samo ÅŸelite koristiti "
     1552"posrednika za nekoliko specifičnih stranica. <p>Ako imate kompliciranije "
     1553"potrebe, moÅŸda ćete htjeti koristiti konfiguracijsku skriptu.\n"
    12081554"</qt>"
    12091555
     
    12181564#: manualproxy.ui:188
    12191565msgid "Remove all proxy exception addresses from the list."
    1220 msgstr "Ukloni sve adrese koje se ne dohvaćaju preko proxy posluÅŸitelja sa popisa."
     1566msgstr ""
     1567"Ukloni sve adrese koje se ne dohvaćaju preko proxy posluÅŸitelja sa popisa."
    12211568
    12221569#. i18n: ectx: property (text), widget (QPushButton, pbDeleteAll)
     
    12301577#: manualproxy.ui:201
    12311578msgid "Remove the selected proxy exception address from the list."
    1232 msgstr "Ukloni odabrane adrese koje se ne dohvaćaju preko proxy posluÅŸitelja sa popisa."
     1579msgstr ""
     1580"Ukloni odabrane adrese koje se ne dohvaćaju preko proxy posluÅŸitelja sa "
     1581"popisa."
    12331582
    12341583#. i18n: ectx: property (text), widget (QPushButton, pbDelete)
     
    12481597#: manualproxy.ui:224
    12491598msgid "Change the selected proxy exception address."
    1250 msgstr "Kliknite na ovaj gumb ako ÅŸelite izmjeniti odabrane adrese koje će biti iznimke."
     1599msgstr ""
     1600"Kliknite na ovaj gumb ako ÅŸelite izmjeniti odabrane adrese koje će biti "
     1601"iznimke."
    12511602
    12521603#. i18n: ectx: property (text), widget (QPushButton, pbChange)
     
    12641615#: netpref.cpp:33
    12651616#, kde-format
    1266 msgid "Here you can set timeout values. You might want to tweak them if your connection is very slow. The maximum allowed value is 1 second."
    1267 msgid_plural "Here you can set timeout values. You might want to tweak them if your connection is very slow. The maximum allowed value is %1 seconds."
    1268 msgstr[0] "Ovdje moÅŸete podesiti vrijeme valjanosti, koje moÅŸda trebate podesiti ako vam je veza spora. Najveća dozvoljena vrijednost je %1 sekunda."
    1269 msgstr[1] "Ovdje moÅŸete podesiti vrijeme valjanosti, koje moÅŸda trebate podesiti ako vam je veza spora. Najveća dozvoljena vrijednost je %1 sekunde."
    1270 msgstr[2] "Ovdje moÅŸete podesiti vrijeme valjanosti, koje moÅŸda trebate podesiti ako vam je veza spora. Najveća dozvoljena vrijednost je %1 sekundi."
     1617msgid ""
     1618"Here you can set timeout values. You might want to tweak them if your "
     1619"connection is very slow. The maximum allowed value is 1 second."
     1620msgid_plural ""
     1621"Here you can set timeout values. You might want to tweak them if your "
     1622"connection is very slow. The maximum allowed value is %1 seconds."
     1623msgstr[0] ""
     1624"Ovdje moÅŸete podesiti vrijeme valjanosti, koje moÅŸda trebate podesiti ako vam "
     1625"je veza spora. Najveća dozvoljena vrijednost je %1 sekunda."
     1626msgstr[1] ""
     1627"Ovdje moÅŸete podesiti vrijeme valjanosti, koje moÅŸda trebate podesiti ako vam "
     1628"je veza spora. Najveća dozvoljena vrijednost je %1 sekunde."
     1629msgstr[2] ""
     1630"Ovdje moÅŸete podesiti vrijeme valjanosti, koje moÅŸda trebate podesiti ako vam "
     1631"je veza spora. Najveća dozvoljena vrijednost je %1 sekundi."
    12711632
    12721633#. +> trunk stable
     
    13101671#. +> trunk stable
    13111672#: netpref.cpp:69
    1312 msgid "Enables FTP's \"passive\" mode. This is required to allow FTP to work from behind firewalls."
    1313 msgstr "Omogući FTP passive mode. Ovo je potrebno da bi koristili FTP iza vatrozida (firewalla)."
     1673msgid ""
     1674"Enables FTP's \"passive\" mode. This is required to allow FTP to work from "
     1675"behind firewalls."
     1676msgstr ""
     1677"Omogući FTP passive mode. Ovo je potrebno da bi koristili FTP iza vatrozida "
     1678"(firewalla)."
    13141679
    13151680#. +> trunk stable
     
    13201685#. +> trunk stable
    13211686#: netpref.cpp:76
    1322 msgid "<p>Marks partially uploaded FTP files.</p><p>When this option is enabled, partially uploaded files will have a \".part\" extension. This extension will be removed once the transfer is complete.</p>"
    1323 msgstr "<p>Označi djelomično uploadane FTP datoteke</p> <p>Ako je ova opcija omogućena, djelomično uploadane datoteke će imati ekstenziju \".part\". Ekstenzija će biti maknuta kad prijenos zavrÅ¡i.</p>"
     1687msgid ""
     1688"<p>Marks partially uploaded FTP files.</p><p>When this option is enabled, "
     1689"partially uploaded files will have a \".part\" extension. This extension will "
     1690"be removed once the transfer is complete.</p>"
     1691msgstr ""
     1692"<p>Označi djelomično uploadane FTP datoteke</p> <p>Ako je ova opcija "
     1693"omogućena, djelomično uploadane datoteke će imati ekstenziju \".part\". "
     1694"Ekstenzija će biti maknuta kad prijenos zavrÅ¡i.</p>"
    13241695
    13251696#. +> trunk stable
    13261697#: netpref.cpp:144
    1327 msgid "<h1>Network Preferences</h1>Here you can define the behavior of KDE programs when using Internet and network connections. If you experience timeouts or use a modem to connect to the Internet, you might want to adjust these settings."
    1328 msgstr "<h1>Postavke mreÅŸe</h1> Ovdje moÅŸete definirati ponaÅ¡anje KDE programa dok korite Internet i mreÅŸne veze. Ako koristite modem za spajanje na Internet ili Vam mreÅŸa ne radi kako ÅŸelite, ovdje moÅŸete promijeniti te postavke."
     1698msgid ""
     1699"<h1>Network Preferences</h1>Here you can define the behavior of KDE programs "
     1700"when using Internet and network connections. If you experience timeouts or "
     1701"use a modem to connect to the Internet, you might want to adjust these "
     1702"settings."
     1703msgstr ""
     1704"<h1>Postavke mreÅŸe</h1> Ovdje moÅŸete definirati ponaÅ¡anje KDE programa dok "
     1705"korite Internet i mreÅŸne veze. Ako koristite modem za spajanje na Internet "
     1706"ili Vam mreÅŸa ne radi kako ÅŸelite, ovdje moÅŸete promijeniti te postavke."
    13291707
    13301708#. i18n: ectx: property (whatsThis), widget (QLabel, lbDomain)
     
    13341712msgid ""
    13351713"<qt>\n"
    1336 "Enter the host or domain to which this policy applies, e.g. <b>www.kde.org</b> or <b>.kde.org</b>.\n"
    1337 "</qt>"
    1338 msgstr ""
    1339 "<qt>\n"
    1340 "Unesite domaćina ili domenu na koju se ovo pravilo odnosi, npr. <b>www.kde.org</b> ili <b>.kde.org</b>\n"
     1714"Enter the host or domain to which this policy applies, e.g. <b>www.kde.org</b>"
     1715" or <b>.kde.org</b>.\n"
     1716"</qt>"
     1717msgstr ""
     1718"<qt>\n"
     1719"Unesite domaćina ili domenu na koju se ovo pravilo odnosi, npr. <b>www.kde."
     1720"org</b> ili <b>.kde.org</b>\n"
    13411721"</qt>"
    13421722
     
    13661746"<li><b>Prihvati</b> – Ove stranice smiju slati kolačiće</li>\n"
    13671747"<li><b>Odbij</b> – Ove stranice ne smiju slati kolačiće</li>\n"
    1368 "<li><b>Pitaj</b> – TraÅŸi se potvrda kad god ove stranice pokuÅ¡aju poslati kolačić</li>\n"
     1748"<li><b>Pitaj</b> – TraÅŸi se potvrda kad god ove stranice pokuÅ¡aju poslati "
     1749"kolačić</li>\n"
    13691750"</ul>\n"
    13701751"</qt>"
     
    14111792#. +> trunk stable
    14121793#: smbrodlg.cpp:177
    1413 msgid "<p><h1>Windows Shares</h1>Konqueror is able to access shared Microsoft Windows file systems, if properly configured. If there is a specific computer from which you want to browse, fill in the <em>Browse server</em> field. This is mandatory if you are not running Samba locally. The <em>Broadcast address</em> and <em>WINS address</em> fields will also be available, if you use the native code, or the location of the 'smb.conf' file from which the options are read, when using Samba. In any case, the broadcast address (interfaces in smb.conf) must be set up if it is guessed incorrectly or you have multiple cards. A WINS server usually improves performance, and reduces the network load a lot.</p><p>The bindings are used to assign a default user for a given server, possibly with the corresponding password, or for accessing specific shares. If you choose to, new bindings will be created for logins and shares accessed during browsing. You can edit all of them from here. Passwords will be stored locally, and scrambled so as to render them unreadable to the human eye. For security reasons, you may not want to do that, as entries with passwords are clearly indicated as such.</p>"
    1414 msgstr "<p> <h1>Windows dijeljenja</h1> Konqueror moÅŸe pristupati dijeljenim datotečnim sustavima operacijskog sustava Microsoft Windows, ako je pravilno postavljen. Ako postoji specifično računalo koje ÅŸelite pregledati, popunite polje <em>Pregledaj posluÅŸitelja</em>. To je obavezno ako nemate lokalno pokrenutu Sambu. Polja <em>Adresa emitiranja</em> i <em>WINS adresa</em> će također biti dostupna, ako koristite čisti kod, ili lokacija'smb.conf' datoteke iz koje će biti pročitane opcije, ako koristite Sambu. U oba slučaja, adresa emitiranja (sučelja u smb.conf) mora biti postavljena ako je pogreÅ¡no pogođena ili ako imate viÅ¡e mreÅŸnih kartica. WINS posluÅŸitelj obično poboljÅ¡a brzinu i uvelike smanji opterećenje mreÅŸe.</p> <p>Veze se koriste za dodjeljivanje uobičajenog korisnika zadanom posluÅŸitelju, moguće s odgovarajućom lozinkom, ili za pristup specifičnim lokacijama. Ako tako odaberete, nove veze će se stvoriti za prijave i dijeljenja kojima se pristupa prilikom pregledavanja. Sve ih moÅŸete urediti odavde. Lozinke će biti spremljene lokalno, ali ispremijeÅ¡ane kako bi bile nečitljive ljudima (iz sigurnosnih razloga).</p>"
     1794msgid ""
     1795"<p><h1>Windows Shares</h1>Konqueror is able to access shared Microsoft "
     1796"Windows file systems, if properly configured. If there is a specific computer "
     1797"from which you want to browse, fill in the <em>Browse server</em> field. This "
     1798"is mandatory if you are not running Samba locally. The <em>Broadcast address<"
     1799"/em> and <em>WINS address</em> fields will also be available, if you use the "
     1800"native code, or the location of the 'smb.conf' file from which the options "
     1801"are read, when using Samba. In any case, the broadcast address (interfaces in "
     1802"smb.conf) must be set up if it is guessed incorrectly or you have multiple "
     1803"cards. A WINS server usually improves performance, and reduces the network "
     1804"load a lot.</p><p>The bindings are used to assign a default user for a given "
     1805"server, possibly with the corresponding password, or for accessing specific "
     1806"shares. If you choose to, new bindings will be created for logins and shares "
     1807"accessed during browsing. You can edit all of them from here. Passwords will "
     1808"be stored locally, and scrambled so as to render them unreadable to the human "
     1809"eye. For security reasons, you may not want to do that, as entries with "
     1810"passwords are clearly indicated as such.</p>"
     1811msgstr ""
     1812"<p> <h1>Windows dijeljenja</h1> Konqueror moÅŸe pristupati dijeljenim "
     1813"datotečnim sustavima operacijskog sustava Microsoft Windows, ako je pravilno "
     1814"postavljen. Ako postoji specifično računalo koje ÅŸelite pregledati, popunite "
     1815"polje <em>Pregledaj posluÅŸitelja</em>. To je obavezno ako nemate lokalno "
     1816"pokrenutu Sambu. Polja <em>Adresa emitiranja</em> i <em>WINS adresa</em> će "
     1817"također biti dostupna, ako koristite čisti kod, ili lokacija'smb.conf' "
     1818"datoteke iz koje će biti pročitane opcije, ako koristite Sambu. U oba "
     1819"slučaja, adresa emitiranja (sučelja u smb.conf) mora biti postavljena ako je "
     1820"pogreÅ¡no pogođena ili ako imate viÅ¡e mreÅŸnih kartica. WINS posluÅŸitelj obično "
     1821"poboljÅ¡a brzinu i uvelike smanji opterećenje mreÅŸe.</p> <p>Veze se koriste za "
     1822"dodjeljivanje uobičajenog korisnika zadanom posluÅŸitelju, moguće s "
     1823"odgovarajućom lozinkom, ili za pristup specifičnim lokacijama. Ako tako "
     1824"odaberete, nove veze će se stvoriti za prijave i dijeljenja kojima se "
     1825"pristupa prilikom pregledavanja. Sve ih moÅŸete urediti odavde. Lozinke će "
     1826"biti spremljene lokalno, ali ispremijeÅ¡ane kako bi bile nečitljive ljudima "
     1827"(iz sigurnosnih razloga).</p>"
    14151828
    14161829#. +> trunk stable
    14171830#: useragentdlg.cpp:80
    1418 #, fuzzy
    14191831#| msgid "Add Identification"
    14201832msgctxt "@title:window"
     
    14241836#. +> trunk stable
    14251837#: useragentdlg.cpp:149
    1426 #, fuzzy
    14271838#| msgid "Modify Identification"
    14281839msgctxt "@title:window"
    14291840msgid "Modify Identification"
    1430 msgstr "Izmjeni identifikaciju"
     1841msgstr "Izmijeni identifikaciju"
    14311842
    14321843#. +> trunk stable
    14331844#: useragentdlg.cpp:201
    14341845#, kde-format
    1435 msgid "<qt><center>Found an existing identification for<br/><b>%1</b><br/>Do you want to replace it?</center></qt>"
    1436 msgstr "<qt> <center>Pronađena postojeća identifikacija za<br/> <b>%1</b><br/> Åœelite li je zamijeniti?</center> </qt>"
     1846msgid ""
     1847"<qt><center>Found an existing identification for<br/><b>%1</b><br/>Do you "
     1848"want to replace it?</center></qt>"
     1849msgstr ""
     1850"<qt> <center>Pronađena postojeća identifikacija za<br/> <b>%1</b><br/> Åœelite "
     1851"li je zamijeniti?</center> </qt>"
    14371852
    14381853#. +> trunk stable
    14391854#: useragentdlg.cpp:206
    1440 #, fuzzy
    14411855#| msgid "Duplicate Identification"
    14421856msgctxt "@title:window"
    14431857msgid "Duplicate Identification"
    1444 msgstr "Dvostruka identifikacija"
     1858msgstr "Duplikat identifikacije"
    14451859
    14461860#. +> trunk stable
    14471861#: useragentdlg.cpp:386
    1448 msgid "<p><h1>Browser Identification</h1> The browser-identification module allows you to have full control over how Konqueror will identify itself to web sites you browse.</p><p>This ability to fake identification is necessary because some web sites do not display properly when they detect that they are not talking to current versions of either Netscape Navigator or Internet Explorer, even if the browser actually supports all the necessary features to render those pages properly. For such sites, you can use this feature to try to browse them. Please understand that this might not always work, since such sites might be using non-standard web protocols and or specifications.</p><p><u>NOTE:</u> To obtain specific help on a particular section of the dialog box, simply click on the quick help button on the window title bar, then click on the section for which you are seeking help.</p>"
    1449 msgstr "<p> <h1>Indentifikacija preglednikay</h1>  Modul za identifikaciju preglednika Vam omogućuje punu kontrolu nad tim kako će se Konqueror identificirati web stranicama koje pregledavate.</p> <p>Ova mogućnost laÅŸne identifikacije je potrebna jer se neke web stranice ne ÅŸele pravilno iscrtati ako otkriju da ih se ne pregledava sa najzadnjim verzijama Mozilla Firefoxa ili Internet Explorera, makar taj preglednik imao sve mogućnosti potrebne za pravilno iscrtavanje tih stranica. Za takve stranice, moÅŸete iskoristiti ovu mogućnost dok ih pregledavate. Molimo za razumijevanje da taj trik moÅŸda neće uvijek upaliti, jer takve stranice moÅŸda koriste nestandardne web protokole i/ili specifikacije.</p> <p><u>NAPOMENA:</u>Da biste dobili specifičnu pomoć za određeni dio dialoga, jednostavno kliknite na gumb za brzu pomoć u naslovnoj traci prozora, a zatim kliknite na dio za koji traÅŸite pomoć.</p>"
     1862msgid ""
     1863"<p><h1>Browser Identification</h1> The browser-identification module allows "
     1864"you to have full control over how Konqueror will identify itself to web sites "
     1865"you browse.</p><p>This ability to fake identification is necessary because "
     1866"some web sites do not display properly when they detect that they are not "
     1867"talking to current versions of either Netscape Navigator or Internet "
     1868"Explorer, even if the browser actually supports all the necessary features to "
     1869"render those pages properly. For such sites, you can use this feature to try "
     1870"to browse them. Please understand that this might not always work, since such "
     1871"sites might be using non-standard web protocols and or specifications.</p><p>"
     1872"<u>NOTE:</u> To obtain specific help on a particular section of the dialog "
     1873"box, simply click on the quick help button on the window title bar, then "
     1874"click on the section for which you are seeking help.</p>"
     1875msgstr ""
     1876"<p> <h1>Indentifikacija preglednikay</h1>  Modul za identifikaciju "
     1877"preglednika Vam omogućuje punu kontrolu nad tim kako će se Konqueror "
     1878"identificirati web stranicama koje pregledavate.</p> <p>Ova mogućnost laÅŸne "
     1879"identifikacije je potrebna jer se neke web stranice ne ÅŸele pravilno iscrtati "
     1880"ako otkriju da ih se ne pregledava sa najzadnjim verzijama Mozilla Firefoxa "
     1881"ili Internet Explorera, makar taj preglednik imao sve mogućnosti potrebne za "
     1882"pravilno iscrtavanje tih stranica. Za takve stranice, moÅŸete iskoristiti ovu "
     1883"mogućnost dok ih pregledavate. Molimo za razumijevanje da taj trik moÅŸda neće "
     1884"uvijek upaliti, jer takve stranice moÅŸda koriste nestandardne web protokole "
     1885"i/ili specifikacije.</p> <p><u>NAPOMENA:</u>Da biste dobili specifičnu pomoć "
     1886"za određeni dio dialoga, jednostavno kliknite na gumb za brzu pomoć u "
     1887"naslovnoj traci prozora, a zatim kliknite na dio za koji traÅŸite pomoć.</p>"
    14501888
    14511889#. i18n: ectx: property (whatsThis), widget (QWidget, UserAgentUI)
     
    14541892msgid ""
    14551893"<qt>\n"
    1456 "Here you can modify the default browser-identification text or set a site <code>(eg. www.kde.org)</code> or a domain <code>(eg. kde.org)</code> specific identification text.<p>\n"
    1457 "To add a new site-specific identification text, click the <code>New</code> button and supply the necessary information. To change an existing site-specific entry, click on the <code>Change</code> button. The <code>Delete</code> button will remove the selected site-specific identification text, causing the default setting to be used for that site or domain.\n"
    1458 "</qt>"
    1459 msgstr ""
    1460 "<qt>\n"
    1461 "Ovdje moÅŸete promijeniti uobičajeni tekst identifikacije preglednika ili postaviti specifični tekst identifikacije za određene stranice ili domene (npr. <code>www.kde.org</code> ili <code>.kde.org</code>). <p>\n"
    1462 "Da biste dodali novi tekst identifikacije za specifičnu stranicu, kliknite na gumb <code>Novo</code> i dajte potrebne informacije. Da biste promijenili unos za specifičnu stranicu, kliknite na gumb <code>Promijeni</code>. Gumb <code>IzbriÅ¡i</code> će izbrisati identifikacijske tekstove za odabrane specifične stranice. Za te stranice bit će koriÅ¡tene uobičajene postavke.\n"
     1894"Here you can modify the default browser-identification text or set a site <"
     1895"code>(eg. www.kde.org)</code> or a domain <code>(eg. kde.org)</code> specific "
     1896"identification text.<p>\n"
     1897"To add a new site-specific identification text, click the <code>New</code> "
     1898"button and supply the necessary information. To change an existing "
     1899"site-specific entry, click on the <code>Change</code> button. The <code>"
     1900"Delete</code> button will remove the selected site-specific identification "
     1901"text, causing the default setting to be used for that site or domain.\n"
     1902"</qt>"
     1903msgstr ""
     1904"<qt>\n"
     1905"Ovdje moÅŸete promijeniti uobičajeni tekst identifikacije preglednika ili "
     1906"postaviti specifični tekst identifikacije za određene stranice ili domene "
     1907"(npr. <code>www.kde.org</code> ili <code>.kde.org</code>). <p>\n"
     1908"Da biste dodali novi tekst identifikacije za specifičnu stranicu, kliknite na "
     1909"gumb <code>Novo</code> i dajte potrebne informacije. Da biste promijenili "
     1910"unos za specifičnu stranicu, kliknite na gumb <code>Promijeni</code>. Gumb <"
     1911"code>IzbriÅ¡i</code> će izbrisati identifikacijske tekstove za odabrane "
     1912"specifične stranice. Za te stranice bit će koriÅ¡tene uobičajene postavke.\n"
    14631913"</qt>"
    14641914
     
    14691919"<qt>\n"
    14701920"Send the browser identification to web sites.<p>\n"
    1471 "<u>NOTE:</u> Many sites rely on this information to display pages properly, hence, it is highly recommended that you do not totally disable this feature but rather customize it.<p>\n"
    1472 "By default, only minimal identification information is sent to remote sites. The identification text that will be sent is shown below.\n"
     1921"<u>NOTE:</u> Many sites rely on this information to display pages properly, "
     1922"hence, it is highly recommended that you do not totally disable this feature "
     1923"but rather customize it.<p>\n"
     1924"By default, only minimal identification information is sent to remote sites. "
     1925"The identification text that will be sent is shown below.\n"
    14731926"</qt>"
    14741927msgstr ""
    14751928"<qt>\n"
    14761929"Å alji identifikaciju preglednika web stranicama.<p>\n"
    1477 "<u>NAPOMENA:</u> Mnoge stranice oslanjaju se na ovaj podatak kako bi ispravno prikazale sadrÅŸaj. Stoga je preporučljivo da ne isključujete ovu mogućnost potpuno, već da je samo prilagodite.<p>\n"
    1478 "Uobičajeno se Å¡alju samo najnuÅŸniji podaci. Tekst koji se Å¡alje prikazan je dolje.\n"
     1930"<u>NAPOMENA:</u> Mnoge stranice oslanjaju se na ovaj podatak kako bi ispravno "
     1931"prikazale sadrÅŸaj. Stoga je preporučljivo da ne isključujete ovu mogućnost "
     1932"potpuno, već da je samo prilagodite.<p>\n"
     1933"Uobičajeno se Å¡alju samo najnuÅŸniji podaci. Tekst koji se Å¡alje prikazan je "
     1934"dolje.\n"
    14791935"</qt>"
    14801936
     
    14881944#. +> trunk stable
    14891945#: useragentdlg.ui:43
    1490 msgid "The browser identification text sent to the sites you visit. Use the provided options to customize it."
    1491 msgstr "Identifikacijski tekst preglednika koji se Å¡alje web stranicama koje posjetite. MoÅŸete ga prilagoditi ponuđenim opcijama."
     1946msgid ""
     1947"The browser identification text sent to the sites you visit. Use the provided "
     1948"options to customize it."
     1949msgstr ""
     1950"Identifikacijski tekst preglednika koji se Å¡alje web stranicama koje "
     1951"posjetite. MoÅŸete ga prilagoditi ponuđenim opcijama."
    14921952
    14931953#. i18n: ectx: property (title), widget (QGroupBox, defaultIdGroupBox)
     
    15001960#. +> trunk stable
    15011961#: useragentdlg.ui:58
    1502 msgid "The browser identification text sent to the sites you visit. You can customize it using the options provided below."
    1503 msgstr "Ovo je uobičajena identifikacija koja se Å¡alje posluÅŸiteljima tokom pretraÅŸivanja stranica na internetu. Odabiranjem u kućicama ispod moÅŸete ju prilagoditi svojim ÅŸeljama."
     1962msgid ""
     1963"The browser identification text sent to the sites you visit. You can "
     1964"customize it using the options provided below."
     1965msgstr ""
     1966"Ovo je uobičajena identifikacija koja se Å¡alje posluÅŸiteljima tokom "
     1967"pretraÅŸivanja stranica na internetu. Odabiranjem u kućicama ispod moÅŸete ju "
     1968"prilagoditi svojim ÅŸeljama."
    15041969
    15051970#. i18n: ectx: property (whatsThis), widget (QCheckBox, osNameCheckBox)
    15061971#. +> trunk stable
    15071972#: useragentdlg.ui:71
    1508 msgid "Includes your operating system's name in the browser identification text."
    1509 msgstr "Ovdje odabirete dodavanje <code>inačice vaÅ¡eg operacijskog sustava</code> u uobičajenu identifikacijsku poruku."
     1973msgid ""
     1974"Includes your operating system's name in the browser identification text."
     1975msgstr ""
     1976"Ovdje odabirete dodavanje <code>inačice vaÅ¡eg operacijskog sustava</code> u "
     1977"uobičajenu identifikacijsku poruku."
    15101978
    15111979#. i18n: ectx: property (text), widget (QCheckBox, osNameCheckBox)
     
    15181986#. +> trunk stable
    15191987#: useragentdlg.ui:102
    1520 msgid "Includes your operating system's version number in the browser identification text."
    1521 msgstr "Ovdje odabirete dodavanje <code>inačice vaÅ¡eg operacijskog sustava</code> u uobičajenu identifikacijsku poruku."
     1988msgid ""
     1989"Includes your operating system's version number in the browser identification "
     1990"text."
     1991msgstr ""
     1992"Ovdje odabirete dodavanje <code>inačice vaÅ¡eg operacijskog sustava</code> u "
     1993"uobičajenu identifikacijsku poruku."
    15221994
    15231995#. i18n: ectx: property (text), widget (QCheckBox, osVersionCheckBox)
     
    15422014#. +> trunk stable
    15432015#: useragentdlg.ui:127
    1544 msgid "Includes your language settings in the browser identification text to obtain localized versions of the page."
    1545 msgstr "Uključuje vaÅ¡e jezične postavke u identifikacijskom tekstu preglednika kako bi se dohvatila lokalizirana verzija stranice."
     2016msgid ""
     2017"Includes your language settings in the browser identification text to obtain "
     2018"localized versions of the page."
     2019msgstr ""
     2020"Uključuje vaÅ¡e jezične postavke u identifikacijskom tekstu preglednika kako "
     2021"bi se dohvatila lokalizirana verzija stranice."
    15462022
    15472023#. i18n: ectx: property (text), widget (QCheckBox, languageCheckBox)
     
    16112087msgid ""
    16122088"<qt>\n"
    1613 "Enter the site or domain name where a fake browser identification should be used.<p>\n"
    1614 "<u>NOTE:</u> Wildcard syntax such as \\\"*,?\\\" is NOT allowed: instead, use the top level address of a site to make generic matches; for example, if you want all KDE sites to receive a fake browser identification, you would enter <code>kde.org</code> - the fake identity would then be sent to any KDE site that ends with <code>kde.org</code>.</p>\n"
    1615 "</qt>"
    1616 msgstr ""
    1617 "<qt>\n"
    1618 "Unesite web stranicu ili domenu gdje bi treba biti koriÅ¡tena laÅŸna identifikacija pretraÅŸivača. <p>\n"
    1619 "<u>NAPOMENA:</u>ViÅ¡eznačna sintaksa poput \\\"*, ?\\\" NIJE dozvoljena: umjesto toga, koristite gornji nivo adrese web stranice da biste dobili općenite podudarnosti; na primjer, ako ÅŸelite da sve KDE stranice dobe laÅŸnu identifikaciju preglednika, unijeli biste <code>.kde.org</code> – laÅŸni identitet će tada biti poslan svim stranicama čija adresa zavrÅ¡ava na <code>kde.org</code>.\n"
     2089"Enter the site or domain name where a fake browser identification should be "
     2090"used.<p>\n"
     2091"<u>NOTE:</u> Wildcard syntax such as \\\"*,?\\\" is NOT allowed: instead, use "
     2092"the top level address of a site to make generic matches; for example, if you "
     2093"want all KDE sites to receive a fake browser identification, you would enter "
     2094"<code>kde.org</code> - the fake identity would then be sent to any KDE site "
     2095"that ends with <code>kde.org</code>.</p>\n"
     2096"</qt>"
     2097msgstr ""
     2098"<qt>\n"
     2099"Unesite web stranicu ili domenu gdje bi treba biti koriÅ¡tena laÅŸna "
     2100"identifikacija pretraÅŸivača. <p>\n"
     2101"<u>NAPOMENA:</u>ViÅ¡eznačna sintaksa poput \\\"*, ?\\\" NIJE dozvoljena: "
     2102"umjesto toga, koristite gornji nivo adrese web stranice da biste dobili "
     2103"općenite podudarnosti; na primjer, ako ÅŸelite da sve KDE stranice dobe laÅŸnu "
     2104"identifikaciju preglednika, unijeli biste <code>.kde.org</code> – laÅŸni "
     2105"identitet će tada biti poslan svim stranicama čija adresa zavrÅ¡ava na <code>"
     2106"kde.org</code>.\n"
    16202107"</qt>"
    16212108
     
    16322119msgid ""
    16332120"<qt>\n"
    1634 "Select the browser identification to use whenever contacting the site you specified above.\n"
    1635 "</qt>"
    1636 msgstr ""
    1637 "<qt>\n"
    1638 "Odaberite identifikaciju preglednika koju ćete koristiti kad pristupate stranicama navedenim gore.\n"
     2121"Select the browser identification to use whenever contacting the site you "
     2122"specified above.\n"
     2123"</qt>"
     2124msgstr ""
     2125"<qt>\n"
     2126"Odaberite identifikaciju preglednika koju ćete koristiti kad pristupate "
     2127"stranicama navedenim gore.\n"
    16392128"</qt>"
    16402129
     
    16512140msgid ""
    16522141"<qt>\n"
    1653 "The actual browser identification text that will be sent to the remote machine.\n"
    1654 "</qt>"
    1655 msgstr ""
    1656 "<qt>\n"
    1657 "Stvarni tekst identifikacije preglednika koji će biti poslan udaljenom računalu.\n"
     2142"The actual browser identification text that will be sent to the remote "
     2143"machine.\n"
     2144"</qt>"
     2145msgstr ""
     2146"<qt>\n"
     2147"Stvarni tekst identifikacije preglednika koji će biti poslan udaljenom "
     2148"računalu.\n"
    16582149"</qt>"
    16592150
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmkonq.po

    r1123 r1129  
    55# Andrej Dundovic <adundovi@gmail.com>, 2009.
    66# Marko Dimjasevic <marko@dimjasevic.net>, 2011.
     7# Marko DimjaÅ¡ević <marko@dimjasevic.net>, 2011.
    78msgid ""
    89msgstr ""
     
    1011"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    1112"POT-Creation-Date: 2011-07-08 10:22+0200\n"
    12 "PO-Revision-Date: 2011-03-04 19:03+0100\n"
    13 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     13"PO-Revision-Date: 2011-07-12 16:54+0200\n"
     14"Last-Translator: Marko DimjaÅ¡ević <marko@dimjasevic.net>\n"
    1415"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
    1516"MIME-Version: 1.0\n"
     
    1718"Content-Transfer-Encoding: 8bit\n"
    1819"Language: hr\n"
    19 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     20"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     21"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    2022"X-Generator: Lokalize 1.2\n"
    2123"X-Environment: kde\n"
     
    2527#. +> trunk stable
    2628#: behaviour.cpp:45
    27 msgid "<h1>Konqueror Behavior</h1> You can configure how Konqueror behaves as a file manager here."
    28 msgstr "<h1>PonaÅ¡anje Konquerora</h1>Ovdje moÅŸete podesiti ponaÅ¡anje Konquerora kao upravitelja datoteka. "
     29msgid ""
     30"<h1>Konqueror Behavior</h1> You can configure how Konqueror behaves as a file "
     31"manager here."
     32msgstr ""
     33"<h1>PonaÅ¡anje Konquerora</h1>Ovdje moÅŸete podesiti ponaÅ¡anje Konquerora kao "
     34"upravitelja datoteka. "
    2935
    3036#. +> trunk stable
     
    4046#. +> trunk stable
    4147#: behaviour.cpp:59
    42 msgid "If this option is checked, Konqueror will open a new window when you open a folder, rather than showing that folder's contents in the current window."
    43 msgstr "Ako je ovo odabrano, Konqueror će otvoriti direktorij koji otvorite i pokazati ga u novom prozoru, umjesto da pokaÅŸe sadrÅŸaj direktorija u trenutnom prozoru."
     48msgid ""
     49"If this option is checked, Konqueror will open a new window when you open a "
     50"folder, rather than showing that folder's contents in the current window."
     51msgstr ""
     52"Ako je ovo odabrano, Konqueror će otvoriti direktorij koji otvorite i "
     53"pokazati ga u novom prozoru, umjesto da pokaÅŸe sadrÅŸaj direktorija u "
     54"trenutnom prozoru."
    4455
    4556#. +> trunk stable
     
    5263#, fuzzy
    5364#| msgid "Check this if you want 'Delete' menu commands to be displayed on the desktop and in the file manager's context menus. You can always delete files by holding the Shift key while calling 'Move to Trash'."
    54 msgid "Check this if you want 'Delete' menu commands to be displayed on the desktop and in the file manager's menus and context menus. You can always delete files by holding the Shift key while calling 'Move to Trash'."
    55 msgstr "Uključite ovo ako ÅŸelite da naredbe brisanja budu prikazane na radnoj povrÅ¡ini i u kontekstnim izbornicima upravitelja daotekama. Uvijek moÅŸete izbrisati datoteke tako da drÅŸite tipku Shift dok pozivate naredbu 'Baci u smeće'."
     65msgid ""
     66"Check this if you want 'Delete' menu commands to be displayed on the desktop "
     67"and in the file manager's menus and context menus. You can always delete "
     68"files by holding the Shift key while calling 'Move to Trash'."
     69msgstr ""
     70"Uključite ovo ako ÅŸelite da naredbe brisanja budu prikazane na radnoj "
     71"povrÅ¡ini i u kontekstnim izbornicima upravitelja daotekama. Uvijek moÅŸete "
     72"izbrisati datoteke tako da drÅŸite tipku Shift dok pozivate naredbu 'Baci u "
     73"smeće'."
    5674
    5775#. +> trunk stable
    5876#: kcustommenueditor.cpp:96
    59 #, fuzzy
    6077#| msgid "Menu Editor"
    6178msgctxt "@title:window"
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmkwincompositing.po

    r1123 r1129  
    1010"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    1111"POT-Creation-Date: 2011-07-08 10:22+0200\n"
    12 "PO-Revision-Date: 2011-05-04 21:53+0200\n"
     12"PO-Revision-Date: 2011-07-12 16:57+0200\n"
    1313"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
    1414"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
     
    1717"Content-Transfer-Encoding: 8bit\n"
    1818"Language: hr\n"
    19 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     19"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     20"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    2021"X-Generator: Lokalize 1.2\n"
    2122"X-Environment: kde\n"
     
    101102#: main.cpp:213
    102103msgid ""
    103 "Failed to activate desktop effects using the given configuration options. Settings will be reverted to their previous values.\n"
    104 "\n"
    105 "Check your X configuration. You may also consider changing advanced options, especially changing the compositing type."
    106 msgstr ""
    107 "Ne mogu aktivirati efekte radne povrÅ¡ine sa zadanim konfiguracijskim opcijama. Postavke će biti vraćene na stare vrijednosti.\n"
    108 "\n"
    109 "Provjerite vaÅ¡u X konfiguraciju. Također moÅŸete razmotriti izmjenu naprednih opcija, posebno promjenu tipa 3D efekata."
     104"Failed to activate desktop effects using the given configuration options. "
     105"Settings will be reverted to their previous values.\n"
     106"\n"
     107"Check your X configuration. You may also consider changing advanced options, "
     108"especially changing the compositing type."
     109msgstr ""
     110"Ne mogu aktivirati efekte radne povrÅ¡ine sa zadanim konfiguracijskim opcijama."
     111" Postavke će biti vraćene na stare vrijednosti.\n"
     112"\n"
     113"Provjerite vaÅ¡u X konfiguraciju. Također moÅŸete razmotriti izmjenu naprednih "
     114"opcija, posebno promjenu tipa 3D efekata."
    110115
    111116#. +> trunk stable
     
    151156#. +> trunk stable
    152157#: main.cpp:417
    153 msgid "Desktop effects are not available on this system due to the following technical issues:"
    154 msgstr "3D efekti nisu dostupni na ovom sustavu zbog sljedećih tehničkih predmeta:"
     158msgid ""
     159"Desktop effects are not available on this system due to the following "
     160"technical issues:"
     161msgstr ""
     162"3D efekti nisu dostupni na ovom sustavu zbog sljedećih tehničkih predmeta:"
    155163
    156164#. +> trunk stable
    157165#: main.cpp:630
    158166msgid ""
    159 "Your settings have been saved but as KDE is currently running in failsafe mode desktop effects cannot be enabled at this time.\n"
     167"Your settings have been saved but as KDE is currently running in failsafe "
     168"mode desktop effects cannot be enabled at this time.\n"
    160169"\n"
    161170"Please exit failsafe mode to enable desktop effects."
    162171msgstr ""
    163 "VaÅ¡e postavke biti će spremljene ali kako KDE trenutno radi u sigurnosnom načinu, efekti radne povrÅ¡ine ne mogu biti omogućeni u ovom trenutku.\n"
     172"VaÅ¡e postavke biti će spremljene ali kako KDE trenutno radi u sigurnosnom "
     173"načinu, efekti radne povrÅ¡ine ne mogu biti omogućeni u ovom trenutku.\n"
    164174"\n"
    165175"Molim vas da izađite iz sigurnosnog načina rada kako bi ste omogućili efekte."
     
    184194#. +> trunk stable
    185195#: main.ui:82
    186 #, fuzzy
    187196msgid "Pressing this button can crash the desktop."
    188 msgstr "Pritnisnite gumb za brisanje osjetila."
     197msgstr "Pritiskanje ovog gumba moÅŸe uzrokovati ruÅ¡enje radne povrÅ¡ine."
    189198
    190199#. i18n: ectx: property (text), widget (QCheckBox, rearmSafetyCheck)
     
    192201#: main.ui:105
    193202msgid "I have saved my data."
    194 msgstr ""
     203msgstr "Spremio sam svoje podatke."
    195204
    196205#. i18n: ectx: property (text), widget (QPushButton, rearmGlSupportButton)
    197206#. +> trunk stable
    198207#: main.ui:128
    199 #, fuzzy
    200208msgid "Re-enable OpenGL detection"
    201 msgstr "Omogući otkrivanje mrtvog istorazinca"
     209msgstr "Ponovno omogući otkrivanje OpenGL-a"
    202210
    203211#. i18n: ectx: property (title), widget (QGroupBox, groupBox_2)
     
    218226#: main.ui:199
    219227msgid "Desktop effects can be toggled anytime using this shortcut:"
    220 msgstr "Efekti radne povrÅ¡ine moÅŸete bilo kada uključiti i isključiti koristeći ovaj prečac:"
     228msgstr ""
     229"Efekti radne povrÅ¡ine moÅŸete bilo kada uključiti i isključiti koristeći ovaj "
     230"prečac:"
    221231
    222232#. i18n: ectx: property (title), widget (QGroupBox, groupBox)
     
    301311#. +> trunk stable
    302312#: main.ui:418
    303 msgid "You can find more effects, as well as effect-specific settings, in the \"All Effects\" tab above."
    304 msgstr "MoÅŸete pronaći joÅ¡ efekata, kao i postavke vezane uz efekte u \"Svi efekti\" kartici iznad."
     313msgid ""
     314"You can find more effects, as well as effect-specific settings, in the \"All "
     315"Effects\" tab above."
     316msgstr ""
     317"MoÅŸete pronaći joÅ¡ efekata, kao i postavke vezane uz efekte u \"Svi efekti\" "
     318"kartici iznad."
    305319
    306320#. i18n: ectx: attribute (title), widget (QWidget, tab_2)
     
    313327#. +> trunk stable
    314328#: main.ui:472
    315 msgid "Hint: To find out or configure how to activate an effect, look at the effect's settings."
    316 msgstr "Savjet: Za pronaći gdje ili kako konfigurirati, odnosno aktivirati efekt, pogledajte na postavke efekta."
     329msgid ""
     330"Hint: To find out or configure how to activate an effect, look at the "
     331"effect's settings."
     332msgstr ""
     333"Savjet: Za pronaći gdje ili kako konfigurirati, odnosno aktivirati efekt, "
     334"pogledajte na postavke efekta."
    317335
    318336#. i18n: ectx: attribute (title), widget (QWidget, tab_4)
     
    361379#. +> trunk stable
    362380#: main.ui:615
    363 msgctxt "A window thumbnail requires to have the corresponding window mapped. To have thumbnails at all time, windows are not unmapped. This can break window minimization as it is modelled as unmapping of windows."
     381msgctxt ""
     382"A window thumbnail requires to have the corresponding window mapped. To have "
     383"thumbnails at all time, windows are not unmapped. This can break window "
     384"minimization as it is modelled as unmapping of windows."
    364385msgid "Always (Breaks minimization)"
    365386msgstr "Uvijek (uništava minimizaciju)"
     
    368389#. +> trunk stable
    369390#: main.ui:620
    370 msgctxt "Windows are not unmapped if the window is somewhere visible on any of the virtual desktops."
     391msgctxt ""
     392"Windows are not unmapped if the window is somewhere visible on any of the "
     393"virtual desktops."
    371394msgid "Only for Shown Windows"
    372395msgstr "Samo za prikazane prozore"
     
    375398#. +> trunk stable
    376399#: main.ui:625
    377 msgctxt "Windows are unmapped as they are requested. This can lead to not having updated thumbnials for windows on other desktops."
     400msgctxt ""
     401"Windows are unmapped as they are requested. This can lead to not having "
     402"updated thumbnials for windows on other desktops."
    378403msgid "Never"
    379404msgstr "Nikada"
     
    389414#: main.ui:666
    390415msgid ""
    391 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n"
    392 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n"
     416"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3."
     417"org/TR/REC-html40/strict.dtd\">\n"
     418"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">"
     419"\n"
    393420"p, li { white-space: pre-wrap; }\n"
    394 "</style></head><body style=\" font-family:'Segoe'; font-size:8pt; font-weight:400; font-style:normal;\">\n"
    395 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Crisp:</span></p>\n"
    396 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">XRenderSetPictureFilter(\"fast\")</span> -  Pretty fast on all GPUs but looks bricky</p>\n"
    397 "<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>\n"
    398 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Smooth:</span></p>\n"
    399 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">XRenderSetPictureFilter(\"good\") </span>- linear blending.</p>\n"
    400 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Fast enough on newer nvidia GPUs and maybe others but also can be <span style=\" text-decoration: underline;\">very</span> slow, you will have to try it.</p></body></html>"
    401 msgstr ""
    402 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n"
    403 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n"
     421"</style></head><body style=\" font-family:'Segoe'; font-size:8pt; "
     422"font-weight:400; font-style:normal;\">\n"
     423"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     424"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
     425"font-weight:600;\">Crisp:</span></p>\n"
     426"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     427"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
     428"font-style:italic;\">XRenderSetPictureFilter(\"fast\")</span> -  Pretty fast "
     429"on all GPUs but looks bricky</p>\n"
     430"<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; "
     431"margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>"
     432"\n"
     433"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     434"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
     435"font-weight:600;\">Smooth:</span></p>\n"
     436"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     437"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
     438"font-style:italic;\">XRenderSetPictureFilter(\"good\") </span>- linear "
     439"blending.</p>\n"
     440"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     441"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Fast enough on newer "
     442"nvidia GPUs and maybe others but also can be <span style=\" text-decoration: "
     443"underline;\">very</span> slow, you will have to try it.</p></body></html>"
     444msgstr ""
     445"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3."
     446"org/TR/REC-html40/strict.dtd\">\n"
     447"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">"
     448"\n"
    404449"p, li { white-space: pre-wrap; }\n"
    405 "</style></head><body style=\" font-family:'Segoe'; font-size:8pt; font-weight:400; font-style:normal;\">\n"
    406 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Krto:</span></p>\n"
    407 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">XRenderSetPictureFilter(\"fast\")</span> –  Poprilično brzo na svim GPU-ovima, no izgleda kockasto</p>\n"
    408 "<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>\n"
    409 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Uglađeno:</span></p>\n"
    410 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">XRenderSetPictureFilter(\"good\") </span>- linearno stapanje.</p>\n"
    411 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Dovoljno brzo na novijim nvidijinim GPU-ovima i moÅŸda i na ostali, no također moÅŸe biti <span style=\" text-decoration: underline;\">vrlo</span> sporo; morat ćete isprobati.</p></body></html>"
     450"</style></head><body style=\" font-family:'Segoe'; font-size:8pt; "
     451"font-weight:400; font-style:normal;\">\n"
     452"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     453"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
     454"font-weight:600;\">Krto:</span></p>\n"
     455"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     456"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
     457"font-style:italic;\">XRenderSetPictureFilter(\"fast\")</span> –  Poprilično "
     458"brzo na svim GPU-ovima, no izgleda kockasto</p>\n"
     459"<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; "
     460"margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>"
     461"\n"
     462"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     463"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
     464"font-weight:600;\">Uglađeno:</span></p>\n"
     465"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     466"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
     467"font-style:italic;\">XRenderSetPictureFilter(\"good\") </span>- linearno "
     468"stapanje.</p>\n"
     469"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     470"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Dovoljno brzo na "
     471"novijim nvidijinim GPU-ovima i moÅŸda i na ostali, no također moÅŸe biti <span "
     472"style=\" text-decoration: underline;\">vrlo</span> sporo; morat ćete "
     473"isprobati.</p></body></html>"
    412474
    413475#. i18n: ectx: property (text), item, widget (QComboBox, xrScaleFilter)
     
    428490#: main.ui:699
    429491msgid ""
    430 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n"
    431 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n"
     492"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3."
     493"org/TR/REC-html40/strict.dtd\">\n"
     494"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">"
     495"\n"
    432496"p, li { white-space: pre-wrap; }\n"
    433 "</style></head><body style=\" font-family:'Segoe'; font-size:8pt; font-weight:400; font-style:normal;\">\n"
    434 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Crisp:</span></p>\n"
    435 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">GL_NEAREST</span> -  (very) fast on all GPUs but looks bricky</p>\n"
    436 "<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>\n"
    437 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Smooth:</span></p>\n"
    438 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">GL_LINEAR</span> - fast on most GPUs but a little blurry</p>\n"
    439 "<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>\n"
    440 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Accurate:</span></p>\n"
    441 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Lanczos filter, requires shader support (glsl or arb).</p>\n"
    442 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Might be slow on weaker GPUs and even cause various troubles with broken drivers (from overbrightening to segfaults.)</p>\n"
    443 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Fall back to \"Smooth\" if you have problems.</p></body></html>"
    444 msgstr ""
    445 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n"
    446 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n"
     497"</style></head><body style=\" font-family:'Segoe'; font-size:8pt; "
     498"font-weight:400; font-style:normal;\">\n"
     499"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     500"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
     501"font-weight:600;\">Crisp:</span></p>\n"
     502"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     503"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
     504"font-style:italic;\">GL_NEAREST</span> -  (very) fast on all GPUs but looks "
     505"bricky</p>\n"
     506"<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; "
     507"margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>"
     508"\n"
     509"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     510"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
     511"font-weight:600;\">Smooth:</span></p>\n"
     512"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     513"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
     514"font-style:italic;\">GL_LINEAR</span> - fast on most GPUs but a little "
     515"blurry</p>\n"
     516"<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; "
     517"margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>"
     518"\n"
     519"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     520"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
     521"font-weight:600;\">Accurate:</span></p>\n"
     522"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     523"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Lanczos filter, "
     524"requires shader support (glsl or arb).</p>\n"
     525"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     526"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Might be slow on "
     527"weaker GPUs and even cause various troubles with broken drivers (from "
     528"overbrightening to segfaults.)</p>\n"
     529"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     530"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Fall back to "
     531"\"Smooth\" if you have problems.</p></body></html>"
     532msgstr ""
     533"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3."
     534"org/TR/REC-html40/strict.dtd\">\n"
     535"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">"
     536"\n"
    447537"p, li { white-space: pre-wrap; }\n"
    448 "</style></head><body style=\" font-family:'Segoe'; font-size:8pt; font-weight:400; font-style:normal;\">\n"
    449 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Kruto:</span></p>\n"
    450 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">GL_NEAREST</span> –  (poprilično) brzo na svim GPU-ovima, no izgleda kockasto</p>\n"
    451 "<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>\n"
    452 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Uglađeno:</span></p>\n"
    453 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:italic;\">GL_LINEAR</span> – brzo na većini GPU-ova, no malo je zamagljeno</p>\n"
    454 "<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>\n"
    455 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-weight:600;\">Precizno:</span></p>\n"
    456 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Filtar Lanczos, treba podrÅ¡ku za sjenčanje (glsl ili arb).</p>\n"
    457 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">MoÅŸe biti sporo na slabijim GPU-ovima ili čak uzrokovati razne probleme s nevaljalim upravljačkim programima (od prejakog osvjetljenja do \"segfaultova\".)</p>\n"
    458 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Vratite na \"Uglađeno\" ako imate problema.</p></body></html>"
     538"</style></head><body style=\" font-family:'Segoe'; font-size:8pt; "
     539"font-weight:400; font-style:normal;\">\n"
     540"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     541"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
     542"font-weight:600;\">Kruto:</span></p>\n"
     543"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     544"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
     545"font-style:italic;\">GL_NEAREST</span> –  (poprilično) brzo na svim "
     546"GPU-ovima, no izgleda kockasto</p>\n"
     547"<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; "
     548"margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>"
     549"\n"
     550"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     551"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
     552"font-weight:600;\">Uglađeno:</span></p>\n"
     553"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     554"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
     555"font-style:italic;\">GL_LINEAR</span> – brzo na većini GPU-ova, no malo je "
     556"zamagljeno</p>\n"
     557"<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; "
     558"margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></p>"
     559"\n"
     560"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     561"margin-right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" "
     562"font-weight:600;\">Precizno:</span></p>\n"
     563"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     564"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Filtar Lanczos, "
     565"treba podrÅ¡ku za sjenčanje (glsl ili arb).</p>\n"
     566"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     567"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">MoÅŸe biti sporo na "
     568"slabijim GPU-ovima ili čak uzrokovati razne probleme s nevaljalim "
     569"upravljačkim programima (od prejakog osvjetljenja do \"segfaultova\".)</p>\n"
     570"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     571"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Vratite na "
     572"\"Uglađeno\" ako imate problema.</p></body></html>"
    459573
    460574#. i18n: ectx: property (text), item, widget (QComboBox, glScaleFilter)
     
    474588#: main.ui:726
    475589msgid "Suspend desktop effects for fullscreen windows"
    476 msgstr "Obustavi efekte radne povrÅ¡ine za prozore rastegnute preko cijelog zaslona"
     590msgstr ""
     591"Obustavi efekte radne povrÅ¡ine za prozore rastegnute preko cijelog zaslona"
    477592
    478593#. i18n: ectx: property (title), widget (QGroupBox, glGroup)
     
    498613#: main.ui:798
    499614msgid ""
    500 "If enabled all rendering will be performed with Shaders written in the OpenGL Shading Language.\n"
     615"If enabled all rendering will be performed with Shaders written in the OpenGL "
     616"Shading Language.\n"
    501617"On legacy hardware disabling Shaders can improve the performance."
    502618msgstr ""
    503 "Ako je omogućeno, svo iscrtavanje će se izvrÅ¡iti uz Sjenčanje napisano u OpenGL-ovom jeziku za sjenčanje.\n"
     619"Ako je omogućeno, svo iscrtavanje će se izvrÅ¡iti uz Sjenčanje napisano u "
     620"OpenGL-ovom jeziku za sjenčanje.\n"
    504621" Na starom hardveru onemogućavanje Sjenčanja moÅŸe poboljÅ¡ati performanse."
    505622
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmkwinrules.po

    r1123 r1129  
    77# Andrej Dundović <adundovi@gmail.com>, 2009.
    88# Andrej Dundovic <adundovi@gmail.com>, 2010.
     9# Marko DimjaÅ¡ević <marko@dimjasevic.net>, 2011.
    910msgid ""
    1011msgstr ""
     
    1213"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    1314"POT-Creation-Date: 2011-07-08 10:22+0200\n"
    14 "PO-Revision-Date: 2011-03-04 19:01+0100\n"
    15 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     15"PO-Revision-Date: 2011-07-12 17:36+0200\n"
     16"Last-Translator: Marko DimjaÅ¡ević <marko@dimjasevic.net>\n"
    1617"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
    1718"MIME-Version: 1.0\n"
     
    1920"Content-Transfer-Encoding: 8bit\n"
    2021"Language: hr\n"
    21 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     22"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     23"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    2224"X-Generator: Lokalize 1.2\n"
    2325"X-Environment: kde\n"
     
    2830msgctxt "NAME OF TRANSLATORS"
    2931msgid "Your names"
    30 msgstr "Renato Pavičić, Åœarko Pintar"
     32msgstr "Renato Pavičić, Åœarko Pintar, Marko DimjaÅ¡ević"
    3133
    3234#. +> trunk stable
    3335msgctxt "EMAIL OF TRANSLATORS"
    3436msgid "Your emails"
    35 msgstr "renato@translator-shop.org, zarko.pintar@gmail.com"
     37msgstr ""
     38"renato@translator-shop.org, zarko.pintar@gmail.com, marko@dimjasevic.net"
    3639
    3740#. i18n: ectx: property (text), item, widget (QListWidget, types)
     
    155158#. +> trunk stable
    156159#: detectwidget.ui:175
    157 #, fuzzy
    158160msgid "Match Strategy"
    159 msgstr "Taktika i strategija"
     161msgstr "Strategija podudaranja"
    160162
    161163#. i18n: ectx: property (whatsThis), widget (QRadioButton, use_class)
    162164#. +> trunk stable
    163165#: detectwidget.ui:184
    164 msgid "For selecting all windows belonging to a specific application, selecting only window class should usually work."
    165 msgstr "Za odabir svih prozora koji pripadaju određenoj aplikaciji, dovoljno je odabrati samo klasu porozora."
     166msgid ""
     167"For selecting all windows belonging to a specific application, selecting only "
     168"window class should usually work."
     169msgstr ""
     170"Za odabir svih prozora koji pripadaju određenoj aplikaciji, dovoljno je "
     171"odabrati samo klasu porozora."
    166172
    167173#. i18n: ectx: property (text), widget (QRadioButton, use_class)
     
    174180#. +> trunk stable
    175181#: detectwidget.ui:197
    176 msgid "For selecting a specific window in an application, both window class and window role should be selected. Window class will determine the application, and window role the specific window in the application; many applications do not provide useful window roles though."
    177 msgstr "Za odabir određenog prozora unutar aplikacije, i klasa prozora i uloga se trebaju označiti. Klasa prozora će odrediti aplikaciju, a uloga prozora određeni prozor unutar aplikacije; iako mnoge aplikacije ne pruÅŸaju korisne informacije kroz prozorske uloge. "
     182msgid ""
     183"For selecting a specific window in an application, both window class and "
     184"window role should be selected. Window class will determine the application, "
     185"and window role the specific window in the application; many applications do "
     186"not provide useful window roles though."
     187msgstr ""
     188"Za odabir određenog prozora unutar aplikacije, i klasa prozora i uloga se "
     189"trebaju označiti. Klasa prozora će odrediti aplikaciju, a uloga prozora "
     190"određeni prozor unutar aplikacije; iako mnoge aplikacije ne pruÅŸaju korisne "
     191"informacije kroz prozorske uloge. "
    178192
    179193#. i18n: ectx: property (text), widget (QRadioButton, use_role)
     
    186200#. +> trunk stable
    187201#: detectwidget.ui:207
    188 msgid "With some (non-KDE) applications whole window class can be sufficient for selecting a specific window in an application, as they set whole window class to contain both application and window role."
    189 msgstr "Za neke (ne-KDE) aplikacije cijela klasa prozora moÅŸe biti dovoljna za odabir određenog prozora u aplikaciji, kako je podeÅ¡eno da cijela klasa prozora sadrÅŸi i ulogu aplikacije i prozora."
     202msgid ""
     203"With some (non-KDE) applications whole window class can be sufficient for "
     204"selecting a specific window in an application, as they set whole window class "
     205"to contain both application and window role."
     206msgstr ""
     207"Za neke (ne-KDE) aplikacije cijela klasa prozora moÅŸe biti dovoljna za odabir "
     208"određenog prozora u aplikaciji, kako je podeÅ¡eno da cijela klasa prozora "
     209"sadrÅŸi i ulogu aplikacije i prozora."
    190210
    191211#. i18n: ectx: property (text), widget (QRadioButton, use_whole_class)
     
    205225#: editshortcut.ui:18
    206226msgid ""
    207 "A single shortcut can be easily assigned or cleared using the two buttons. Only shortcuts with modifiers can be used.<p>\n"
    208 "It is possible to have several possible shortcuts, and the first available shortcut will be used. The shortcuts are specified using space-separated shortcut sets. One set is specified as <i>base</i>+(<i>list</i>), where base are modifiers and list is a list of keys.<br>\n"
    209 "For example \"<b>Shift+Alt+(123) Shift+Ctrl+(ABC)</b>\" will first try <b>Shift+Alt+1</b>, then others with <b>Shift+Ctrl+C</b> as the last one."
    210 msgstr ""
    211 "Pojedini prečac moÅŸe se jednostavno pridruÅŸiti ili izbrisati koristeći dva gumba. Mogu se koristit samo prečaci sa modifikatorima.<p>\n"
    212 "Moguće je imati nekoliko prečaca, a koristiti prvi slobodni prečac. Prečaci koriste posebni razmakno-separatorski skup. Jedan skup je određen kao <i>base</i>+(<i>list</i>), gdje su 'base' modifikatori, a 'list' lista tipki.<br>\n"
    213 "Na primjer \"<b>Shift+Alt+(123) Shift+Ctrl+(ABC)</b>\" će prvo pokuÅ¡ati <b>Shift+Alt+1</b>, a tada ostale sa <b>Shift+Ctrl+C</b> kao zadnjim."
     227"A single shortcut can be easily assigned or cleared using the two buttons. "
     228"Only shortcuts with modifiers can be used.<p>\n"
     229"It is possible to have several possible shortcuts, and the first available "
     230"shortcut will be used. The shortcuts are specified using space-separated "
     231"shortcut sets. One set is specified as <i>base</i>+(<i>list</i>), where base "
     232"are modifiers and list is a list of keys.<br>\n"
     233"For example \"<b>Shift+Alt+(123) Shift+Ctrl+(ABC)</b>\" will first try <b>"
     234"Shift+Alt+1</b>, then others with <b>Shift+Ctrl+C</b> as the last one."
     235msgstr ""
     236"Pojedini prečac moÅŸe se jednostavno pridruÅŸiti ili izbrisati koristeći dva "
     237"gumba. Mogu se koristit samo prečaci sa modifikatorima.<p>\n"
     238"Moguće je imati nekoliko prečaca, a koristiti prvi slobodni prečac. Prečaci "
     239"koriste posebni razmakno-separatorski skup. Jedan skup je određen kao <i>"
     240"base</i>+(<i>list</i>), gdje su 'base' modifikatori, a 'list' lista tipki.<br>"
     241"\n"
     242"Na primjer \"<b>Shift+Alt+(123) Shift+Ctrl+(ABC)</b>\" će prvo pokuÅ¡ati <b>"
     243"Shift+Alt+1</b>, a tada ostale sa <b>Shift+Ctrl+C</b> kao zadnjim."
    214244
    215245#. i18n: ectx: property (text), widget (QPushButton, pushButton1)
     
    247277#. +> trunk stable
    248278#: kcm.cpp:86
    249 msgid "<p><h1>Window-specific Settings</h1> Here you can customize window settings specifically only for some windows.</p> <p>Please note that this configuration will not take effect if you do not use KWin as your window manager. If you do use a different window manager, please refer to its documentation for how to customize window behavior.</p>"
    250 msgstr "<p><h1>Prozorski-posebne postavke</h1> Ovdje moÅŸete prilagoditi postavke prozora posebno za neki prozor.</p> <p>Imajte na umu da ova konfiguracija nema efekta ako ne koristite KWin kao vaÅ¡ upravitelj prozorima. Ako koristite drugi upravitelj prozorima, onda konzultirajte njegovu dokumentaciju kako prilagoditi ponaÅ¡anje prozora</p>"
     279msgid ""
     280"<p><h1>Window-specific Settings</h1> Here you can customize window settings "
     281"specifically only for some windows.</p> <p>Please note that this "
     282"configuration will not take effect if you do not use KWin as your window "
     283"manager. If you do use a different window manager, please refer to its "
     284"documentation for how to customize window behavior.</p>"
     285msgstr ""
     286"<p><h1>Prozorski-posebne postavke</h1> Ovdje moÅŸete prilagoditi postavke "
     287"prozora posebno za neki prozor.</p> <p>Imajte na umu da ova konfiguracija "
     288"nema efekta ako ne koristite KWin kao vaÅ¡ upravitelj prozorima. Ako koristite "
     289"drugi upravitelj prozorima, onda konzultirajte njegovu dokumentaciju kako "
     290"prilagoditi ponaÅ¡anje prozora</p>"
    251291
    252292#. +> trunk stable
     
    304344#. +> trunk stable
    305345#: ruleslist.cpp:155
    306 #, fuzzy
    307346msgid "Export Rule"
    308 msgstr "Izvezi rutu"
     347msgstr "Izvezi pravilo"
    309348
    310349#. +> trunk stable
    311350#: ruleslist.cpp:166
    312 #, fuzzy
    313351msgid "Import Rules"
    314 msgstr "Stil ruba okvira"
     352msgstr "Uvezi pravila"
    315353
    316354#. i18n: ectx: property (text), widget (KPushButton, new_button)
     
    347385#. +> trunk stable
    348386#: ruleslist.ui:91
    349 #, fuzzy
    350387msgid "&Import"
    351388msgstr "&Uvoz"
     
    354391#. +> trunk stable
    355392#: ruleslist.ui:98
    356 #, fuzzy
    357393msgid "&Export"
    358394msgstr "&Izvoz"
     
    360396#. +> trunk stable
    361397#: ruleswidget.cpp:57
    362 msgid "Enable this checkbox to alter this window property for the specified window(s)."
    363 msgstr "Omogući ovaj odabirni okvir kako bi promijenili svojstva određenih prozora sa svojstvima ovog prozora."
     398msgid ""
     399"Enable this checkbox to alter this window property for the specified "
     400"window(s)."
     401msgstr ""
     402"Omogući ovaj odabirni okvir kako bi promijenili svojstva određenih prozora sa "
     403"svojstvima ovog prozora."
    364404
    365405#. +> trunk stable
    366406#: ruleswidget.cpp:59
    367 msgid "Specify how the window property should be affected:<ul><li><em>Do Not Affect:</em> The window property will not be affected and therefore the default handling for it will be used. Specifying this will block more generic window settings from taking effect.</li><li><em>Apply Initially:</em> The window property will be only set to the given value after the window is created. No further changes will be affected.</li><li><em>Remember:</em> The value of the window property will be remembered and every time time the window is created, the last remembered value will be applied.</li><li><em>Force:</em> The window property will be always forced to the given value.</li><li><em>Apply Now:</em> The window property will be set to the given value immediately and will not be affected later (this action will be deleted afterwards).</li><li><em>Force temporarily:</em> The window property will be forced to the given value until it is hidden (this action will be deleted after the window is hidden).</li></ul>"
    368 msgstr "Odredite kakav će imati utjecaj prozorske osobitosti:<ul><li><em>Bez utjecaja:</em> Prozorske osobitosti neće imati utjecaja i biti će koriÅ¡teno zadano rukovanje. Ovo će blokirati mnoge općenite postavke prozora.</li><li><em>Primijeni na početku:</em> Prozorske osobitosti će biti postavljene na određenu vrijednost samo pri stvaranju prozora. Buduće promjene neće imati utjecaja.</li><li><em>Zapamti:</em> Vrijednost prozorske osobitosti biti će zapamćena i svaki puta kada se prozor stvori, biti će primjenjena zadnja zapamćena vrijednost.</li><li><em>Prisilno:</em> Prozorska osobitost biti će uvijek prisilno postavljena na zadanu vrijednost.</li><li><em>Primjeni sada:</em> Prozorska osobitost biti će odmah postavljena na zadanu vrijednost i neće imati utjecaja kasnije (akcija će biti izbrisana).</li><li><em>Privremeno prisilno:</em> Prozorska osobitost biti će prisilno postavljena na zadanu vrijednost sve dok nije sakrivena (ova akcija biti će izbrisana nakon Å¡to se prozor sakrije).</li></ul>"
     407msgid ""
     408"Specify how the window property should be affected:<ul><li><em>Do Not "
     409"Affect:</em> The window property will not be affected and therefore the "
     410"default handling for it will be used. Specifying this will block more generic "
     411"window settings from taking effect.</li><li><em>Apply Initially:</em> The "
     412"window property will be only set to the given value after the window is "
     413"created. No further changes will be affected.</li><li><em>Remember:</em> The "
     414"value of the window property will be remembered and every time time the "
     415"window is created, the last remembered value will be applied.</li><li><em>"
     416"Force:</em> The window property will be always forced to the given value.</li>"
     417"<li><em>Apply Now:</em> The window property will be set to the given value "
     418"immediately and will not be affected later (this action will be deleted "
     419"afterwards).</li><li><em>Force temporarily:</em> The window property will be "
     420"forced to the given value until it is hidden (this action will be deleted "
     421"after the window is hidden).</li></ul>"
     422msgstr ""
     423"Odredite kakav će imati utjecaj prozorske osobitosti:<ul><li><em>Bez "
     424"utjecaja:</em> Prozorske osobitosti neće imati utjecaja i biti će koriÅ¡teno "
     425"zadano rukovanje. Ovo će blokirati mnoge općenite postavke prozora.</li><li><"
     426"em>Primijeni na početku:</em> Prozorske osobitosti će biti postavljene na "
     427"određenu vrijednost samo pri stvaranju prozora. Buduće promjene neće imati "
     428"utjecaja.</li><li><em>Zapamti:</em> Vrijednost prozorske osobitosti biti će "
     429"zapamćena i svaki puta kada se prozor stvori, biti će primjenjena zadnja "
     430"zapamćena vrijednost.</li><li><em>Prisilno:</em> Prozorska osobitost biti će "
     431"uvijek prisilno postavljena na zadanu vrijednost.</li><li><em>Primjeni sada:<"
     432"/em> Prozorska osobitost biti će odmah postavljena na zadanu vrijednost i "
     433"neće imati utjecaja kasnije (akcija će biti izbrisana).</li><li><em>"
     434"Privremeno prisilno:</em> Prozorska osobitost biti će prisilno postavljena na "
     435"zadanu vrijednost sve dok nije sakrivena (ova akcija biti će izbrisana nakon "
     436"Å¡to se prozor sakrije).</li></ul>"
    369437
    370438#. +> trunk stable
    371439#: ruleswidget.cpp:74
    372 msgid "Specify how the window property should be affected:<ul><li><em>Do Not Affect:</em> The window property will not be affected and therefore the default handling for it will be used. Specifying this will block more generic window settings from taking effect.</li><li><em>Force:</em> The window property will be always forced to the given value.</li><li><em>Force temporarily:</em> The window property will be forced to the given value until it is hidden (this action will be deleted after the window is hidden).</li></ul>"
    373 msgstr "Odredite kakav će imati utjecaj prozorske osobitosti:<ul><li><em>Bez utjecaja:</em> Prozorske osobitosti neće imati utjecaja i biti će koriÅ¡teno zadano rukovanje. Ovo će blokirati mnoge općenite postavke prozora.</li><li><em>Prisilno:</em> Prozorska osobitost biti će uvijek prisilno postavljena na zadanu vrijednost.</li><li><em>Privremeno prisilno:</em> Prozorska osobitost biti će prisilno postavljena na zadanu vrijednost sve dok nije sakrivena (ova akcija biti će izbrisana nakon Å¡to se prozor sakrije).</li></ul>"
     440msgid ""
     441"Specify how the window property should be affected:<ul><li><em>Do Not "
     442"Affect:</em> The window property will not be affected and therefore the "
     443"default handling for it will be used. Specifying this will block more generic "
     444"window settings from taking effect.</li><li><em>Force:</em> The window "
     445"property will be always forced to the given value.</li><li><em>Force "
     446"temporarily:</em> The window property will be forced to the given value until "
     447"it is hidden (this action will be deleted after the window is hidden).</li><"
     448"/ul>"
     449msgstr ""
     450"Odredite kakav će imati utjecaj prozorske osobitosti:<ul><li><em>Bez "
     451"utjecaja:</em> Prozorske osobitosti neće imati utjecaja i biti će koriÅ¡teno "
     452"zadano rukovanje. Ovo će blokirati mnoge općenite postavke prozora.</li><li><"
     453"em>Prisilno:</em> Prozorska osobitost biti će uvijek prisilno postavljena na "
     454"zadanu vrijednost.</li><li><em>Privremeno prisilno:</em> Prozorska osobitost "
     455"biti će prisilno postavljena na zadanu vrijednost sve dok nije sakrivena (ova "
     456"akcija biti će izbrisana nakon Å¡to se prozor sakrije).</li></ul>"
    374457
    375458#. +> trunk stable
     
    396479msgid ""
    397480"You have specified the window class as unimportant.\n"
    398 "This means the settings will possibly apply to windows from all applications. If you really want to create a generic setting, it is recommended you at least limit the window types to avoid special window types."
     481"This means the settings will possibly apply to windows from all applications. "
     482"If you really want to create a generic setting, it is recommended you at "
     483"least limit the window types to avoid special window types."
    399484msgstr ""
    400485"Odredili ste klasu prozora kao nevaÅŸnu.\n"
    401 "To znači da je moguće da će se primjeniti postavke prozora iz svih aplikacija. Ako zaista ÅŸelite stvoriti općenite postavke, preporučamo vam da barem ograničite tipove prozora kako bi izbjegli posebne tipove."
     486"To znači da je moguće da će se primjeniti postavke prozora iz svih aplikacija."
     487" Ako zaista ÅŸelite stvoriti općenite postavke, preporučamo vam da barem "
     488"ograničite tipove prozora kako bi izbjegli posebne tipove."
    402489
    403490#. +> trunk stable
     
    408495#. +> trunk stable
    409496#: ruleswidget.cpp:743
    410 msgid "This configuration dialog allows altering settings only for the selected window or application. Find the setting you want to affect, enable the setting using the checkbox, select in what way the setting should be affected and to which value."
    411 msgstr "Ovaj konfiguracijski dijalog dopuÅ¡ta vam promjenu postavki samo za odabraog prozora ili aplikacije. Pronađite postavku koju ÅŸelite promijeniti, omogućite postavku preko odabirnog okvira, odredite na koji način će postavka viti primjenjena i na koju vrijednost."
     497msgid ""
     498"This configuration dialog allows altering settings only for the selected "
     499"window or application. Find the setting you want to affect, enable the "
     500"setting using the checkbox, select in what way the setting should be affected "
     501"and to which value."
     502msgstr ""
     503"Ovaj konfiguracijski dijalog dopuÅ¡ta vam promjenu postavki samo za odabraog "
     504"prozora ili aplikacije. Pronađite postavku koju ÅŸelite promijeniti, omogućite "
     505"postavku preko odabirnog okvira, odredite na koji način će postavka viti "
     506"primjenjena i na koju vrijednost."
    412507
    413508#. +> trunk stable
     
    424519#. +> trunk stable
    425520#: ruleswidgetbase.ui:21
    426 #, fuzzy
    427521msgid "&Window matching"
    428 msgstr "Prebacivanje prozora"
     522msgstr "P&rozor kojem se podudara"
    429523
    430524#. i18n: ectx: property (text), widget (QLabel, textLabel1)
     
    437531#. +> trunk stable
    438532#: ruleswidgetbase.ui:46
    439 #, fuzzy
    440533#| msgid "Window &class (application type):"
    441534msgid "Window &class (application):"
    442 msgstr "&Klasa prozora (tip aplikacije):"
     535msgstr "Klasa prozora (aplika&cija):"
    443536
    444537#. i18n: ectx: property (text), item, widget (KComboBox, wmclass_match)
     
    536629#. +> trunk stable
    537630#: ruleswidgetbase.ui:381
    538 #, fuzzy
    539631msgid "s delay"
    540 msgstr "Bez odgode"
     632msgstr "s-zadrÅ¡ka"
    541633
    542634#. i18n: ectx: property (text), item, widget (QListWidget, types)
    543635#. +> trunk stable
    544636#: ruleswidgetbase.ui:524
    545 #, fuzzy
    546637msgid "Unmanaged Window"
    547 msgstr "Nije pod kontrolom upravitelja mreÅŸe"
     638msgstr "Slobodan prozor"
    548639
    549640#. i18n: ectx: attribute (title), widget (QWidget, TabPage3)
    550641#. +> trunk stable
    551642#: ruleswidgetbase.ui:545
    552 #, fuzzy
    553643msgid "&Size && Position"
    554 msgstr "PoloÅŸaj teksta"
     644msgstr "&Veličina && poloÅŸaj"
    555645
    556646#. i18n: ectx: property (text), widget (QCheckBox, enable_position)
     
    780870#: ruleswidgetbase.ui:598
    781871msgid "x,y"
    782 msgstr ""
     872msgstr "x,y"
    783873
    784874#. i18n: ectx: property (validChars), widget (KRestrictedLine, position)
     
    803893#. +> trunk stable
    804894#: ruleswidgetbase.ui:655 ruleswidgetbase.ui:1058 ruleswidgetbase.ui:1205
    805 #, fuzzy
    806895msgid "width,height"
    807 msgstr "visina"
     896msgstr "Å¡irina,visina"
    808897
    809898#. i18n: ectx: property (text), widget (QCheckBox, enable_maximizehoriz)
     
    846935#. +> trunk stable
    847936#: ruleswidgetbase.ui:891
    848 #, fuzzy
    849937msgid "Initial p&lacement"
    850 msgstr "Početna količina"
     938msgstr "Početni po&loÅŸaj"
    851939
    852940#. i18n: ectx: property (text), item, widget (KComboBox, placement)
     
    9521040#. +> trunk stable
    9531041#: ruleswidgetbase.ui:1280
    954 #, fuzzy
    9551042msgid "Obey geometry restrictions"
    956 msgstr "Makni filter"
     1043msgstr "Strogo prati geometrijska ograničenja"
    9571044
    9581045#. i18n: ectx: attribute (title), widget (QWidget, TabPage4)
    9591046#. +> trunk stable
    9601047#: ruleswidgetbase.ui:1313
    961 #, fuzzy
    9621048msgid "&Arrangement && Access"
    963 msgstr "RazmjeÅ¡taj"
     1049msgstr "R&azmjeÅ¡taj && pristup"
    9641050
    9651051#. i18n: ectx: property (text), widget (QCheckBox, enable_above)
     
    10141100#. +> trunk stable
    10151101#: ruleswidgetbase.ui:1606
    1016 #, fuzzy
    10171102msgid "Window shall (not) appear in the taskbar."
    1018 msgstr "Prozor se neće pojaviti na traci sa zadacima"
     1103msgstr "Prozor se (ne) smije pojaviti u traci sa zadacima."
    10191104
    10201105#. i18n: ectx: property (text), widget (QCheckBox, enable_skiptaskbar)
     
    10291114msgid "Window shall (not) appear in the manager for virtual desktops"
    10301115msgstr ""
     1116"Prozor se (ne) smije pojaviti u upravitelju za virtualne radne povrÅ¡ine"
    10311117
    10321118#. i18n: ectx: property (text), widget (QCheckBox, enable_skippager)
     
    10401126#: ruleswidgetbase.ui:1707
    10411127msgid "Window shall (not) appear in the Alt+Tab list"
    1042 msgstr ""
     1128msgstr "Prozor se (ne) smije pojaviti u listi Alt+Tab"
    10431129
    10441130#. i18n: ectx: property (text), widget (QCheckBox, enable_skipswitcher)
     
    10631149#. +> trunk stable
    10641150#: ruleswidgetbase.ui:1907
    1065 #, fuzzy
    10661151msgid "Appearance && &Fixes"
    1067 msgstr "Vrijeme pojavljivanja:"
     1152msgstr "Izgled && &popravci"
    10681153
    10691154#. i18n: ectx: property (text), widget (QCheckBox, enable_noborder)
    10701155#. +> trunk stable
    10711156#: ruleswidgetbase.ui:1913
    1072 #, fuzzy
    10731157msgid "&No titlebar and frame"
    1074 msgstr "Naslovna traka i okvir"
     1158msgstr "Bez &naslovne trake i okvira"
    10751159
    10761160#. i18n: ectx: property (text), widget (QCheckBox, enable_opacityactive)
    10771161#. +> trunk stable
    10781162#: ruleswidgetbase.ui:1964
    1079 #, fuzzy
    10801163#| msgid "A&ctive opacity in %"
    10811164msgid "A&ctive opacity"
    1082 msgstr "A&ktivna neprozirnost u %"
     1165msgstr "A&ktivna neprozirnost"
    10831166
    10841167#. i18n: ectx: property (suffix), widget (QSpinBox, opacityactive)
     
    10861169#. +> trunk stable
    10871170#: ruleswidgetbase.ui:1996 ruleswidgetbase.ui:2041
    1088 #, fuzzy, no-c-format
     1171#, no-c-format
    10891172msgid "%"
    10901173msgstr "%"
     
    10931176#. +> trunk stable
    10941177#: ruleswidgetbase.ui:2009
    1095 #, fuzzy
    10961178#| msgid "I&nactive opacity in %"
    10971179msgid "I&nactive opacity"
    1098 msgstr "&Neaktivna neprozirnost u %"
     1180msgstr "&Neaktivna neprozirnost"
    10991181
    11001182#. i18n: ectx: property (text), widget (QCheckBox, enable_moveresizemode)
     
    11361218#. +> trunk stable
    11371219#: ruleswidgetbase.ui:2148
    1138 #, fuzzy
    11391220#| msgid "Block global shortcuts"
    11401221msgid "Ignore global shortcuts"
    1141 msgstr "Blokiraj opće prečace"
     1222msgstr "Ignoriraj globalne prečace"
    11421223
    11431224#. i18n: ectx: property (text), widget (QCheckBox, enable_closeable)
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmlocale.po

    r1124 r1129  
    1313"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    1414"POT-Creation-Date: 2011-07-10 07:56+0200\n"
    15 "PO-Revision-Date: 2011-05-03 01:03+0200\n"
     15"PO-Revision-Date: 2011-07-12 17:05+0200\n"
    1616"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
    1717"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
     
    2020"Content-Transfer-Encoding: 8bit\n"
    2121"Language: hr\n"
    22 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     22"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     23"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    2324"X-Generator: Lokalize 1.2\n"
    2425"X-Environment: kde\n"
     
    2930msgctxt "NAME OF TRANSLATORS"
    3031msgid "Your names"
    31 msgstr "Dario Lah, Denis Lackovic, Vlatko Kosturjak, Oliver Mucafir, Andrej Dundović, Marko DimjaÅ¡ević"
     32msgstr ""
     33"Dario Lah, Denis Lackovic, Vlatko Kosturjak, Oliver Mucafir, Andrej Dundović, "
     34"Marko DimjaÅ¡ević"
    3235
    3336#. +> trunk stable
    3437msgctxt "EMAIL OF TRANSLATORS"
    3538msgid "Your emails"
    36 msgstr "lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, oliver.untwist@gmail.com, adundovi@gmail.com, marko@dimjasevic.net"
     39msgstr ""
     40"lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, oliver."
     41"untwist@gmail.com, adundovi@gmail.com, marko@dimjasevic.net"
    3742
    3843#. +> trunk stable
     
    7580#: kcmlocale.cpp:462
    7681#, kde-format
    77 msgid "You have the language with code '%1' in your list of languages to use for translation but the localization files for it could not be found. The language has been removed from your configuration. If you want to add it again please install the localization files for it and add the language again."
    78 msgstr "U VaÅ¡oj listi jezika za prijevod imate jezik s kÃŽdom '%1', no nije moguće pronaći lokalizacijske datoteke za dotični jezik. Taj je jezik uklonjen iz VaÅ¡e konfiguracije. Ako ga ÅŸelite ponovno dodati, instalirajte lokalizacijske datoteke za taj jezik i ponovno ga dodajte."
     82msgid ""
     83"You have the language with code '%1' in your list of languages to use for "
     84"translation but the localization files for it could not be found. The "
     85"language has been removed from your configuration. If you want to add it "
     86"again please install the localization files for it and add the language again."
     87msgstr ""
     88"U VaÅ¡oj listi jezika za prijevod imate jezik s kÃŽdom '%1', no nije moguće "
     89"pronaći lokalizacijske datoteke za dotični jezik. Taj je jezik uklonjen iz "
     90"VaÅ¡e konfiguracije. Ako ga ÅŸelite ponovno dodati, instalirajte lokalizacijske "
     91"datoteke za taj jezik i ponovno ga dodajte."
    7992
    8093#. +> trunk stable
     
    8497"To change the language of all programs, you will have to logout first."
    8598msgstr ""
    86 "Promijenjene jezične postavke primijenjuju se samo na novo pokrenute aplikacije.\n"
     99"Promijenjene jezične postavke primijenjuju se samo na novo pokrenute "
     100"aplikacije.\n"
    87101"Ako ÅŸelite promijeniti jezik u svim programima morate se prvo odjaviti."
    88102
     
    96110msgid ""
    97111"<h1>Country/Region & Language</h1>\n"
    98 "<p>Here you can set your localization settings such as language, numeric formats, date and time formats, etc.  Choosing a country will load a set of default formats which you can then change to your personal preferences.  These personal preferences will remain set even if you change the country.  The reset buttons allow you to easily see where you have personal settings and to restore those items to the country's default value.</p>"
     112"<p>Here you can set your localization settings such as language, numeric "
     113"formats, date and time formats, etc.  Choosing a country will load a set of "
     114"default formats which you can then change to your personal preferences.  "
     115"These personal preferences will remain set even if you change the country.  "
     116"The reset buttons allow you to easily see where you have personal settings "
     117"and to restore those items to the country's default value.</p>"
    99118msgstr ""
    100119"<h1>Zemlja i jezik</h1>\n"
    101 "<p>Ovdje moÅŸete postaviti vaÅ¡e lokalizacijske postavke kao Å¡to su jezik, brojčani formati, formati datuma i vremena itd. Odabir zemlje će učitati skup zadanih formata koje moÅŸete prilagoditi vlastitim ÅŸeljama i one će biti zapamćene i kad promijenite zemlju. Gumbi za povratak na uobičajeno omogućuju Vam da lako uočite gdje imate prilagođene postavke i da ih vratite na zadane vrijednosti za određenu zemlju.</p>"
     120"<p>Ovdje moÅŸete postaviti vaÅ¡e lokalizacijske postavke kao Å¡to su jezik, "
     121"brojčani formati, formati datuma i vremena itd. Odabir zemlje će učitati skup "
     122"zadanih formata koje moÅŸete prilagoditi vlastitim ÅŸeljama i one će biti "
     123"zapamćene i kad promijenite zemlju. Gumbi za povratak na uobičajeno omogućuju "
     124"Vam da lako uočite gdje imate prilagođene postavke i da ih vratite na zadane "
     125"vrijednosti za određenu zemlju.</p>"
    102126
    103127#. +> trunk stable
     
    233257#. +> trunk stable
    234258#: kcmlocale.cpp:1072
    235 msgid "<p>This is the country where you live.  The KDE Workspace will use the settings for this country or region.</p>"
    236 msgstr "<p>Ovo je drÅŸava u kojoj ÅŸivite.  KDE-ov radni prostor će koristiti postavke za ovu drÅŸavu ili regiju.</p>"
     259msgid ""
     260"<p>This is the country where you live.  The KDE Workspace will use the "
     261"settings for this country or region.</p>"
     262msgstr ""
     263"<p>Ovo je drÅŸava u kojoj ÅŸivite.  KDE-ov radni prostor će koristiti postavke "
     264"za ovu drÅŸavu ili regiju.</p>"
    237265
    238266#. +> trunk stable
     
    256284#. +> trunk stable
    257285#: kcmlocale.cpp:1132
    258 msgid "<p>This is the country subdivision where you live, e.g. your state or province.  The KDE Workspace will use this setting for local information services such as holidays.</p>"
    259 msgstr "<p>Ovo je podrazred drÅŸava gdje ÅŸivite, npr. savezna drÅŸava ili pokrajina.  KDE-ov radni prostor će koristiti ove postavke za servise za lokalne informacije kao Å¡to su praznici.</p>"
     286msgid ""
     287"<p>This is the country subdivision where you live, e.g. your state or "
     288"province.  The KDE Workspace will use this setting for local information "
     289"services such as holidays.</p>"
     290msgstr ""
     291"<p>Ovo je podrazred drÅŸava gdje ÅŸivite, npr. savezna drÅŸava ili pokrajina.  "
     292"KDE-ov radni prostor će koristiti ove postavke za servise za lokalne "
     293"informacije kao Å¡to su praznici.</p>"
    260294
    261295#. i18n: ectx: property (availableLabel), widget (KActionSelector, m_selectTranslations)
     
    267301#. +> trunk stable
    268302#: kcmlocale.cpp:1170
    269 msgid "<p>This is the list of installed KDE Workspace language translations not currently being used.  To use a language translation move it to the 'Preferred Languages' list in the order of preference.  If no suitable languages are listed, then you may need to install more language packages using your usual installation method.</p>"
    270 msgstr "<p>Ovo je lista instaliranih prijevoda KDE-ovog radnog prostora koji se trenutno ne koriste. Kako biste koristili neki jezik, premjestite ga u listu 'Preferirani jezici' na ÅŸeljeno mjesto. Ako nije naveden ni jedan Vama prikladan jezik, moÅŸda ćete trebati instalirati dodatne jezične pakete koristeći uobičajeni instalacijski postupak.</p>"
     303msgid ""
     304"<p>This is the list of installed KDE Workspace language translations not "
     305"currently being used.  To use a language translation move it to the "
     306"'Preferred Languages' list in the order of preference.  If no suitable "
     307"languages are listed, then you may need to install more language packages "
     308"using your usual installation method.</p>"
     309msgstr ""
     310"<p>Ovo je lista instaliranih prijevoda KDE-ovog radnog prostora koji se "
     311"trenutno ne koriste. Kako biste koristili neki jezik, premjestite ga u listu "
     312"'Preferirani jezici' na ÅŸeljeno mjesto. Ako nije naveden ni jedan Vama "
     313"prikladan jezik, moÅŸda ćete trebati instalirati dodatne jezične pakete "
     314"koristeći uobičajeni instalacijski postupak.</p>"
    271315
    272316#. i18n: ectx: property (selectedLabel), widget (KActionSelector, m_selectTranslations)
     
    278322#. +> trunk stable
    279323#: kcmlocale.cpp:1180
    280 msgid "<p>This is the list of installed KDE Workspace language translations currently being used, listed in order of preference.  If a translation is not available for the first language in the list, the next language will be used.  If no other translations are available then US English will be used.</p>"
    281 msgstr "<p>Ovo je lista instaliranih prijevoda KDE-ovog radnog prostora koji se trenutno koriste, navedenih ÅŸeljenim redoslijedom. Ako nije dostupan prijevod za prvi jezik u listi, koristit će se sljedeći jezik. Ako nije dostupan ni jedan drugi prijevod, koristit će se američki engleski.</p>"
     324msgid ""
     325"<p>This is the list of installed KDE Workspace language translations "
     326"currently being used, listed in order of preference.  If a translation is not "
     327"available for the first language in the list, the next language will be used. "
     328" If no other translations are available then US English will be used.</p>"
     329msgstr ""
     330"<p>Ovo je lista instaliranih prijevoda KDE-ovog radnog prostora koji se "
     331"trenutno koriste, navedenih ÅŸeljenim redoslijedom. Ako nije dostupan prijevod "
     332"za prvi jezik u listi, koristit će se sljedeći jezik. Ako nije dostupan ni "
     333"jedan drugi prijevod, koristit će se američki engleski.</p>"
    282334
    283335#. +> trunk stable
     
    304356#: kcmlocale.cpp:1300 kcmlocale.cpp:1754 kcmlocalewidget.ui:163
    305357#: kcmlocalewidget.ui:524
    306 #, fuzzy
    307358msgid "Digit grouping:"
    308 msgstr "svetlosna grupa"
     359msgstr "Grupiranje znamenki:"
    309360
    310361#. +> trunk stable
     
    312363#, fuzzy
    313364#| msgid "<p>Here you can define the digit group separator used to display numbers.</p><p>Note that the digit group separator used to display monetary values has to be set separately (see the 'Money' tab).</p>"
    314 msgid "<p>Here you can define the digit grouping used to display numbers.</p><p>Note that the digit grouping used to display monetary values has to be set separately (see the 'Money' tab).</p>"
    315 msgstr "<p>Ovdje moÅŸete odrediti razdjelnicu grupa znamenki za prikaz brojeva.</p><p>Primijetite da razdjelnik grupa znamenki za prikaz novčanih vrijednosti treba podesiti posebno (vidjeti karticu 'Novac').</p>"
     365msgid ""
     366"<p>Here you can define the digit grouping used to display numbers.</p><p>Note "
     367"that the digit grouping used to display monetary values has to be set "
     368"separately (see the 'Money' tab).</p>"
     369msgstr ""
     370"<p>Ovdje moÅŸete odrediti razdjelnicu grupa znamenki za prikaz brojeva.</p><p>"
     371"Primijetite da razdjelnik grupa znamenki za prikaz novčanih vrijednosti treba "
     372"podesiti posebno (vidjeti karticu 'Novac').</p>"
    316373
    317374#. i18n: ectx: property (text), widget (QLabel, m_labelThousandsSeparator)
     
    325382#. +> trunk stable
    326383#: kcmlocale.cpp:1339
    327 msgid "<p>Here you can define the digit group separator used to display numbers.</p><p>Note that the digit group separator used to display monetary values has to be set separately (see the 'Money' tab).</p>"
    328 msgstr "<p>Ovdje moÅŸete odrediti razdjelnicu grupa znamenki za prikaz brojeva.</p><p>Primijetite da razdjelnik grupa znamenki za prikaz novčanih vrijednosti treba podesiti posebno (vidjeti karticu 'Novac').</p>"
     384msgid ""
     385"<p>Here you can define the digit group separator used to display numbers.</p>"
     386"<p>Note that the digit group separator used to display monetary values has to "
     387"be set separately (see the 'Money' tab).</p>"
     388msgstr ""
     389"<p>Ovdje moÅŸete odrediti razdjelnicu grupa znamenki za prikaz brojeva.</p><p>"
     390"Primijetite da razdjelnik grupa znamenki za prikaz novčanih vrijednosti treba "
     391"podesiti posebno (vidjeti karticu 'Novac').</p>"
    329392
    330393#. i18n: ectx: property (text), widget (QLabel, m_labelDecimalSymbol)
     
    338401#. +> trunk stable
    339402#: kcmlocale.cpp:1396
    340 msgid "<p>Here you can define the decimal separator used to display numbers (i.e. a dot or a comma in most countries).</p><p>Note that the decimal separator used to display monetary values has to be set separately (see the 'Money' tab).</p>"
    341 msgstr "<p>Ovdje moÅŸete odrediti decimalnu razdjelnicu za prikaz brojeva (točka ili zarez u mnogim zemljama).</p><p>Primijetite da decimalna razdjelnica za prikaz novčanih vrijednosti valja definirati posebno (vidjeti karticu 'Novac').</p>"
     403msgid ""
     404"<p>Here you can define the decimal separator used to display numbers (i.e. a "
     405"dot or a comma in most countries).</p><p>Note that the decimal separator used "
     406"to display monetary values has to be set separately (see the 'Money' tab).</p>"
     407msgstr ""
     408"<p>Ovdje moÅŸete odrediti decimalnu razdjelnicu za prikaz brojeva (točka ili "
     409"zarez u mnogim zemljama).</p><p>Primijetite da decimalna razdjelnica za "
     410"prikaz novčanih vrijednosti valja definirati posebno (vidjeti karticu "
     411"'Novac').</p>"
    342412
    343413#. i18n: ectx: property (text), widget (QLabel, m_labelDecimalPlaces)
     
    351421#. +> trunk stable
    352422#: kcmlocale.cpp:1447
    353 msgid "<p>Here you can set the number of decimal places displayed for numeric values, i.e. the number of digits <em>after</em> the decimal separator.</p><p>Note that the decimal places used to display monetary values has to be set separately (see the 'Money' tab).</p>"
    354 msgstr "<p>Ovdje moÅŸete postaviti broj decimalnih mjesta za prikaz brojčanih vrijednosti, odnosno broj znamenki <em>nakon</em> decimalne razdjelnice.</p><p>Primijetite da decimalna mjesta za prikaz novčanih vrijednosti valja podesiti posebno (vidjeti karticu 'Novac').</p>"
     423msgid ""
     424"<p>Here you can set the number of decimal places displayed for numeric "
     425"values, i.e. the number of digits <em>after</em> the decimal separator.</p><p>"
     426"Note that the decimal places used to display monetary values has to be set "
     427"separately (see the 'Money' tab).</p>"
     428msgstr ""
     429"<p>Ovdje moÅŸete postaviti broj decimalnih mjesta za prikaz brojčanih "
     430"vrijednosti, odnosno broj znamenki <em>nakon</em> decimalne razdjelnice.</p><"
     431"p>Primijetite da decimalna mjesta za prikaz novčanih vrijednosti valja "
     432"podesiti posebno (vidjeti karticu 'Novac').</p>"
    355433
    356434#. i18n: ectx: property (text), widget (QLabel, m_labelPositiveFormat)
     
    362440#. +> trunk stable
    363441#: kcmlocale.cpp:1485
    364 msgid "<p>Here you can specify text used to prefix positive numbers. Most locales leave this blank.</p><p>Note that the positive sign used to display monetary values has to be set separately (see the 'Money' tab).</p>"
    365 msgstr "<p>Ovdje moÅŸete navesti tekst koji će biti prefiks pozitivnim brojevima. Većina zemalja ima prazan tekst.</p><p>Primijetite da pozitivni predznak za prikaz novčanih vrijednosti valja postavitiposebno (vidjeti karticu 'Novac').</p>"
     442msgid ""
     443"<p>Here you can specify text used to prefix positive numbers. Most locales "
     444"leave this blank.</p><p>Note that the positive sign used to display monetary "
     445"values has to be set separately (see the 'Money' tab).</p>"
     446msgstr ""
     447"<p>Ovdje moÅŸete navesti tekst koji će biti prefiks pozitivnim brojevima. "
     448"Većina zemalja ima prazan tekst.</p><p>Primijetite da pozitivni predznak za "
     449"prikaz novčanih vrijednosti valja postavitiposebno (vidjeti karticu 'Novac')."
     450"</p>"
    366451
    367452#. +> trunk stable
     
    379464#. +> trunk stable
    380465#: kcmlocale.cpp:1542
    381 msgid "<p>Here you can specify text used to prefix negative numbers. This should not be empty, so you can distinguish positive and negative numbers. It is normally set to minus (-).</p><p>Note that the negative sign used to display monetary values has to be set separately (see the 'Money' tab).</p>"
    382 msgstr "<p>Ovdje moÅŸete navesti tekst koji će biti prefiks negativnim brojevima. Ovo ne bi smjelo biti prazno kako biste mogli razlikovati pozitivne od negativnih brojeva. Obično se postavlja minus (-).</p><p>Primijetite da negativni predznak za prikaz novčanih vrijednosti valja postaviti posebno (vidjeti karticu 'Novac').</p>"
     466msgid ""
     467"<p>Here you can specify text used to prefix negative numbers. This should not "
     468"be empty, so you can distinguish positive and negative numbers. It is "
     469"normally set to minus (-).</p><p>Note that the negative sign used to display "
     470"monetary values has to be set separately (see the 'Money' tab).</p>"
     471msgstr ""
     472"<p>Ovdje moÅŸete navesti tekst koji će biti prefiks negativnim brojevima. Ovo "
     473"ne bi smjelo biti prazno kako biste mogli razlikovati pozitivne od negativnih "
     474"brojeva. Obično se postavlja minus (-).</p><p>Primijetite da negativni "
     475"predznak za prikaz novčanih vrijednosti valja postaviti posebno (vidjeti "
     476"karticu 'Novac').</p>"
    383477
    384478#. +> trunk stable
     
    399493#. +> trunk stable
    400494#: kcmlocale.cpp:1596
    401 msgid "<p>Here you can define the set of digits used to display numbers. If digits other than Arabic are selected, they will appear only if used in the language of the application or the piece of text where the number is shown.</p> <p>Note that the set of digits used to display monetary values has to be set separately (see the 'Money' tab).</p>"
    402 msgstr "<p>Ovdje moÅŸete odrediti brojevni sustav za prikaz brojeva. Ako je izabran nearapski brojevni sustav, prikazat će se samo ako je koriÅ¡ten u jeziku aplikacije ili dijelu teksta u kojem je prikazan broj.</p> <p>Primijetite da brojevni sustav za prikaz novčanih vrijednosti valja definirati posebno (vidjeti karticu 'Novac').</p>"
     495msgid ""
     496"<p>Here you can define the set of digits used to display numbers. If digits "
     497"other than Arabic are selected, they will appear only if used in the language "
     498"of the application or the piece of text where the number is shown.</p> <p>"
     499"Note that the set of digits used to display monetary values has to be set "
     500"separately (see the 'Money' tab).</p>"
     501msgstr ""
     502"<p>Ovdje moÅŸete odrediti brojevni sustav za prikaz brojeva. Ako je izabran "
     503"nearapski brojevni sustav, prikazat će se samo ako je koriÅ¡ten u jeziku "
     504"aplikacije ili dijelu teksta u kojem je prikazan broj.</p> <p>Primijetite da "
     505"brojevni sustav za prikaz novčanih vrijednosti valja definirati posebno "
     506"(vidjeti karticu 'Novac').</p>"
    403507
    404508#. i18n: ectx: property (text), widget (QLabel, m_labelCurrencyCode)
     
    410514#. +> trunk stable
    411515#: kcmlocale.cpp:1637
    412 msgid "<p>Here you can choose the currency to be used when displaying monetary values, e.g. United States Dollar or Pound Sterling.</p>"
    413 msgstr "<p>Ovdje moÅŸete odabrati valutu za prikaznovčanih vrijednosti, npr. dolar Sjedinjenih DrÅŸava ili funta Ujedinjenog Kraljevstva.</p>"
     516msgid ""
     517"<p>Here you can choose the currency to be used when displaying monetary "
     518"values, e.g. United States Dollar or Pound Sterling.</p>"
     519msgstr ""
     520"<p>Ovdje moÅŸete odabrati valutu za prikaznovčanih vrijednosti, npr. dolar "
     521"Sjedinjenih DrÅŸava ili funta Ujedinjenog Kraljevstva.</p>"
    414522
    415523#. +> trunk stable
     
    428536#. +> trunk stable
    429537#: kcmlocale.cpp:1698
    430 msgid "<p>Here you can choose the symbol to be used when displaying monetary values, e.g. $, US$ or USD.</p>"
    431 msgstr "<p>Ovdje moÅŸete odabrati simbol za prikaz novčanih vrijednosti, npr. $, US$ ili USD.</p>"
     538msgid ""
     539"<p>Here you can choose the symbol to be used when displaying monetary values, "
     540"e.g. $, US$ or USD.</p>"
     541msgstr ""
     542"<p>Ovdje moÅŸete odabrati simbol za prikaz novčanih vrijednosti, npr. $, US$ "
     543"ili USD.</p>"
    432544
    433545#. +> trunk stable
     
    435547#, fuzzy
    436548#| msgid "<p>Here you can define the decimal separator used to display monetary values.</p><p>Note that the decimal separator used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>"
    437 msgid "<p>Here you can define the digit grouping used to display monetary values.</p><p>Note that the digit grouping used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>"
    438 msgstr "<p>Ovdje moÅŸete definirati decimalnu razdjelnicu za prikaz novčanih vrijednosti.</p><p>Primijetite da decimalnu razdjelnicu za prikaz drugih brojeva treba podesiti posebno (vidjeti karticu 'Brojevi').</p>"
     549msgid ""
     550"<p>Here you can define the digit grouping used to display monetary values.</p>"
     551"<p>Note that the digit grouping used to display other numbers has to be "
     552"defined separately (see the 'Numbers' tab).</p>"
     553msgstr ""
     554"<p>Ovdje moÅŸete definirati decimalnu razdjelnicu za prikaz novčanih "
     555"vrijednosti.</p><p>Primijetite da decimalnu razdjelnicu za prikaz drugih "
     556"brojeva treba podesiti posebno (vidjeti karticu 'Brojevi').</p>"
    439557
    440558#. +> trunk stable
    441559#: kcmlocale.cpp:1794
    442 msgid "<p>Here you can define the group separator used to display monetary values.</p><p>Note that the thousands separator used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>"
    443 msgstr "<p>Ovdje moÅŸete definirati razdjelnicu grupa za prikaz novčanih vrijednosti.</p><p>Primijetite da razdjelnica tisuća za prikaz drugih brojeva treba definirati posebno (vidjeti karticu 'Brojevi').</p>"
     560msgid ""
     561"<p>Here you can define the group separator used to display monetary values.<"
     562"/p><p>Note that the thousands separator used to display other numbers has to "
     563"be defined separately (see the 'Numbers' tab).</p>"
     564msgstr ""
     565"<p>Ovdje moÅŸete definirati razdjelnicu grupa za prikaz novčanih vrijednosti.<"
     566"/p><p>Primijetite da razdjelnica tisuća za prikaz drugih brojeva treba "
     567"definirati posebno (vidjeti karticu 'Brojevi').</p>"
    444568
    445569#. +> trunk stable
    446570#: kcmlocale.cpp:1849
    447 msgid "<p>Here you can define the decimal separator used to display monetary values.</p><p>Note that the decimal separator used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>"
    448 msgstr "<p>Ovdje moÅŸete definirati decimalnu razdjelnicu za prikaz novčanih vrijednosti.</p><p>Primijetite da decimalnu razdjelnicu za prikaz drugih brojeva treba podesiti posebno (vidjeti karticu 'Brojevi').</p>"
     571msgid ""
     572"<p>Here you can define the decimal separator used to display monetary values."
     573"</p><p>Note that the decimal separator used to display other numbers has to "
     574"be defined separately (see the 'Numbers' tab).</p>"
     575msgstr ""
     576"<p>Ovdje moÅŸete definirati decimalnu razdjelnicu za prikaz novčanih "
     577"vrijednosti.</p><p>Primijetite da decimalnu razdjelnicu za prikaz drugih "
     578"brojeva treba podesiti posebno (vidjeti karticu 'Brojevi').</p>"
    449579
    450580#. +> trunk stable
    451581#: kcmlocale.cpp:1902
    452 msgid "<p>Here you can set the number of decimal places displayed for monetary values, i.e. the number of digits <em>after</em> the decimal separator.</p><p>Note that the decimal places used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>"
    453 msgstr "<p>Ovdje moÅŸete postaviti broj decimalnih mjesta za prikaz novčanih vrijednosti, odnosno broj znamenki <em>nakon</em> decimalne razdjelnice.</p><p>Primijetite da decimalna mjesta za prikaz drugih brojeva treba definirati posebno (vidjeti karticu 'Brojevi').</p>"
     582msgid ""
     583"<p>Here you can set the number of decimal places displayed for monetary "
     584"values, i.e. the number of digits <em>after</em> the decimal separator.</p><p>"
     585"Note that the decimal places used to display other numbers has to be defined "
     586"separately (see the 'Numbers' tab).</p>"
     587msgstr ""
     588"<p>Ovdje moÅŸete postaviti broj decimalnih mjesta za prikaz novčanih "
     589"vrijednosti, odnosno broj znamenki <em>nakon</em> decimalne razdjelnice.</p><"
     590"p>Primijetite da decimalna mjesta za prikaz drugih brojeva treba definirati "
     591"posebno (vidjeti karticu 'Brojevi').</p>"
    454592
    455593#. i18n: ectx: property (text), widget (QLabel, m_labelMonetaryPositiveFormat)
     
    461599#. +> trunk stable
    462600#: kcmlocale.cpp:1953
    463 msgid "<p>Here you can set the format of positive monetary values.</p><p>Note that the positive sign used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>"
    464 msgstr "<p>Ovdje moÅŸete postaviti format pozitivnih novčanih vrijednosti.</p><p>Primijetite da pozitivni predznak za prikaz drugih brojeva valja definirati posebno (vidjeti karticu 'Brojevi').</p>"
     601msgid ""
     602"<p>Here you can set the format of positive monetary values.</p><p>Note that "
     603"the positive sign used to display other numbers has to be defined separately "
     604"(see the 'Numbers' tab).</p>"
     605msgstr ""
     606"<p>Ovdje moÅŸete postaviti format pozitivnih novčanih vrijednosti.</p><p>"
     607"Primijetite da pozitivni predznak za prikaz drugih brojeva valja definirati "
     608"posebno (vidjeti karticu 'Brojevi').</p>"
    465609
    466610#. +> trunk stable
     
    496640#. +> trunk stable
    497641#: kcmlocale.cpp:2010
    498 msgid "Here you can select how a positive sign will be positioned. This only affects monetary values."
    499 msgstr "Ovdje birate kako će znak za pozitivno biti postavljen. Ovdje podeÅ¡eno će ujtecati samo na novčane vrijednosti."
     642msgid ""
     643"Here you can select how a positive sign will be positioned. This only affects "
     644"monetary values."
     645msgstr ""
     646"Ovdje birate kako će znak za pozitivno biti postavljen. Ovdje podeÅ¡eno će "
     647"ujtecati samo na novčane vrijednosti."
    500648
    501649#. +> trunk stable
     
    506654#. +> trunk stable
    507655#: kcmlocale.cpp:2014
    508 msgid "If this option is checked, the currency sign will be prefixed (i.e. to the left of the value) for all positive monetary values. If not, it will be postfixed (i.e. to the right)."
    509 msgstr "Ako ovdje odaberete, znak valute će se pisati kao prefix (slijeva) za sve pozitivne vrijednosti novca. U suprotnom, on će biti zdesna."
     656msgid ""
     657"If this option is checked, the currency sign will be prefixed (i.e. to the "
     658"left of the value) for all positive monetary values. If not, it will be "
     659"postfixed (i.e. to the right)."
     660msgstr ""
     661"Ako ovdje odaberete, znak valute će se pisati kao prefix (slijeva) za sve "
     662"pozitivne vrijednosti novca. U suprotnom, on će biti zdesna."
    510663
    511664#. i18n: ectx: property (text), widget (QLabel, m_labelMonetaryNegativeFormat)
     
    517670#. +> trunk stable
    518671#: kcmlocale.cpp:2108
    519 msgid "<p>Here you can set the format of negative monetary values.</p><p>Note that the negative sign used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>"
    520 msgstr "<p>Ovdje moÅŸete postaviti format negativnih novčanih vrijednosti.</p><p>Primijetite da negativnih predznak za prikaz drugih brojeva valja definirati posebno (vidjeti karticu 'Brojevi').</p>"
     672msgid ""
     673"<p>Here you can set the format of negative monetary values.</p><p>Note that "
     674"the negative sign used to display other numbers has to be defined separately "
     675"(see the 'Numbers' tab).</p>"
     676msgstr ""
     677"<p>Ovdje moÅŸete postaviti format negativnih novčanih vrijednosti.</p><p>"
     678"Primijetite da negativnih predznak za prikaz drugih brojeva valja definirati "
     679"posebno (vidjeti karticu 'Brojevi').</p>"
    521680
    522681#. +> trunk stable
    523682#: kcmlocale.cpp:2120
    524 msgid "Here you can select how a negative sign will be positioned. This only affects monetary values."
    525 msgstr "Ovdje moÅŸete odabrati smjeÅ¡taj znaka negativnosti. Ovo se odnosi samo na novačane vrijednosti."
     683msgid ""
     684"Here you can select how a negative sign will be positioned. This only affects "
     685"monetary values."
     686msgstr ""
     687"Ovdje moÅŸete odabrati smjeÅ¡taj znaka negativnosti. Ovo se odnosi samo na "
     688"novačane vrijednosti."
    526689
    527690#. +> trunk stable
    528691#: kcmlocale.cpp:2125
    529 msgid "If this option is checked, the currency sign will be prefixed (i.e. to the left of the value) for all negative monetary values. If not, it will be postfixed (i.e. to the right)."
    530 msgstr "Ako ovdje omogućite, znak za valutu će biti stavljen ispred (slijeva) negativnih novčanih vrijednosti. U surotnom, biti će stavljen straga (zdesna)."
     692msgid ""
     693"If this option is checked, the currency sign will be prefixed (i.e. to the "
     694"left of the value) for all negative monetary values. If not, it will be "
     695"postfixed (i.e. to the right)."
     696msgstr ""
     697"Ako ovdje omogućite, znak za valutu će biti stavljen ispred (slijeva) "
     698"negativnih novčanih vrijednosti. U surotnom, biti će stavljen straga (zdesna)."
    531699
    532700#. +> trunk stable
    533701#: kcmlocale.cpp:2215
    534 msgid "<p>Here you can define the set of digits used to display monetary values. If digits other than Arabic are selected, they will appear only if used in the language of the application or the piece of text where the number is shown.</p><p>Note that the set of digits used to display other numbers has to be defined separately (see the 'Numbers' tab).</p>"
    535 msgstr "<p>Ovdje moÅŸete odabrati brojevni sustav za prikaz novčanih vrijednosti. Ako je izabran nearapski brojevni sustav, pokazat će se ako je koriÅ¡ten u jeziku aplikacije ili dijelu teksta u kojem je prikazan broj.</p><p>Primijetite da brojevni sustav za prikaz drugih brojeva treba podesiti posebno (vidjeti karticu 'Brojevi').</p>"
     702msgid ""
     703"<p>Here you can define the set of digits used to display monetary values. If "
     704"digits other than Arabic are selected, they will appear only if used in the "
     705"language of the application or the piece of text where the number is shown.<"
     706"/p><p>Note that the set of digits used to display other numbers has to be "
     707"defined separately (see the 'Numbers' tab).</p>"
     708msgstr ""
     709"<p>Ovdje moÅŸete odabrati brojevni sustav za prikaz novčanih vrijednosti. Ako "
     710"je izabran nearapski brojevni sustav, pokazat će se ako je koriÅ¡ten u jeziku "
     711"aplikacije ili dijelu teksta u kojem je prikazan broj.</p><p>Primijetite da "
     712"brojevni sustav za prikaz drugih brojeva treba podesiti posebno (vidjeti "
     713"karticu 'Brojevi').</p>"
    536714
    537715#. i18n: ectx: property (text), widget (QLabel, m_labelCalendarSystem)
     
    544722#: kcmlocale.cpp:2258
    545723msgid "<p>Here you can set the Calendar System to use to display dates.</p>"
    546 msgstr "<p>Ovdje moÅŸete postaviti kalendarski sustav koji će se koristiti za prikaz datuma.</p>"
     724msgstr ""
     725"<p>Ovdje moÅŸete postaviti kalendarski sustav koji će se koristiti za prikaz "
     726"datuma.</p>"
    547727
    548728#. i18n: ectx: property (text), widget (QCheckBox, m_checkCalendarGregorianUseCommonEra)
     
    554734#. +> trunk stable
    555735#: kcmlocale.cpp:2314
    556 msgid "<p>This option determines if the Common Era (CE/BCE) should be used instead of the Christian Era (AD/BC).</p>"
    557 msgstr "<p>Ova opcija određuje da li se koristi \"NaÅ¡a era\" (CE/BCE) umjesto \"Kršćanska era\" (AD/BC).</p>"
     736msgid ""
     737"<p>This option determines if the Common Era (CE/BCE) should be used instead "
     738"of the Christian Era (AD/BC).</p>"
     739msgstr ""
     740"<p>Ova opcija određuje da li se koristi \"NaÅ¡a era\" (CE/BCE) umjesto "
     741"\"Kršćanska era\" (AD/BC).</p>"
    558742
    559743#. i18n: ectx: property (text), widget (QLabel, m_labelShortYearWindow)
     
    572756#. +> trunk stable
    573757#: kcmlocale.cpp:2359
    574 msgid "<p>This option determines what year range a two digit date is interpreted as, for example with a range of 1950 to 2049 the value 10 is interpreted as 2010.  This range is only applied when reading the Short Year (YY) date format.</p>"
    575 msgstr "<p>Ova opcija određuje koje se razdoblje godina podrazumijeva za dvije znamenke, npr. u razdoblju od 1950. do 2049. vrijednost 10. predstavlja 2010. godinu.  Ovo se koristi samo pri formatu kratkog prikaza godine (YY).</p>"
     758msgid ""
     759"<p>This option determines what year range a two digit date is interpreted as, "
     760"for example with a range of 1950 to 2049 the value 10 is interpreted as 2010. "
     761" This range is only applied when reading the Short Year (YY) date format.</p>"
     762msgstr ""
     763"<p>Ova opcija određuje koje se razdoblje godina podrazumijeva za dvije "
     764"znamenke, npr. u razdoblju od 1950. do 2049. vrijednost 10. predstavlja 2010. "
     765"godinu.  Ovo se koristi samo pri formatu kratkog prikaza godine (YY).</p>"
    576766
    577767#. i18n: ectx: property (text), widget (QLabel, m_labelWeekNumberSystem)
    578768#. +> trunk stable
    579769#: kcmlocale.cpp:2401 kcmlocalewidget.ui:938
    580 #, fuzzy
    581770#| msgid "Measure system:"
    582771msgid "Week number system:"
    583 msgstr "Mjerni sustav:"
     772msgstr "Sustav brojanja tjedana:"
    584773
    585774#. +> trunk
    586775#: kcmlocale.cpp:2402
    587 msgid "<p>This option determines how the Week Number will be calculated. There are four options available:</p> <ul><li><b>ISO Week</b> Use the ISO standard Week Number. This will always use Monday as the first day of the ISO week. This is the most commonly used system.</li><li><b>Full First Week</b> The first week of the year starts on the first occurrence of the <i>First day of the week</i>, and lasts for seven days.  Any days before Week 1 are considered part of the last week of the previous year. This system is most commonly used in the USA.</li><li><b>Partial First Week</b> The first week starts on the first day of the year. The second week of the year starts on the first occurrence of the <i>First day of the week</i>, and lasts for seven days. The first week may not contain seven days.</li><li><b>Simple Week</b> The first week starts on the first day of the year and lasts seven days, with all new weeks starting on the same weekday as the first day of the year.</li></ul>"
     776msgid ""
     777"<p>This option determines how the Week Number will be calculated. There are "
     778"four options available:</p> <ul><li><b>ISO Week</b> Use the ISO standard Week "
     779"Number. This will always use Monday as the first day of the ISO week. This is "
     780"the most commonly used system.</li><li><b>Full First Week</b> The first week "
     781"of the year starts on the first occurrence of the <i>First day of the week</i>"
     782", and lasts for seven days.  Any days before Week 1 are considered part of "
     783"the last week of the previous year. This system is most commonly used in the "
     784"USA.</li><li><b>Partial First Week</b> The first week starts on the first day "
     785"of the year. The second week of the year starts on the first occurrence of "
     786"the <i>First day of the week</i>, and lasts for seven days. The first week "
     787"may not contain seven days.</li><li><b>Simple Week</b> The first week starts "
     788"on the first day of the year and lasts seven days, with all new weeks "
     789"starting on the same weekday as the first day of the year.</li></ul>"
    588790msgstr ""
    589791
    590792#. +> stable
    591793#: kcmlocale.cpp:2402
    592 msgid "<p>This option determines how the Week Number will be calculated. There are four options available:</p> <ul><li><b>ISO Week</b> Use the ISO standard Week Number. This will always use Monday as the first day of the ISO week. This is the most commonly used system.</li><li><b>Full First Week</b> The first week of the year starts on the first occurrence of the <i>First day of the week</i>, and lasts for seven days.  Any days before Week 1 are considered part of the last week of the previous year. This system is most commonly used in the USA.</li><li><b>Partial First Week</b> The first week starts on the first day of the year. The second week of the year starts on the first occurrence of the <i>First day of the week</i>, and lasts for seven days. The first week may not contain seven days.</li><li><b>Simple Week</b> The first week starts on the first day of the year and lasts seven days, will all new weeks starting on the same weekday as the first day of the year.</li></ul>"
     794msgid ""
     795"<p>This option determines how the Week Number will be calculated. There are "
     796"four options available:</p> <ul><li><b>ISO Week</b> Use the ISO standard Week "
     797"Number. This will always use Monday as the first day of the ISO week. This is "
     798"the most commonly used system.</li><li><b>Full First Week</b> The first week "
     799"of the year starts on the first occurrence of the <i>First day of the week</i>"
     800", and lasts for seven days.  Any days before Week 1 are considered part of "
     801"the last week of the previous year. This system is most commonly used in the "
     802"USA.</li><li><b>Partial First Week</b> The first week starts on the first day "
     803"of the year. The second week of the year starts on the first occurrence of "
     804"the <i>First day of the week</i>, and lasts for seven days. The first week "
     805"may not contain seven days.</li><li><b>Simple Week</b> The first week starts "
     806"on the first day of the year and lasts seven days, will all new weeks "
     807"starting on the same weekday as the first day of the year.</li></ul>"
    593808msgstr ""
    594809
    595810#. +> trunk stable
    596811#: kcmlocale.cpp:2425
    597 #, fuzzy
    598812msgid "ISO Week"
    599 msgstr "1 tjedan"
     813msgstr "ISO tjedan"
    600814
    601815#. +> trunk stable
    602816#: kcmlocale.cpp:2427
    603 #, fuzzy
    604817msgid "Full First Week"
    605 msgstr "Broj"
     818msgstr "Puni prvi tjedan"
    606819
    607820#. +> trunk stable
    608821#: kcmlocale.cpp:2429
    609 #, fuzzy
    610822msgid "Partial First Week"
    611 msgstr "Parcijalni naboj"
     823msgstr "Djelomični prvi tjedan"
    612824
    613825#. +> trunk stable
    614826#: kcmlocale.cpp:2431
    615 #, fuzzy
    616827msgid "Simple Week"
    617 msgstr "Jednostavan test"
     828msgstr "Jednostavni tjedan"
    618829
    619830#. i18n: ectx: property (text), widget (QLabel, m_labelWeekStartDay)
     
    625836#. +> trunk stable
    626837#: kcmlocale.cpp:2461
    627 #, fuzzy
    628838#| msgid "<p>This option determines which day will be considered as the first one of the week.</p> "
    629 msgid "<p>This option determines which day will be considered as the first one of the week.  This value may affect the Week Number System.</p> "
    630 msgstr "<p>Ova opcija određuje koji se dan smatra prvim danom tjedna.</p> "
     839msgid ""
     840"<p>This option determines which day will be considered as the first one of "
     841"the week.  This value may affect the Week Number System.</p> "
     842msgstr ""
     843"<p>Ova opcija određuje koji se dan smatra prvim danom tjedna. Ova vrijednost "
     844"moÅŸe utjecati na Sustav brojanja tjedana.</p> "
    631845
    632846#. i18n: ectx: property (text), widget (QLabel, m_labelWorkingWeekStartDay)
     
    638852#. +> trunk stable
    639853#: kcmlocale.cpp:2496
    640 msgid "<p>This option determines which day will be considered as the first working day of the week.</p>"
    641 msgstr "<p>Ova opcija određuje koji dan se smatra prvim radnim danom u tjednu.</p>"
     854msgid ""
     855"<p>This option determines which day will be considered as the first working "
     856"day of the week.</p>"
     857msgstr ""
     858"<p>Ova opcija određuje koji dan se smatra prvim radnim danom u tjednu.</p>"
    642859
    643860#. i18n: ectx: property (text), widget (QLabel, m_labelWorkingWeekEndDay)
     
    649866#. +> trunk stable
    650867#: kcmlocale.cpp:2530
    651 msgid "<p>This option determines which day will be considered as the last working day of the week.</p>"
    652 msgstr "<p>Ova opcija određuje koji se dan smatra zadnjim radnim danom u tjednu.</p>"
     868msgid ""
     869"<p>This option determines which day will be considered as the last working "
     870"day of the week.</p>"
     871msgstr ""
     872"<p>Ova opcija određuje koji se dan smatra zadnjim radnim danom u tjednu.</p>"
    653873
    654874#. i18n: ectx: property (text), widget (QLabel, m_labelWeekDayOfPray)
     
    660880#. +> trunk stable
    661881#: kcmlocale.cpp:2564
    662 msgid "<p>This option determines which day if any will be considered as the day of the week for special religious observance.</p>"
    663 msgstr "<p>Ova opcija određuje koji će se dan u tjednu smatrati danom u tjednu za posebne vjerske obrede.</p>"
     882msgid ""
     883"<p>This option determines which day if any will be considered as the day of "
     884"the week for special religious observance.</p>"
     885msgstr ""
     886"<p>Ova opcija određuje koji će se dan u tjednu smatrati danom u tjednu za "
     887"posebne vjerske obrede.</p>"
    664888
    665889#. +> trunk stable
     
    677901#. +> trunk stable
    678902#: kcmlocale.cpp:2599
    679 msgid "<p>The text in this textbox will be used to format time strings. The sequences below will be replaced:</p><table><tr><td><b>HH</b></td><td>The hour as a decimal number using a 24-hour clock (00-23).</td></tr><tr><td><b>hH</b></td><td>The hour (24-hour clock) as a decimal number (0-23).</td></tr><tr><td><b>PH</b></td><td>The hour as a decimal number using a 12-hour clock (01-12).</td></tr><tr><td><b>pH</b></td><td>The hour (12-hour clock) as a decimal number (1-12).</td></tr><tr><td><b>MM</b></td><td>The minutes as a decimal number (00-59).</td></tr><tr><td><b>SS</b></td><td>The seconds as a decimal number (00-59).</td></tr><tr><td><b>AMPM</b></td><td>Either 'AM' or 'PM' according to the given time value. Noon is treated as 'PM' and midnight as 'AM'.</td></tr></table>"
    680 msgstr "<p>Tekst u ovom tekstualnom polju koristi se za oblikovanje oznaka vremena. Sljedeći nizovi bit će zamijenjeni:</p><table><tr><td><b>HH</b></td><td>Sat kao decimalni broj kod 24-satnog formata (00-23).</td></tr><tr><td><b>hH</b></td><td>Sat (24-satni prikaz) kao decimalni broj (0-23).</td></tr><tr><td><b>PH</b></td><td>Sat kao decimalni broj kod 12-satnog formata (01-12).</td></tr><tr><td><b>pH</b></td><td>Sat (12-satni prikaz) kao decimalni broj (1-12).</td></tr><tr><td><b>MM</b></td><td>Minute kao decimalni broj (00-59).</td></tr><tr><td><b>SS</b></td><td>Sekunde kao decimalni broj (00-59).</td></tr><tr><td><b>AMPM</b></td><td>Ili 'AM' ili 'PM' ovisno o danom vremenu. Podne je 'PM', a ponoć je 'AM'.</td></tr></table>"
     903msgid ""
     904"<p>The text in this textbox will be used to format time strings. The "
     905"sequences below will be replaced:</p><table><tr><td><b>HH</b></td><td>The "
     906"hour as a decimal number using a 24-hour clock (00-23).</td></tr><tr><td><b>"
     907"hH</b></td><td>The hour (24-hour clock) as a decimal number (0-23).</td></tr>"
     908"<tr><td><b>PH</b></td><td>The hour as a decimal number using a 12-hour clock "
     909"(01-12).</td></tr><tr><td><b>pH</b></td><td>The hour (12-hour clock) as a "
     910"decimal number (1-12).</td></tr><tr><td><b>MM</b></td><td>The minutes as a "
     911"decimal number (00-59).</td></tr><tr><td><b>SS</b></td><td>The seconds as a "
     912"decimal number (00-59).</td></tr><tr><td><b>AMPM</b></td><td>Either 'AM' or "
     913"'PM' according to the given time value. Noon is treated as 'PM' and midnight "
     914"as 'AM'.</td></tr></table>"
     915msgstr ""
     916"<p>Tekst u ovom tekstualnom polju koristi se za oblikovanje oznaka vremena. "
     917"Sljedeći nizovi bit će zamijenjeni:</p><table><tr><td><b>HH</b></td><td>Sat "
     918"kao decimalni broj kod 24-satnog formata (00-23).</td></tr><tr><td><b>hH</b><"
     919"/td><td>Sat (24-satni prikaz) kao decimalni broj (0-23).</td></tr><tr><td><b>"
     920"PH</b></td><td>Sat kao decimalni broj kod 12-satnog formata (01-12).</td></tr>"
     921"<tr><td><b>pH</b></td><td>Sat (12-satni prikaz) kao decimalni broj (1-12).<"
     922"/td></tr><tr><td><b>MM</b></td><td>Minute kao decimalni broj (00-59).</td><"
     923"/tr><tr><td><b>SS</b></td><td>Sekunde kao decimalni broj (00-59).</td></tr><"
     924"tr><td><b>AMPM</b></td><td>Ili 'AM' ili 'PM' ovisno o danom vremenu. Podne je "
     925"'PM', a ponoć je 'AM'.</td></tr></table>"
    681926
    682927#. +> trunk stable
     
    735980#: kcmlocale.cpp:2709
    736981msgid "<p>Here you can set the text to be displayed for AM.</p>"
    737 msgstr "<p>Ovdje moÅŸete postaviti tekst koji će se prikazati za prijepodne.</p>"
     982msgstr ""
     983"<p>Ovdje moÅŸete postaviti tekst koji će se prikazati za prijepodne.</p>"
    738984
    739985#. i18n: ectx: property (text), widget (QLabel, m_labelPmSymbol)
     
    746992#: kcmlocale.cpp:2714
    747993msgid "<p>Here you can set the text to be displayed for PM.</p>"
    748 msgstr "<p>Ovdje moÅŸete postaviti tekst koji će se prikazati za poslijepodne.</p>"
     994msgstr ""
     995"<p>Ovdje moÅŸete postaviti tekst koji će se prikazati za poslijepodne.</p>"
    749996
    750997#. i18n: ectx: property (text), widget (QLabel, m_labelDateFormat)
     
    7561003#. +> trunk stable
    7571004#: kcmlocale.cpp:2819
    758 msgid "<p>The text in this textbox will be used to format long dates. The sequences below will be replaced:</p><table><tr><td><b>YYYY</b></td><td>The year with century as a decimal number.</td></tr><tr><td><b>YY</b></td><td>The year without century as a decimal number (00-99).</td></tr><tr><td><b>MM</b></td><td>The month as a decimal number (01-12).</td></tr><tr><td><b>mM</b></td><td>The month as a decimal number (1-12).</td></tr><tr><td><b>SHORTMONTH</b></td><td>The first three characters of the month name.</td></tr><tr><td><b>MONTH</b></td><td>The full month name.</td></tr><tr><td><b>DD</b></td><td>The day of month as a decimal number (01-31).</td></tr><tr><td><b>dD</b></td><td>The day of month as a decimal number (1-31).</td></tr><tr><td><b>SHORTWEEKDAY</b></td><td>The first three characters of the weekday name.</td></tr><tr><td><b>WEEKDAY</b></td><td>The full weekday name.</td></tr><tr><td><b>ERAYEAR</b></td><td>The Era Year in local format (e.g. 2000 AD).</td></tr><tr><td><b>SHORTERANAME</b></td><td>The short Era Name.</td></tr><tr><td><b>YEARINERA</b></td><td>The Year in Era as a decimal number.</td></tr><tr><td><b>DAYOFYEAR</b></td><td>The Day of Year as a decimal number.</td></tr><tr><td><b>ISOWEEK</b></td><td>The ISO Week as a decimal number.</td></tr><tr><td><b>DAYOFISOWEEK</b></td><td>The Day of the ISO Week as a decimal number.</td></tr></table>"
    759 msgstr "<p>Tekst u ovom tekstualnom polju koristit će se u formatiranju dugih datuma. NiÅŸe navedeni nizovi bit će zamijenjeni:</p><table><tr><td><b>GGGG</b></td><td>Godina sa stoljećem kao decimalni broj.</td></tr><tr><td><b>GG</b></td><td>Godina bez stoljeća kao decimalni broj (00-99).</td></tr><tr><td><b>MM</b></td><td>Mjesec kao decimalni broj (01-12).</td></tr><tr><td><b>mM</b></td><td>Mjesec kao decimalni broj (1-12).</td></tr><tr><td><b>KRATKIMJESEC</b></td><td>Prva tri slova iz naziva mjeseca. </td></tr><tr><td><b>MJESEC</b></td><td>Puni naziv mjeseca.</td></tr><tr><td><b>DD</b></td><td>Dan u mjesecu kao decimalni broj (01-31).</td></tr><tr><td><b>dD</b></td><td>Dan u mjesecu kao decimalni broj (1-31).</td></tr><tr><td><b>KRATKIDAN</b></td><td>Prva tri slova imena dana.</td></tr><tr><td><b>DANUTJEDNU</b></td><td>Puni naziv dana u tjednu.</td></tr><tr><td><b>ERAGODINA</b></td><td>Godina ere u lokalnom formatu (npr. 2000. AD).</td></tr><tr><td><b>KRATKINAZIVERE</b></td><td>Kratki naziv ere.</td></tr><tr><td><b>GODINAUERI</b></td><td>Godina u eri kao decimalni broj.</td></tr><tr><td><b>DANGODINE</b></td><td>Dan u godini kao decimalni broj.</td></tr><tr><td><b>ISOTJEDAN</b></td><td>ISO tjedan kao decimalni broj.</td></tr><tr><td><b>DANISOTJEDNA</b></td><td>Dan ISO tjedna kao decimalni broj.</td></tr></table>"
     1005msgid ""
     1006"<p>The text in this textbox will be used to format long dates. The sequences "
     1007"below will be replaced:</p><table><tr><td><b>YYYY</b></td><td>The year with "
     1008"century as a decimal number.</td></tr><tr><td><b>YY</b></td><td>The year "
     1009"without century as a decimal number (00-99).</td></tr><tr><td><b>MM</b></td><"
     1010"td>The month as a decimal number (01-12).</td></tr><tr><td><b>mM</b></td><td>"
     1011"The month as a decimal number (1-12).</td></tr><tr><td><b>SHORTMONTH</b></td>"
     1012"<td>The first three characters of the month name.</td></tr><tr><td><b>MONTH<"
     1013"/b></td><td>The full month name.</td></tr><tr><td><b>DD</b></td><td>The day "
     1014"of month as a decimal number (01-31).</td></tr><tr><td><b>dD</b></td><td>The "
     1015"day of month as a decimal number (1-31).</td></tr><tr><td><b>SHORTWEEKDAY</b>"
     1016"</td><td>The first three characters of the weekday name.</td></tr><tr><td><b>"
     1017"WEEKDAY</b></td><td>The full weekday name.</td></tr><tr><td><b>ERAYEAR</b><"
     1018"/td><td>The Era Year in local format (e.g. 2000 AD).</td></tr><tr><td><b>"
     1019"SHORTERANAME</b></td><td>The short Era Name.</td></tr><tr><td><b>YEARINERA</b>"
     1020"</td><td>The Year in Era as a decimal number.</td></tr><tr><td><b>DAYOFYEAR<"
     1021"/b></td><td>The Day of Year as a decimal number.</td></tr><tr><td><b>ISOWEEK<"
     1022"/b></td><td>The ISO Week as a decimal number.</td></tr><tr><td><b>"
     1023"DAYOFISOWEEK</b></td><td>The Day of the ISO Week as a decimal number.</td><"
     1024"/tr></table>"
     1025msgstr ""
     1026"<p>Tekst u ovom tekstualnom polju koristit će se u formatiranju dugih datuma. "
     1027"NiÅŸe navedeni nizovi bit će zamijenjeni:</p><table><tr><td><b>GGGG</b></td><"
     1028"td>Godina sa stoljećem kao decimalni broj.</td></tr><tr><td><b>GG</b></td><td>"
     1029"Godina bez stoljeća kao decimalni broj (00-99).</td></tr><tr><td><b>MM</b><"
     1030"/td><td>Mjesec kao decimalni broj (01-12).</td></tr><tr><td><b>mM</b></td><td>"
     1031"Mjesec kao decimalni broj (1-12).</td></tr><tr><td><b>KRATKIMJESEC</b></td><"
     1032"td>Prva tri slova iz naziva mjeseca. </td></tr><tr><td><b>MJESEC</b></td><td>"
     1033"Puni naziv mjeseca.</td></tr><tr><td><b>DD</b></td><td>Dan u mjesecu kao "
     1034"decimalni broj (01-31).</td></tr><tr><td><b>dD</b></td><td>Dan u mjesecu kao "
     1035"decimalni broj (1-31).</td></tr><tr><td><b>KRATKIDAN</b></td><td>Prva tri "
     1036"slova imena dana.</td></tr><tr><td><b>DANUTJEDNU</b></td><td>Puni naziv dana "
     1037"u tjednu.</td></tr><tr><td><b>ERAGODINA</b></td><td>Godina ere u lokalnom "
     1038"formatu (npr. 2000. AD).</td></tr><tr><td><b>KRATKINAZIVERE</b></td><td>"
     1039"Kratki naziv ere.</td></tr><tr><td><b>GODINAUERI</b></td><td>Godina u eri kao "
     1040"decimalni broj.</td></tr><tr><td><b>DANGODINE</b></td><td>Dan u godini kao "
     1041"decimalni broj.</td></tr><tr><td><b>ISOTJEDAN</b></td><td>ISO tjedan kao "
     1042"decimalni broj.</td></tr><tr><td><b>DANISOTJEDNA</b></td><td>Dan ISO tjedna "
     1043"kao decimalni broj.</td></tr></table>"
    7601044
    7611045#. +> trunk stable
     
    8581142#. +> trunk stable
    8591143#: kcmlocale.cpp:2953
    860 msgid "<p>The text in this textbox will be used to format short dates. For instance, this is used when listing files. The sequences below will be replaced:</p><table><tr><td><b>YYYY</b></td><td>The year with century as a decimal number.</td></tr><tr><td><b>YY</b></td><td>The year without century as a decimal number (00-99).</td></tr><tr><td><b>MM</b></td><td>The month as a decimal number (01-12).</td></tr><tr><td><b>mM</b></td><td>The month as a decimal number (1-12).</td></tr><tr><td><b>SHORTMONTH</b></td><td>The first three characters of the month name.</td></tr><tr><td><b>MONTH</b></td><td>The full month name.</td></tr><tr><td><b>DD</b></td><td>The day of month as a decimal number (01-31).</td></tr><tr><td><b>dD</b></td><td>The day of month as a decimal number (1-31).</td></tr><tr><td><b>SHORTWEEKDAY</b></td><td>The first three characters of the weekday name.</td></tr><tr><td><b>WEEKDAY</b></td><td>The full weekday name.</td></tr><tr><td><b>ERAYEAR</b></td><td>The Era Year in local format (e.g. 2000 AD).</td></tr><tr><td><b>SHORTERANAME</b></td><td>The short Era Name.</td></tr><tr><td><b>YEARINERA</b></td><td>The Year in Era as a decimal number.</td></tr><tr><td><b>DAYOFYEAR</b></td><td>The Day of Year as a decimal number.</td></tr><tr><td><b>ISOWEEK</b></td><td>The ISO Week as a decimal number.</td></tr><tr><td><b>DAYOFISOWEEK</b></td><td>The Day of the ISO Week as a decimal number.</td></tr></table>"
    861 msgstr "<p>Tekst u ovom tekstualnom polju koristit će se u formatiranju kratkih datuma. Na primjer, ovo se koristi pri izlistavanju datoteka. NiÅŸe navedeni nizovi bit će zamijenjeni:</p><table><tr><td><b>GGGG</b></td><td>Godina sa stoljećem kao decimalni broj.</td></tr><tr><td><b>GG</b></td><td>Godina bez stoljeća kao decimalni broj (00-99).</td></tr><tr><td><b>MM</b></td><td>Mjesec kao decimalni broj (01-12).</td></tr><tr><td><b>mM</b></td><td>Mjesec kao decimalni broj (1-12).</td></tr><tr><td><b>KRATKIMJESEC</b></td><td>Prva tri slova iz naziva mjeseca.</td></tr><tr><td><b>MJESEC</b></td><td>Puni naziv mjeseca.</td></tr><tr><td><b>DD</b></td><td>Dan u mjesecu kao decimalni broj (01-31).</td></tr><tr><td><b>dD</b></td><td>Dan u mjesecu kao decimalni broj (1-31).</td></tr><tr><td><b>KRATKIDAN</b></td><td>Prva tri znaka naziva dana u tjednu.</td></tr><tr><td><b>DANUTJEDNU</b></td><td>Puni naziv dana u tjednu.</td></tr><tr><td><b>ERAGODINA</b></td><td>Godina u eri u lokalnom formatu (npr. 2000. AD).</td></tr><tr><td><b>KRATKINAZIVERE</b></td><td>Kratki naziv ere.</td></tr><tr><td><b>GODINAUERI</b></td><td>Godina u eri kao decimalni broj.</td></tr><tr><td><b>DANGODINE</b></td><td>Dan u godini kao decimalni broj.</td></tr><tr><td><b>ISOTJEDAN</b></td><td>ISO tjedan kao decimalni broj.</td></tr><tr><td><b>DANISOTJEDNA</b></td><td>Dan u ISO tjednu kao decimalni broj.</td></tr></table>"
     1144msgid ""
     1145"<p>The text in this textbox will be used to format short dates. For instance, "
     1146"this is used when listing files. The sequences below will be replaced:</p><"
     1147"table><tr><td><b>YYYY</b></td><td>The year with century as a decimal number.<"
     1148"/td></tr><tr><td><b>YY</b></td><td>The year without century as a decimal "
     1149"number (00-99).</td></tr><tr><td><b>MM</b></td><td>The month as a decimal "
     1150"number (01-12).</td></tr><tr><td><b>mM</b></td><td>The month as a decimal "
     1151"number (1-12).</td></tr><tr><td><b>SHORTMONTH</b></td><td>The first three "
     1152"characters of the month name.</td></tr><tr><td><b>MONTH</b></td><td>The full "
     1153"month name.</td></tr><tr><td><b>DD</b></td><td>The day of month as a decimal "
     1154"number (01-31).</td></tr><tr><td><b>dD</b></td><td>The day of month as a "
     1155"decimal number (1-31).</td></tr><tr><td><b>SHORTWEEKDAY</b></td><td>The first "
     1156"three characters of the weekday name.</td></tr><tr><td><b>WEEKDAY</b></td><td>"
     1157"The full weekday name.</td></tr><tr><td><b>ERAYEAR</b></td><td>The Era Year "
     1158"in local format (e.g. 2000 AD).</td></tr><tr><td><b>SHORTERANAME</b></td><td>"
     1159"The short Era Name.</td></tr><tr><td><b>YEARINERA</b></td><td>The Year in Era "
     1160"as a decimal number.</td></tr><tr><td><b>DAYOFYEAR</b></td><td>The Day of "
     1161"Year as a decimal number.</td></tr><tr><td><b>ISOWEEK</b></td><td>The ISO "
     1162"Week as a decimal number.</td></tr><tr><td><b>DAYOFISOWEEK</b></td><td>The "
     1163"Day of the ISO Week as a decimal number.</td></tr></table>"
     1164msgstr ""
     1165"<p>Tekst u ovom tekstualnom polju koristit će se u formatiranju kratkih "
     1166"datuma. Na primjer, ovo se koristi pri izlistavanju datoteka. NiÅŸe navedeni "
     1167"nizovi bit će zamijenjeni:</p><table><tr><td><b>GGGG</b></td><td>Godina sa "
     1168"stoljećem kao decimalni broj.</td></tr><tr><td><b>GG</b></td><td>Godina bez "
     1169"stoljeća kao decimalni broj (00-99).</td></tr><tr><td><b>MM</b></td><td>"
     1170"Mjesec kao decimalni broj (01-12).</td></tr><tr><td><b>mM</b></td><td>Mjesec "
     1171"kao decimalni broj (1-12).</td></tr><tr><td><b>KRATKIMJESEC</b></td><td>Prva "
     1172"tri slova iz naziva mjeseca.</td></tr><tr><td><b>MJESEC</b></td><td>Puni "
     1173"naziv mjeseca.</td></tr><tr><td><b>DD</b></td><td>Dan u mjesecu kao decimalni "
     1174"broj (01-31).</td></tr><tr><td><b>dD</b></td><td>Dan u mjesecu kao decimalni "
     1175"broj (1-31).</td></tr><tr><td><b>KRATKIDAN</b></td><td>Prva tri znaka naziva "
     1176"dana u tjednu.</td></tr><tr><td><b>DANUTJEDNU</b></td><td>Puni naziv dana u "
     1177"tjednu.</td></tr><tr><td><b>ERAGODINA</b></td><td>Godina u eri u lokalnom "
     1178"formatu (npr. 2000. AD).</td></tr><tr><td><b>KRATKINAZIVERE</b></td><td>"
     1179"Kratki naziv ere.</td></tr><tr><td><b>GODINAUERI</b></td><td>Godina u eri kao "
     1180"decimalni broj.</td></tr><tr><td><b>DANGODINE</b></td><td>Dan u godini kao "
     1181"decimalni broj.</td></tr><tr><td><b>ISOTJEDAN</b></td><td>ISO tjedan kao "
     1182"decimalni broj.</td></tr><tr><td><b>DANISOTJEDNA</b></td><td>Dan u ISO tjednu "
     1183"kao decimalni broj.</td></tr></table>"
    8621184
    8631185#. +> trunk stable
     
    8811203#. +> trunk stable
    8821204#: kcmlocale.cpp:3073
    883 msgid "<p>This option determines whether possessive form of month names should be used in dates.</p>"
    884 msgstr "<p>Ova opcija određuje da li se u datumima koristi duÅŸi oblik imena mjeseca.</p>"
     1205msgid ""
     1206"<p>This option determines whether possessive form of month names should be "
     1207"used in dates.</p>"
     1208msgstr ""
     1209"<p>Ova opcija određuje da li se u datumima koristi duÅŸi oblik imena mjeseca.<"
     1210"/p>"
    8851211
    8861212#. +> trunk stable
    8871213#: kcmlocale.cpp:3114
    888 msgid "<p>Here you can define the set of digits used to display dates and times.  If digits other than Arabic are selected, they will appear only if used in the language of the application or the piece of text where the date or time is shown.</p><p>Note that the set of digits used to display numeric and monetary values have to be set separately (see the 'Number' or 'Money' tabs).</p>"
    889 msgstr "<p>Ovdje moÅŸete odrediti brojevni sustav za prikaz datuma i vremena. Ako je izabran nearapski brojevni sustav, prikazat će se samo ako je koriÅ¡ten u jeziku aplikacije ili dijelu teksta u kojem je prikazan datum ili vrijeme.</p><p> Primijetite da brojevni sustav za prikaz brojčanih i novčanih vrijednosti valja postaviti posebno (vidjeti kartice 'Brojevi' i 'Novac').</p>"
     1214msgid ""
     1215"<p>Here you can define the set of digits used to display dates and times.  If "
     1216"digits other than Arabic are selected, they will appear only if used in the "
     1217"language of the application or the piece of text where the date or time is "
     1218"shown.</p><p>Note that the set of digits used to display numeric and monetary "
     1219"values have to be set separately (see the 'Number' or 'Money' tabs).</p>"
     1220msgstr ""
     1221"<p>Ovdje moÅŸete odrediti brojevni sustav za prikaz datuma i vremena. Ako je "
     1222"izabran nearapski brojevni sustav, prikazat će se samo ako je koriÅ¡ten u "
     1223"jeziku aplikacije ili dijelu teksta u kojem je prikazan datum ili vrijeme.</p>"
     1224"<p> Primijetite da brojevni sustav za prikaz brojčanih i novčanih vrijednosti "
     1225"valja postaviti posebno (vidjeti kartice 'Brojevi' i 'Novac').</p>"
    8901226
    8911227#. +> trunk stable
     
    8961232#. +> trunk stable
    8971233#: kcmlocale.cpp:3152
    898 msgid "<p>Here you can define the default page size to be used in new documents.</p><p>Note that this setting has no effect on printer paper size.</p>"
    899 msgstr "<p>Ovdje moÅŸete definirati zadanu veličinu stranice koja će se koristiti u novim dokumentima.</p>  <p>Primijetite da ova postavka nema utjecaj na veličinu papira pisača.</p>"
     1234msgid ""
     1235"<p>Here you can define the default page size to be used in new documents.</p>"
     1236"<p>Note that this setting has no effect on printer paper size.</p>"
     1237msgstr ""
     1238"<p>Ovdje moÅŸete definirati zadanu veličinu stranice koja će se koristiti u "
     1239"novim dokumentima.</p>  <p>Primijetite da ova postavka nema utjecaj na "
     1240"veličinu papira pisača.</p>"
    9001241
    9011242#. +> trunk stable
     
    11121453#. +> trunk stable
    11131454#: kcmlocale.cpp:3290
    1114 msgid "<p>This changes the units used by most KDE programs to display numbers counted in bytes. Traditionally \"kilobytes\" meant units of 1024, instead of the metric 1000, for most (but not all) byte sizes.<ul><li>To reduce confusion you can use the recently standardized IEC units which are always in multiples of 1024.</li><li>You can also select metric, which is always in units of 1000.</li><li>Selecting JEDEC restores the older-style units used in KDE 3.5 and some other operating systems.</li></p>"
    1115 msgstr "<p>Ovo mijenja jedinice koje koristi većina KDE-ovih programa za prikaz brojeva u bajtovima. Tradicionalni \"kilobajt\" je značio 1024 jedinica, umjesto metričkih 1000 za većinu (ali ne svih) bajtnih veličina.<ul><li>Kako bi smanjili zbunjenost, moÅŸete koristiti nedavno standardizirane jedinice IEC-a koje su uvijek viÅ¡ekratnici od 1024.</li><li>Također moÅŸete odabrati metričke koje su uvijek u jedincama po 1000.</li><li>Odabiranjem JEDEC-a vraćate stare jedinice koje su se koristile u KDE-u 3.5 i u nekim drugim operacijskim sustavima.</li></p>"
     1455msgid ""
     1456"<p>This changes the units used by most KDE programs to display numbers "
     1457"counted in bytes. Traditionally \"kilobytes\" meant units of 1024, instead of "
     1458"the metric 1000, for most (but not all) byte sizes.<ul><li>To reduce "
     1459"confusion you can use the recently standardized IEC units which are always in "
     1460"multiples of 1024.</li><li>You can also select metric, which is always in "
     1461"units of 1000.</li><li>Selecting JEDEC restores the older-style units used in "
     1462"KDE 3.5 and some other operating systems.</li></p>"
     1463msgstr ""
     1464"<p>Ovo mijenja jedinice koje koristi većina KDE-ovih programa za prikaz "
     1465"brojeva u bajtovima. Tradicionalni \"kilobajt\" je značio 1024 jedinica, "
     1466"umjesto metričkih 1000 za većinu (ali ne svih) bajtnih veličina.<ul><li>Kako "
     1467"bi smanjili zbunjenost, moÅŸete koristiti nedavno standardizirane jedinice "
     1468"IEC-a koje su uvijek viÅ¡ekratnici od 1024.</li><li>Također moÅŸete odabrati "
     1469"metričke koje su uvijek u jedincama po 1000.</li><li>Odabiranjem JEDEC-a "
     1470"vraćate stare jedinice koje su se koristile u KDE-u 3.5 i u nekim drugim "
     1471"operacijskim sustavima.</li></p>"
    11161472
    11171473#. +> trunk stable
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmnic.po

    r750 r1129  
    33# Andrej Dundović <adundovi@gmail.com>, 2009.
    44# DoDo <DoDoEntertainment@gmail.com>, 2009.
     5# Marko DimjaÅ¡ević <marko@dimjasevic.net>, 2011.
    56msgid ""
    67msgstr ""
     
    89"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    910"POT-Creation-Date: 2011-01-11 10:25+0100\n"
    10 "PO-Revision-Date: 2009-08-11 16:29+0200\n"
    11 "Last-Translator: DoDo <DoDoEntertainment@gmail.com>\n"
     11"PO-Revision-Date: 2011-07-12 17:37+0200\n"
     12"Last-Translator: Marko DimjaÅ¡ević <marko@dimjasevic.net>\n"
    1213"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
    1314"MIME-Version: 1.0\n"
     
    1516"Content-Transfer-Encoding: 8bit\n"
    1617"Language: hr\n"
    17 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    18 "X-Generator: Lokalize 0.3\n"
     18"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     19"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     20"X-Generator: Lokalize 1.2\n"
    1921"X-Environment: kde\n"
    2022"X-Accelerator-Marker: &\n"
     
    7375#. +> trunk stable
    7476#: nic.cpp:112
    75 #, fuzzy
    7677#| msgid "KDE Panel System Information Control Module"
    7778msgid "System Information Control Module"
    78 msgstr "KDE panel – Upravljački modul podataka o sustavu"
     79msgstr "Upravljački modul za informacije o sustavu"
    7980
    8081#. +> trunk stable
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmopengl.po

    r1123 r1129  
    22#
    33# Zarko Pintar <zarko.pintar@gmail.com>, 2009.
     4# Marko DimjaÅ¡ević <marko@dimjasevic.net>, 2011.
    45msgid ""
    56msgstr ""
     
    78"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    89"POT-Creation-Date: 2011-07-08 10:22+0200\n"
    9 "PO-Revision-Date: 2009-08-25 08:28+0200\n"
    10 "Last-Translator: Zarko Pintar <zarko.pintar@gmail.com>\n"
     10"PO-Revision-Date: 2011-07-12 17:42+0200\n"
     11"Last-Translator: Marko DimjaÅ¡ević <marko@dimjasevic.net>\n"
    1112"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
    1213"MIME-Version: 1.0\n"
     
    1415"Content-Transfer-Encoding: 8bit\n"
    1516"Language: hr\n"
    16 "X-Generator: Lokalize 0.3\n"
    17 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     17"X-Generator: Lokalize 1.2\n"
     18"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     19"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    1820"X-Environment: kde\n"
    1921"X-Accelerator-Marker: &\n"
     
    263265#. +> trunk stable
    264266#: opengl.cpp:580
    265 #, fuzzy
    266267#| msgid "OpenGL version"
    267268msgid "OpenGL/ES version"
    268 msgstr "openGL verzija"
     269msgstr "Inačica OpenGL/ES-a"
    269270
    270271#. +> trunk stable
     
    275276#. +> trunk stable
    276277#: opengl.cpp:587
    277 #, fuzzy
    278278#| msgid "OpenGL extensions"
    279279msgid "OpenGL/ES extensions"
    280 msgstr "OpenGL proÅ¡irenja"
     280msgstr "OpenGL/ES-proÅ¡irenja"
    281281
    282282#. +> trunk stable
     
    303303#: opengl.cpp:606
    304304msgid "server GLX extensions"
    305 msgstr "ProÅ¡irenja GLX posluÅŸitelja"
     305msgstr "PosluÅŸiteljska GLX-proÅ¡irenja"
    306306
    307307#. +> trunk stable
     
    318318#: opengl.cpp:611
    319319msgid "client GLX extensions"
    320 msgstr "ProÅ¡irenja GLX klijenta"
     320msgstr "Klijentska GLX-proÅ¡irenja"
    321321
    322322#. +> trunk stable
    323323#: opengl.cpp:613
    324324msgid "GLX extensions"
    325 msgstr "GLX proÅ¡irenja"
     325msgstr "GLX-proÅ¡irenja"
    326326
    327327#. +> trunk stable
     
    338338#: opengl.cpp:618
    339339msgid "GLU extensions"
    340 msgstr "GLU proÅ¡irenja"
     340msgstr "GLU-proÅ¡irenja"
    341341
    342342#. +> trunk stable
    343343#: opengl.cpp:627
    344 #, fuzzy
    345344#| msgid "GLX"
    346345msgid "EGL"
    347 msgstr "GLX"
     346msgstr "EGL"
    348347
    349348#. +> trunk stable
    350349#: opengl.cpp:628
    351 #, fuzzy
    352350#| msgid "Vendor"
    353351msgid "EGL Vendor"
    354 msgstr "Proizvođač"
     352msgstr "Razvijatelj EGL-a"
    355353
    356354#. +> trunk stable
    357355#: opengl.cpp:629
    358 #, fuzzy
    359356#| msgid "GLU version"
    360357msgid "EGL Version"
    361 msgstr "GLU verzija"
     358msgstr "Inačica EGL-a"
    362359
    363360#. +> trunk stable
    364361#: opengl.cpp:630
    365 #, fuzzy
    366362#| msgid "GLX extensions"
    367363msgid "EGL Extensions"
    368 msgstr "GLX proÅ¡irenja"
     364msgstr "EGL-proÅ¡irenja"
    369365
    370366#. +> trunk stable
     
    390386#. +> trunk stable
    391387#: opengl.cpp:865
    392 #, fuzzy
    393388#| msgid "Could not initialize OpenGL"
    394389msgid "Could not initialize OpenGL ES2.0"
    395 msgstr "Ne mogu inicijalizirati OpenGL"
     390msgstr "Ne mogu inicijalizirati OpenGL ES2.0"
    396391
    397392#. i18n: ectx: property (text), widget (QTreeWidget, glinfoTreeWidget)
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/kcmstyle.po

    r750 r1129  
    77# Andrej Dundovic <adundovi@gmail.com>, 2009.
    88# Andrej Dundović <adundovi@gmail.com>, 2009.
     9# Marko DimjaÅ¡ević <marko@dimjasevic.net>, 2011.
    910msgid ""
    1011msgstr ""
     
    1213"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    1314"POT-Creation-Date: 2011-01-11 10:25+0100\n"
    14 "PO-Revision-Date: 2009-12-09 08:24+0100\n"
    15 "Last-Translator: Andrej Dundović <adundovi@gmail.com>\n"
     15"PO-Revision-Date: 2011-07-12 17:43+0200\n"
     16"Last-Translator: Marko DimjaÅ¡ević <marko@dimjasevic.net>\n"
    1617"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
    1718"MIME-Version: 1.0\n"
     
    1920"Content-Transfer-Encoding: 8bit\n"
    2021"Language: hr\n"
    21 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    22 "X-Generator: Lokalize 1.0\n"
     22"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     23"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     24"X-Generator: Lokalize 1.2\n"
    2325"X-Environment: kde\n"
    2426"X-Accelerator-Marker: &\n"
     
    2830msgctxt "NAME OF TRANSLATORS"
    2931msgid "Your names"
    30 msgstr "Denis Lackovic, Goran Åœugelj, Mato Kutlić, Robert Sedak, Roko Roic, Vlatko Kosturjak, Oliver Mucafir, Andrej Dundović"
     32msgstr ""
     33"Denis Lackovic, Goran Åœugelj, Mato Kutlić, Robert Sedak, Roko Roic, Vlatko "
     34"Kosturjak, Oliver Mucafir, Andrej Dundović"
    3135
    3236#. +> trunk stable
    3337msgctxt "EMAIL OF TRANSLATORS"
    3438msgid "Your emails"
    35 msgstr "lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, oliver.untwist@gmail.com, adundovi@gmail.com"
     39msgstr ""
     40"lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, "
     41"lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, oliver."
     42"untwist@gmail.com, adundovi@gmail.com"
    3643
    3744#. i18n: ectx: property (text), widget (QLabel, label_4)
     
    102109#. +> trunk stable
    103110#: kcmstyle.cpp:165
    104 msgid "<h1>Style</h1>This module allows you to modify the visual appearance of user interface elements, such as the widget style and effects."
    105 msgstr "<h1>Stil</h1>Ovaj modul dopuÅ¡ta vam mijenjati izgled elemenata korisničkog sučelja, kao Å¡to su stilovi ukrasa i efekti."
     111msgid ""
     112"<h1>Style</h1>This module allows you to modify the visual appearance of user "
     113"interface elements, such as the widget style and effects."
     114msgstr ""
     115"<h1>Stil</h1>Ovaj modul dopuÅ¡ta vam mijenjati izgled elemenata korisničkog "
     116"sučelja, kao Å¡to su stilovi ukrasa i efekti."
    106117
    107118#. +> trunk stable
     
    195206#: kcmstyle.cpp:297 kcmstyle.cpp:308
    196207msgid "There was an error loading the configuration dialog for this style."
    197 msgstr "DoÅ¡lo je do greÅ¡ke prilikom učitavanja dijaloga za podeÅ¡avanje ovog stila."
     208msgstr ""
     209"DoÅ¡lo je do greÅ¡ke prilikom učitavanja dijaloga za podeÅ¡avanje ovog stila."
    198210
    199211#. +> trunk stable
     
    205217#: kcmstyle.cpp:382
    206218#, fuzzy
    207 msgid "<p>Changes to the visibility of menu icons will only affect newly started applications.</p>"
    208 msgstr "<p>Neke izmjene, poput postavki DPI-a, imat će učinak samo na novo pokrenutim aplikacijama.</p>"
     219msgid ""
     220"<p>Changes to the visibility of menu icons will only affect newly started "
     221"applications.</p>"
     222msgstr ""
     223"<p>Neke izmjene, poput postavki DPI-a, imat će učinak samo na novo pokrenutim "
     224"aplikacijama.</p>"
    209225
    210226#. +> trunk stable
     
    228244#. +> trunk stable
    229245#: kcmstyle.cpp:734
    230 msgid "Here you can choose from a list of predefined widget styles (e.g. the way buttons are drawn) which may or may not be combined with a theme (additional information like a marble texture or a gradient)."
    231 msgstr "Ovdje moÅŸete odabrati jedan od unaprijed definiranih stilova ukrasa(izgled komponenti kao Å¡to su gumbi, padajući meniji
).Ovo se moÅŸe kombinirati s temom (koja dodaje dodatne efekte kao Å¡to su pozadine ili prijelazi boja)"
     246msgid ""
     247"Here you can choose from a list of predefined widget styles (e.g. the way "
     248"buttons are drawn) which may or may not be combined with a theme (additional "
     249"information like a marble texture or a gradient)."
     250msgstr ""
     251"Ovdje moÅŸete odabrati jedan od unaprijed definiranih stilova ukrasa(izgled "
     252"komponenti kao Å¡to su gumbi, padajući meniji
).Ovo se moÅŸe kombinirati s "
     253"temom (koja dodaje dodatne efekte kao Å¡to su pozadine ili prijelazi boja)"
    232254
    233255#. +> trunk stable
    234256#: kcmstyle.cpp:738
    235 msgid "This area shows a preview of the currently selected style without having to apply it to the whole desktop."
    236 msgstr "Ovdje moÅŸete vidjeti pregled trenutno odabaranog stila prije nego ga primjenite na cijelu radnu povrÅ¡inu."
     257msgid ""
     258"This area shows a preview of the currently selected style without having to "
     259"apply it to the whole desktop."
     260msgstr ""
     261"Ovdje moÅŸete vidjeti pregled trenutno odabaranog stila prije nego ga "
     262"primjenite na cijelu radnu povrÅ¡inu."
    237263
    238264#. +> trunk stable
     
    243269#. +> trunk stable
    244270#: kcmstyle.cpp:742
    245 msgid "<p><b>No Text:</b> Shows only icons on toolbar buttons. Best option for low resolutions.</p><p><b>Text Only: </b>Shows only text on toolbar buttons.</p><p><b>Text Beside Icons: </b> Shows icons and text on toolbar buttons. Text is aligned beside the icon.</p><b>Text Below Icons: </b> Shows icons and text on toolbar buttons. Text is aligned below the icon."
    246 msgstr "<p><b>Bez teksta:</b> Prikazuje samo ikone na gumbima alatne trake. Najbolji izbor za niske rezolucije.</p><p><b>Samo tekst: </b>Prikazuje samo tekst gumbima alatne trake.</p><p><b>Tekst uz ikone: </b> Prikazuje ikone i tekst na gumbima alatne trake. Tekst je pokraj ikone.</p><b>Tekst ispod ikona: </b> Prikazuje ikone i tekst na gumbima alatne trake. Tekst je ispod ikone."
     271msgid ""
     272"<p><b>No Text:</b> Shows only icons on toolbar buttons. Best option for low "
     273"resolutions.</p><p><b>Text Only: </b>Shows only text on toolbar buttons.</p><"
     274"p><b>Text Beside Icons: </b> Shows icons and text on toolbar buttons. Text is "
     275"aligned beside the icon.</p><b>Text Below Icons: </b> Shows icons and text on "
     276"toolbar buttons. Text is aligned below the icon."
     277msgstr ""
     278"<p><b>Bez teksta:</b> Prikazuje samo ikone na gumbima alatne trake. Najbolji "
     279"izbor za niske rezolucije.</p><p><b>Samo tekst: </b>Prikazuje samo tekst "
     280"gumbima alatne trake.</p><p><b>Tekst uz ikone: </b> Prikazuje ikone i tekst "
     281"na gumbima alatne trake. Tekst je pokraj ikone.</p><b>Tekst ispod ikona: </b> "
     282"Prikazuje ikone i tekst na gumbima alatne trake. Tekst je ispod ikone."
    247283
    248284#. +> trunk stable
    249285#: kcmstyle.cpp:749
    250 msgid "If you enable this option, KDE Applications will show small icons alongside some important buttons."
    251 msgstr "Ako uključite ovu mogućnost, KDE Aplikacije će prikazati male ikone uz neke vaÅŸne gumbe."
     286msgid ""
     287"If you enable this option, KDE Applications will show small icons alongside "
     288"some important buttons."
     289msgstr ""
     290"Ako uključite ovu mogućnost, KDE Aplikacije će prikazati male ikone uz neke "
     291"vaÅŸne gumbe."
    252292
    253293#. +> trunk stable
    254294#: kcmstyle.cpp:751
    255 #, fuzzy
    256295#| msgid "If you enable this option, KDE Applications will show small icons alongside some important buttons."
    257 msgid "If you enable this option, KDE Applications will show small icons alongside most menu items."
    258 msgstr "Ako uključite ovu mogućnost, KDE Aplikacije će prikazati male ikone uz neke vaÅŸne gumbe."
     296msgid ""
     297"If you enable this option, KDE Applications will show small icons alongside "
     298"most menu items."
     299msgstr ""
     300"Ako uključite ovu mogućnost, KDE-aplikacije će prikazati male ikone uz većinu "
     301"izbornih stavki."
    259302
    260303#. +> trunk stable
    261304#: kcmstyle.cpp:753
    262 msgid "If you enable this option, KDE Applications will run internal animations."
    263 msgstr "Ako uključite ovu mogućnost, KDE Aplikacije će pokrenuti interne animacije."
     305msgid ""
     306"If you enable this option, KDE Applications will run internal animations."
     307msgstr ""
     308"Ako uključite ovu mogućnost, KDE Aplikacije će pokrenuti interne animacije."
    264309
    265310#. +> trunk stable
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/kurifilter.po

    r1128 r1129  
    33# DoDo <DoDoEntertainment@gmail.com>, 2009.
    44# Marko Dimjasevic <marko@dimjasevic.net>, 2011.
     5# Marko DimjaÅ¡ević <marko@dimjasevic.net>, 2011.
    56msgid ""
    67msgstr ""
     
    89"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    910"POT-Creation-Date: 2011-01-11 10:25+0100\n"
    10 "PO-Revision-Date: 2011-03-04 19:21+0100\n"
    11 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     11"PO-Revision-Date: 2011-07-12 17:47+0200\n"
     12"Last-Translator: Marko DimjaÅ¡ević <marko@dimjasevic.net>\n"
    1213"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
    1314"MIME-Version: 1.0\n"
     
    1617"Language: hr\n"
    1718"X-Generator: Lokalize 1.2\n"
    18 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     19"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     20"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    1921"X-Environment: kde\n"
    2022"X-Accelerator-Marker: &\n"
     
    4042#, fuzzy
    4143#| msgid "<p>In this module you can configure the web shortcuts feature. Web shortcuts allow you to quickly search or lookup words on the Internet. For example, to search for information about the KDE project using the Google engine, you simply type <b>gg:KDE</b> or <b>google:KDE</b>.</p><p>If you select a default search engine, normal words or phrases will be looked up at the specified search engine by simply typing them into applications, such as Konqueror, that have built-in support for such a feature.</p>"
    42 msgid "<p>In this module you can configure the web shortcuts feature. Web shortcuts allow you to quickly search or lookup words on the Internet. For example, to search for information about the KDE project using the Google engine, you simply type <b>gg:KDE</b> or <b>google:KDE</b>.</p><p>If you select a default search engine, then you can search for normal words or phrases by simply typing them into the input widget of applications that have built-in support for such a feature, e.g Konqueror.</p>"
    43 msgstr "<p>U ovom modulu moÅŸete konfigurirati web prečace. Web prečaci Vam omogućuju brzo pretraÅŸivanje Interneta. Na primjer, za traÅŸenje informacija o KDE projektu pomoću Google traÅŸilice, jednostavno upiÅ¡ete <b>gg:KDE</b> ili <b>google:KDE</b>.</p> <p>Ako odaberete uobičajenu traÅŸilicu, normalne riječi i fraze će se traÅŸiti pomoću te traÅŸilice ako samo upiÅ¡ete navedene u aplikacije poput Konquerora koje podrÅŸavaju web prečace.</p>"
     44msgid ""
     45"<p>In this module you can configure the web shortcuts feature. Web shortcuts "
     46"allow you to quickly search or lookup words on the Internet. For example, to "
     47"search for information about the KDE project using the Google engine, you "
     48"simply type <b>gg:KDE</b> or <b>google:KDE</b>.</p><p>If you select a default "
     49"search engine, then you can search for normal words or phrases by simply "
     50"typing them into the input widget of applications that have built-in support "
     51"for such a feature, e.g Konqueror.</p>"
     52msgstr ""
     53"<p>U ovom modulu moÅŸete konfigurirati web prečace. Web prečaci Vam omogućuju "
     54"brzo pretraÅŸivanje Interneta. Na primjer, za traÅŸenje informacija o KDE "
     55"projektu pomoću Google traÅŸilice, jednostavno upiÅ¡ete <b>gg:KDE</b> ili <b>"
     56"google:KDE</b>.</p> <p>Ako odaberete uobičajenu traÅŸilicu, normalne riječi i "
     57"fraze će se traÅŸiti pomoću te traÅŸilice ako samo upiÅ¡ete navedene u "
     58"aplikacije poput Konquerora koje podrÅŸavaju web prečace.</p>"
    4459
    4560#. i18n: ectx: property (whatsThis), widget (QCheckBox, cbEnableShortcuts)
     
    4863msgid ""
    4964"<qt>\n"
    50 "Enable shortcuts that allow you to quickly search for information on the web. For example, entering the shortcut <b>gg:KDE</b> will result in a search for the word <b>KDE</b> on the Google(TM) search engine.\n"
    51 "</qt>"
    52 msgstr ""
    53 "<qt>\n"
    54 "Omogućite prečace koji Vam omogućuju brzo pretraÅŸivanje informacija na Internetu- Na primjer, unoÅ¡enjem prečice <b>gg:KDE</b> će rezultirati traÅŸenjem riječi <b>KDE</b> na Google(TM) traÅŸilici.\n"
     65"Enable shortcuts that allow you to quickly search for information on the web. "
     66"For example, entering the shortcut <b>gg:KDE</b> will result in a search for "
     67"the word <b>KDE</b> on the Google(TM) search engine.\n"
     68"</qt>"
     69msgstr ""
     70"<qt>\n"
     71"Omogućite prečace koji Vam omogućuju brzo pretraÅŸivanje informacija na "
     72"Internetu- Na primjer, unoÅ¡enjem prečice <b>gg:KDE</b> će rezultirati "
     73"traÅŸenjem riječi <b>KDE</b> na Google(TM) traÅŸilici.\n"
    5574"</qt>"
    5675
     
    6483#. +> trunk stable
    6584#: ikwsopts_ui.ui:32
    66 #, fuzzy
    6785msgid "&Use selected shortcuts only"
    68 msgstr "Pomakni prema lijevo"
     86msgstr "Koristi sam&o odabrane prečace"
    6987
    7088#. i18n: ectx: property (whatsThis), widget (QPushButton, pbNew)
     
    110128msgid ""
    111129"<qt>\n"
    112 "Select the search engine to use for input boxes that provide automatic lookup services when you type in normal words and phrases instead of a URL. To disable this feature select <b>None</b> from the list.\n"
    113 "</qt>"
    114 msgstr ""
    115 "<qt>\n"
    116 "Odaberite traÅŸilicu za koriÅ¡tenje u poljima koja pruÅŸaju uslugu automatske pretrage dok unosite tekst u njih umjesto URL-a. Za isključenje te mogućnosti, odaberite <b>NiÅ¡ta</b> iz popisa.\n"
     130"Select the search engine to use for input boxes that provide automatic lookup "
     131"services when you type in normal words and phrases instead of a URL. To "
     132"disable this feature select <b>None</b> from the list.\n"
     133"</qt>"
     134msgstr ""
     135"<qt>\n"
     136"Odaberite traÅŸilicu za koriÅ¡tenje u poljima koja pruÅŸaju uslugu automatske "
     137"pretrage dok unosite tekst u njih umjesto URL-a. Za isključenje te "
     138"mogućnosti, odaberite <b>NiÅ¡ta</b> iz popisa.\n"
    117139"</qt>"
    118140
     
    127149#. +> trunk stable
    128150#: ikwsopts_ui.ui:176 ikwsopts_ui.ui:198
    129 msgid "Choose the delimiter that separates the keyword from the phrase or word to be searched."
    130 msgstr "Odaberite razdvojnik koji razdvaja ključnu riječ od fraze ili riječi koja se pretraÅŸuje."
     151msgid ""
     152"Choose the delimiter that separates the keyword from the phrase or word to be "
     153"searched."
     154msgstr ""
     155"Odaberite razdvojnik koji razdvaja ključnu riječ od fraze ili riječi koja se "
     156"pretraÅŸuje."
    131157
    132158#. i18n: ectx: property (text), widget (QLabel, lbDelimiter)
     
    150176#. +> trunk stable
    151177#: kuriikwsfilter.cpp:125
    152 #, fuzzy
    153178msgid "No preferred search providers were found."
    154 msgstr "nije pronađen valjani rukovoditelj pretraÅŸivanja."
     179msgstr "Nije pronađen ni jedan preferirani pretraÅŸivački pruÅŸatelj."
    155180
    156181#. +> trunk stable
    157182#: kuriikwsfilter.cpp:144
    158 #, fuzzy
    159183msgid "No search providers were found."
    160 msgstr "Nova pretraga za pruÅŸateljem usluga"
     184msgstr "Nije pronađen ni jedan pretraÅŸivački pruÅŸatelj."
    161185
    162186#. +> trunk stable
     
    182206#. +> trunk stable
    183207#: searchproviderdlg.cpp:106
    184 #, fuzzy, kde-format
    185 msgid "The shortcut \"%1\" is already assigned to \"%2\". Please choose a different one."
    186 msgstr "Nadimak je već u upotrebi. Odaberite drugi nadimak."
     208#, kde-format
     209msgid ""
     210"The shortcut \"%1\" is already assigned to \"%2\". Please choose a different "
     211"one."
     212msgstr ""
     213"Prečac \"%1\" je već pridruÅŸen na \"%2\". Molim odaberite drugačiji prečac."
    187214
    188215#. +> trunk stable
     
    205232msgid ""
    206233"The URI does not contain a \\{...} placeholder for the user query.\n"
    207 "This means that the same page is always going to be visited, regardless of what the user types."
     234"This means that the same page is always going to be visited, regardless of "
     235"what the user types."
    208236msgstr ""
    209237"URI ne sadrÅŸi \\
} oznaku za korisnički upit.\n"
     
    238266msgid ""
    239267"<qt>\n"
    240 "Enter the URI that is used to perform a search on the search engine here.<br/>The whole text to be searched for can be specified as \\{@} or \\{0}.<br/>\n"
    241 "Recommended is \\{@}, since it removes all query variables (name=value) from the resulting string, whereas \\{0} will be substituted with the unmodified query string.<br/>You can use \\{1} ... \\{n} to specify certain words from the query and \\{name} to specify a value given by 'name=value' in the user query.<br/>In addition it is possible to specify multiple references (names, numbers and strings) at once (\\{name1,name2,...,\"string\"}).<br/>The first matching value (from the left) will be used as the substitution value for the resulting URI.<br/>A quoted string can be used as the default value if nothing matches from the left of the reference list.\n"
    242 "</qt>"
    243 msgstr ""
    244 "<qt>\n"
    245 "Ovdje unesite URI koji se koristi za traÅŸenje na traÅŸilici.<br/> Cijeli tekst za pretragu se moÅŸe odrediti kao \\{@} ili \\{0}.<br/> \n"
    246 "Preporučeno je \\{@}, jer on ukloni sve varijable upita (ime=vrijednost) iz rezultata, dok će \\{0} biti zamijenjen sa nepromijenjenim upitom.<br/> MoÅŸete koristiti \\{1}
 \\{n} za specificiranje određenih riječi iz upita i \\{ime} za specificiranje vrijednosti dobivene kao 'ime=vrijednost' iz korisničkog upita.<br/> Također je moguće specificirati viÅ¡e referenci (imena, brojevi i tekstovi) odjednom (\\{ime1, ime2,
, \"neki nekst\"}).<br/> Prva podudarna vrijednost (s lijeva) će se koristiti kao zamjenska vrijednost za rezultirajući URI.<br/> Tekst pod navodnicima se moÅŸe koristiti kao uobičajena vrijednost ako se niÅ¡ta iz referentnog popisa ne podudara s lijeva.\n"
     268"Enter the URI that is used to perform a search on the search engine here.<br/>"
     269"The whole text to be searched for can be specified as \\{@} or \\{0}.<br/>\n"
     270"Recommended is \\{@}, since it removes all query variables (name=value) from "
     271"the resulting string, whereas \\{0} will be substituted with the unmodified "
     272"query string.<br/>You can use \\{1} ... \\{n} to specify certain words from "
     273"the query and \\{name} to specify a value given by 'name=value' in the user "
     274"query.<br/>In addition it is possible to specify multiple references (names, "
     275"numbers and strings) at once (\\{name1,name2,...,\"string\"}).<br/>The first "
     276"matching value (from the left) will be used as the substitution value for the "
     277"resulting URI.<br/>A quoted string can be used as the default value if "
     278"nothing matches from the left of the reference list.\n"
     279"</qt>"
     280msgstr ""
     281"<qt>\n"
     282"Ovdje unesite URI koji se koristi za traÅŸenje na traÅŸilici.<br/> Cijeli tekst "
     283"za pretragu se moÅŸe odrediti kao \\{@} ili \\{0}.<br/> \n"
     284"Preporučeno je \\{@}, jer on ukloni sve varijable upita (ime=vrijednost) iz "
     285"rezultata, dok će \\{0} biti zamijenjen sa nepromijenjenim upitom.<br/> "
     286"MoÅŸete koristiti \\{1}
 \\{n} za specificiranje određenih riječi iz upita i "
     287"\\{ime} za specificiranje vrijednosti dobivene kao 'ime=vrijednost' iz "
     288"korisničkog upita.<br/> Također je moguće specificirati viÅ¡e referenci "
     289"(imena, brojevi i tekstovi) odjednom (\\{ime1, ime2,
, \"neki nekst\"}).<br/> "
     290"Prva podudarna vrijednost (s lijeva) će se koristiti kao zamjenska vrijednost "
     291"za rezultirajući URI.<br/> Tekst pod navodnicima se moÅŸe koristiti kao "
     292"uobičajena vrijednost ako se niÅ¡ta iz referentnog popisa ne podudara s lijeva."
     293"\n"
    247294"</qt>"
    248295
     
    261308msgid ""
    262309"<qt>\n"
    263 "The shortcuts entered here can be used as a pseudo-URI scheme in KDE. For example, the shortcut <b>av</b> can be used as in <b>av</b>:<b>my search</b>\n"
    264 "</qt>"
    265 msgstr ""
    266 "<qt>\n"
    267 "Ovdje uneseni prečaci mogu biti koriÅ¡teni kao polu-URI shema u KDE-u. Na primjer, prečac <b>av</b> moÅŸe biti koriÅ¡ten kao u <b>av</b>:<b>moja pretraga</b>\n"
     310"The shortcuts entered here can be used as a pseudo-URI scheme in KDE. For "
     311"example, the shortcut <b>av</b> can be used as in <b>av</b>:<b>my search</b>\n"
     312"</qt>"
     313msgstr ""
     314"<qt>\n"
     315"Ovdje uneseni prečaci mogu biti koriÅ¡teni kao polu-URI shema u KDE-u. Na "
     316"primjer, prečac <b>av</b> moÅŸe biti koriÅ¡ten kao u <b>av</b>:<b>moja "
     317"pretraga</b>\n"
    268318"</qt>"
    269319
     
    278328#: searchproviderdlg_ui.ui:119
    279329msgid "Select the character set that will be used to encode your search query"
    280 msgstr "Odaberite skup znakova koji će biti koriÅ¡ten za kodiranje VaÅ¡eg upita traÅŸilici"
     330msgstr ""
     331"Odaberite skup znakova koji će biti koriÅ¡ten za kodiranje VaÅ¡eg upita "
     332"traÅŸilici"
    281333
    282334#. i18n: ectx: property (text), widget (QLabel, lbCharset)
     
    290342#: searchproviderdlg_ui.ui:141
    291343msgid "Select the character set that will be used to encode your search query."
    292 msgstr "Odaberite skup znakova koji će biti koriÅ¡ten za kodiranje VaÅ¡eg upita traÅŸilici."
     344msgstr ""
     345"Odaberite skup znakova koji će biti koriÅ¡ten za kodiranje VaÅ¡eg upita "
     346"traÅŸilici."
    293347
    294348#~ msgid "<p>In this module you can configure the web shortcuts feature. Web shortcuts allow you to quickly search or lookup words on the Internet. For example, to search for information about the KDE project using the Google engine, you simply type <b>gg:KDE</b> or <b>google:KDE</b>.</p><p>If you select a default search engine, normal words or phrases will be looked up at the specified search engine by simply typing them into applications, such as Konqueror, that have built-in support for such a feature.</p>"
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/kwin.po

    r1124 r1129  
    1212"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    1313"POT-Creation-Date: 2011-07-10 07:56+0200\n"
    14 "PO-Revision-Date: 2011-04-20 22:35+0200\n"
     14"PO-Revision-Date: 2011-07-12 17:48+0200\n"
    1515"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
    1616"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
     
    1919"Content-Transfer-Encoding: 8bit\n"
    2020"Language: hr\n"
    21 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     21"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     22"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    2223"X-Generator: Lokalize 1.2\n"
    2324"X-Poedit-Bookmarks: 110,-1,-1,-1,-1,-1,-1,-1,-1,-1\n"
     
    3435msgctxt "EMAIL OF TRANSLATORS"
    3536msgid "Your emails"
    36 msgstr "renato@translator-shop.org, zarko.pintar@gmail.com, adundovi@gmail.com, marko@dimjasevic.net"
     37msgstr ""
     38"renato@translator-shop.org, zarko.pintar@gmail.com, adundovi@gmail.com, "
     39"marko@dimjasevic.net"
    3740
    3841#. +> trunk stable
     
    4548#: composite.cpp:279
    4649#, kde-format
    47 msgid "Desktop effects have been suspended by another application.<br/>You can resume using the '%1' shortcut."
    48 msgstr "Druga je aplikacija obustavila efekte radne povrÅ¡ine.<br/>MoÅŸete ih vratiti koristeći prečac '%1'."
     50msgid ""
     51"Desktop effects have been suspended by another application.<br/>You can "
     52"resume using the '%1' shortcut."
     53msgstr ""
     54"Druga je aplikacija obustavila efekte radne povrÅ¡ine.<br/>MoÅŸete ih vratiti "
     55"koristeći prečac '%1'."
    4956
    5057#. +> stable
     
    5259msgid ""
    5360"Desktop effects were too slow and have been suspended.\n"
    54 "You can disable functionality checks in System Settings (on the Advanced tab in Desktop Effects)."
     61"You can disable functionality checks in System Settings (on the Advanced tab "
     62"in Desktop Effects)."
    5563msgstr ""
    5664"3D efekti bili su prespori pa su obustavljeni.\n"
    57 "MoÅŸete onemogućiti provjere funkcionalnosti u Postavkama sustava (unutar kartice Napredno kod 3D efekata)."
     65"MoÅŸete onemogućiti provjere funkcionalnosti u Postavkama sustava (unutar "
     66"kartice Napredno kod 3D efekata)."
    5867
    5968#. +> stable
     
    6271msgid ""
    6372"Desktop effects were too slow and have been suspended.\n"
    64 "If this was only a temporary problem, you can resume using the '%1' shortcut.\n"
    65 "You can disable functionality checks in System Settings (on the Advanced tab in Desktop Effects)."
     73"If this was only a temporary problem, you can resume using the '%1' shortcut."
     74"\n"
     75"You can disable functionality checks in System Settings (on the Advanced tab "
     76"in Desktop Effects)."
    6677msgstr ""
    6778"3D efekti bili su prespori pa su obustavljeni.\n"
    6879"Ako je ovo samo privremeni problem, moÅŸete ih vratiti koristeći prečac '%1'.\n"
    69 "Također moÅŸete onemogućiti provjere funkcionalnosti u Postavkama sustava (unutar kartice Napredno kod 3D efekata)."
     80"Također moÅŸete onemogućiti provjere funkcionalnosti u Postavkama sustava "
     81"(unutar kartice Napredno kod 3D efekata)."
    7082
    7183#. +> trunk stable
    7284#: compositingprefs.cpp:108
    73 msgid "<b>OpenGL compositing (the default) has crashed KWin in the past.</b><br>This was most likely due to a driver bug.<p>If you think that you have meanwhile upgraded to a stable driver,<br>you can reset this protection but <b>be aware that this might result in an immediate crash!</b></p><p>Alternatively, you might want to use the XRender backend instead.</p>"
     85msgid ""
     86"<b>OpenGL compositing (the default) has crashed KWin in the past.</b><br>This "
     87"was most likely due to a driver bug.<p>If you think that you have meanwhile "
     88"upgraded to a stable driver,<br>you can reset this protection but <b>be aware "
     89"that this might result in an immediate crash!</b></p><p>Alternatively, you "
     90"might want to use the XRender backend instead.</p>"
    7491msgstr ""
    7592
     
    86103#. +> trunk stable
    87104#: compositingprefs.cpp:123
    88 msgid "XRender/XFixes extensions are not available and only XRender support is compiled."
     105msgid ""
     106"XRender/XFixes extensions are not available and only XRender support is "
     107"compiled."
    89108msgstr "XRender/XFixes proširenja nisu dostupna, podrşan je samo XRender."
    90109
     
    151170#: killer/killer.cpp:70
    152171#, kde-format
    153 msgid "<p>The window \"<b>%2</b>\" is not responding. It belongs to the application <b>%1</b> (Process ID = %3, hostname = %4).</p><p>Do you wish to terminate the application process <em>including <b>all</b> of its child windows</em>?<br /><b>Any unsaved data will be lost.</b></p>"
    154 msgstr "<p>Prozor \"<b>%2</b>\" nema odziva. Pripada aplikaciji <b>%1</b> (Proces ID = %3, ime računala = %4).</p><p>Da li ÅŸelite prekinuti proces ove aplikacije <em>uključujući <b>sve</b> prozore koji joj pripadaju</em>?<br /><b>Svi nespremljeni podaci biti će izgubljeni.</b></p>"
     172msgid ""
     173"<p>The window \"<b>%2</b>\" is not responding. It belongs to the application "
     174"<b>%1</b> (Process ID = %3, hostname = %4).</p><p>Do you wish to terminate "
     175"the application process <em>including <b>all</b> of its child windows</em>?<"
     176"br /><b>Any unsaved data will be lost.</b></p>"
     177msgstr ""
     178"<p>Prozor \"<b>%2</b>\" nema odziva. Pripada aplikaciji <b>%1</b> (Proces ID "
     179"= %3, ime računala = %4).</p><p>Da li ÅŸelite prekinuti proces ove aplikacije "
     180"<em>uključujući <b>sve</b> prozore koji joj pripadaju</em>?<br /><b>Svi "
     181"nespremljeni podaci biti će izgubljeni.</b></p>"
    155182
    156183#. +> trunk stable
     
    382409#. +> trunk stable
    383410#: kwinbindings.cpp:147
    384 #, fuzzy, kde-format
     411#, kde-format
    385412#| msgid "Window to Desktop 1"
    386413msgid "Window to Desktop %1"
    387 msgstr "Prozor na radnu povrÅ¡inu 1"
     414msgstr "Prozor na radnu povrÅ¡inu %1"
    388415
    389416#. +> trunk stable
     
    419446#. +> trunk stable
    420447#: kwinbindings.cpp:157
    421 #, fuzzy, kde-format
     448#, kde-format
    422449#| msgid "Window to Screen 1"
    423450msgid "Window to Screen %1"
    424 msgstr "Prozor na zaslon 1"
     451msgstr "Prozor na zaslon %1"
    425452
    426453#. +> trunk stable
     
    441468#. +> trunk stable
    442469#: kwinbindings.cpp:169
    443 #, fuzzy, kde-format
     470#, kde-format
    444471msgid "Switch to Desktop %1"
    445472msgstr "Prebaci na radnu površinu %1"
     
    477504#. +> trunk stable
    478505#: kwinbindings.cpp:180
    479 #, fuzzy, kde-format
     506#, kde-format
    480507#| msgid "Switch to Screen 1"
    481508msgid "Switch to Screen %1"
    482 msgstr "Prebaci na zaslon 1"
     509msgstr "Prebaci na zaslon %1"
    483510
    484511#. +> trunk stable
     
    579606#. +> trunk stable
    580607#: main.cpp:179
    581 msgid "kwin: it looks like there's already a window manager running. kwin not started.\n"
    582 msgstr "kwin: izgleda da je upravitelj prozora već pokrenut. kwin nije pokrenut.\n"
     608msgid ""
     609"kwin: it looks like there's already a window manager running. kwin not "
     610"started.\n"
     611msgstr ""
     612"kwin: izgleda da je upravitelj prozora već pokrenut. kwin nije pokrenut.\n"
    583613
    584614#. +> trunk stable
     
    595625#. +> trunk stable
    596626#: main.cpp:264
    597 msgid "kwin: unable to claim manager selection, another wm running? (try using --replace)\n"
    598 msgstr "kwin: ne mogu izvrÅ¡iti zahtjev za odabir upravitelja, moÅŸda je drugi upravitelj pokrenut? (pokuÅ¡ajte koristiti --replace)\n"
     627msgid ""
     628"kwin: unable to claim manager selection, another wm running? (try using "
     629"--replace)\n"
     630msgstr ""
     631"kwin: ne mogu izvrÅ¡iti zahtjev za odabir upravitelja, moÅŸda je drugi "
     632"upravitelj pokrenut? (pokuÅ¡ajte koristiti --replace)\n"
    599633
    600634#. +> trunk stable
     
    915949msgid ""
    916950"You have selected to show a window without its border.\n"
    917 "Without the border, you will not be able to enable the border again using the mouse: use the window operations menu instead, activated using the %1 keyboard shortcut."
     951"Without the border, you will not be able to enable the border again using the "
     952"mouse: use the window operations menu instead, activated using the %1 "
     953"keyboard shortcut."
    918954msgstr ""
    919955"Odabrali ste prikazivanje prozora bez njegovog ruba.\n"
    920 "Bez ruba, nećete moći ponovo uključiti rub miÅ¡em. Umjesto toga upotrebite izbornik prozorskih operacija, koji se aktivira prečacom tipkovnice %1."
     956"Bez ruba, nećete moći ponovo uključiti rub miÅ¡em. Umjesto toga upotrebite "
     957"izbornik prozorskih operacija, koji se aktivira prečacom tipkovnice %1."
    921958
    922959#. +> trunk stable
     
    925962msgid ""
    926963"You have selected to show a window in fullscreen mode.\n"
    927 "If the application itself does not have an option to turn the fullscreen mode off you will not be able to disable it again using the mouse: use the window operations menu instead, activated using the %1 keyboard shortcut."
     964"If the application itself does not have an option to turn the fullscreen mode "
     965"off you will not be able to disable it again using the mouse: use the window "
     966"operations menu instead, activated using the %1 keyboard shortcut."
    928967msgstr ""
    929968"Odabrali ste prikazivanje prozora preko cijelog zaslona.\n"
    930 "Ako sâm program nema opciju da se način rada preko cijelog zaslona isključi, nećete ga moći isključiti upotrebom miÅ¡a. Umjesto toga upotrebite izbornik prozorskih operacija, koji se aktivira prečacom tipkovnice %1."
     969"Ako sâm program nema opciju da se način rada preko cijelog zaslona isključi, "
     970"nećete ga moći isključiti upotrebom miÅ¡a. Umjesto toga upotrebite izbornik "
     971"prozorskih operacija, koji se aktivira prečacom tipkovnice %1."
    931972
    932973#~ msgid "Window to Desktop 1"
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/kwin_clients.po

    r1123 r1129  
    1212"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    1313"POT-Creation-Date: 2011-07-08 10:23+0200\n"
    14 "PO-Revision-Date: 2011-03-14 20:32+0100\n"
     14"PO-Revision-Date: 2011-07-12 17:49+0200\n"
    1515"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
    1616"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
     
    2020"Language: hr\n"
    2121"X-Generator: Lokalize 1.2\n"
    22 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     22"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     23"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    2324"X-Environment: kde\n"
    2425"X-Accelerator-Marker: &\n"
     
    152153#. +> trunk stable
    153154#: b2/config/config.cpp:61
    154 msgid "When selected, the window borders are drawn using the titlebar colors; otherwise, they are drawn using normal border colors."
    155 msgstr "Kada je označeno, rubovi prozora iscrtavati će se koristeći boje naslovne trake; inače će se iscrtavati koristeći uobićajene boje ruba."
     155msgid ""
     156"When selected, the window borders are drawn using the titlebar colors; "
     157"otherwise, they are drawn using normal border colors."
     158msgstr ""
     159"Kada je označeno, rubovi prozora iscrtavati će se koristeći boje naslovne "
     160"trake; inače će se iscrtavati koristeći uobićajene boje ruba."
    156161
    157162#. +> trunk stable
     
    162167#. +> trunk stable
    163168#: b2/config/config.cpp:69
    164 msgid "When selected, decorations are drawn with a \"grab handle\" in the bottom right corner of the windows; otherwise, no grab handle is drawn."
    165 msgstr "Kada je označeno, ukrasi će biti iscrtani sa \"oznakom uhvati\" u donjem desnom kutu prozora; inače se neće iscratvati oznaka hvatanja."
     169msgid ""
     170"When selected, decorations are drawn with a \"grab handle\" in the bottom "
     171"right corner of the windows; otherwise, no grab handle is drawn."
     172msgstr ""
     173"Kada je označeno, ukrasi će biti iscrtani sa \"oznakom uhvati\" u donjem "
     174"desnom kutu prozora; inače se neće iscratvati oznaka hvatanja."
    166175
    167176#. +> trunk stable
     
    172181#. +> trunk stable
    173182#: b2/config/config.cpp:77
    174 msgid "When selected, titlebars are automatically relocated to visible positions; otherwise, they are only moved manually using shift+drag."
    175 msgstr "Kad je odabrano, naslovne su trake automatski relocirane na vidljive pozicije; u suprotnom, moguće ih je samo ručno pomicati koristeći shift+povlačenje."
     183msgid ""
     184"When selected, titlebars are automatically relocated to visible positions; "
     185"otherwise, they are only moved manually using shift+drag."
     186msgstr ""
     187"Kad je odabrano, naslovne su trake automatski relocirane na vidljive "
     188"pozicije; u suprotnom, moguće ih je samo ručno pomicati koristeći "
     189"shift+povlačenje."
    176190
    177191#. +> trunk stable
     
    207221#. +> trunk stable
    208222#: b2/config/config.cpp:93
    209 msgid "An action can be associated to a double click of the menu button. Leave it to none if in doubt."
    210 msgstr "Radnja moÅŸe biti pridruÅŸena dvostrukom kliku gumba izbornika. Ostavite na niÅ¡ta ako se dvoumite."
     223msgid ""
     224"An action can be associated to a double click of the menu button. Leave it to "
     225"none if in doubt."
     226msgstr ""
     227"Radnja moÅŸe biti pridruÅŸena dvostrukom kliku gumba izbornika. Ostavite na "
     228"niÅ¡ta ako se dvoumite."
    211229
    212230#. +> trunk stable
     
    217235#. +> trunk
    218236#: oxygen/config/oxygenconfigurationui.cpp:145
    219 #, fuzzy
    220237msgid "Hide Advanced Configuration Options"
    221 msgstr "Izvorni kod"
     238msgstr "Sakrij napredne opcije podeÅ¡avanja"
    222239
    223240#. +> trunk
    224241#: oxygen/config/oxygenconfigurationui.cpp:145
    225 #, fuzzy
    226242msgid "Show Advanced Configuration Options"
    227 msgstr "Nema opcija za konfiguriranje"
     243msgstr "PrikaÅŸi napredne opcije podeÅ¡avanja"
    228244
    229245#. +> trunk stable
     
    792808#. +> trunk stable
    793809#: plastik/config/configdialog.ui:53
    794 msgid "Check this option if the window border should be painted in the titlebar color. Otherwise it will be painted in the background color."
    795 msgstr "Označite ovu opciju kako bi rub prozora bio obojan u boju naslovne trake. Inače će biti obojan u boju pozadine."
     810msgid ""
     811"Check this option if the window border should be painted in the titlebar "
     812"color. Otherwise it will be painted in the background color."
     813msgstr ""
     814"Označite ovu opciju kako bi rub prozora bio obojan u boju naslovne trake. "
     815"Inače će biti obojan u boju pozadine."
    796816
    797817#. i18n: ectx: property (text), widget (QCheckBox, coloredBorder)
     
    804824#. +> trunk stable
    805825#: plastik/config/configdialog.ui:66
    806 msgid "Check this option if you want the titlebar text to have a 3D look with a shadow behind it."
    807 msgstr "Označite ovu opciju ako ÅŸelite da tekst naslovne trake ima 3D izgled sa sjenom ispod. "
     826msgid ""
     827"Check this option if you want the titlebar text to have a 3D look with a "
     828"shadow behind it."
     829msgstr ""
     830"Označite ovu opciju ako ÅŸelite da tekst naslovne trake ima 3D izgled sa "
     831"sjenom ispod. "
    808832
    809833#. i18n: ectx: property (text), widget (QCheckBox, titleShadow)
     
    816840#. +> trunk stable
    817841#: plastik/config/configdialog.ui:76
    818 msgid "Check this option if you want the buttons to fade in when the mouse pointer hovers over them and fade out again when it moves away."
    819 msgstr "Označite ovu opciju ako ÅŸelite da se gumbi naglase kada se prijeđe preko njih miÅ¡em i ponovo izblijede kada se miÅ¡ makne."
     842msgid ""
     843"Check this option if you want the buttons to fade in when the mouse pointer "
     844"hovers over them and fade out again when it moves away."
     845msgstr ""
     846"Označite ovu opciju ako ÅŸelite da se gumbi naglase kada se prijeđe preko njih "
     847"miÅ¡em i ponovo izblijede kada se miÅ¡ makne."
    820848
    821849#. i18n: ectx: property (text), widget (QCheckBox, animateButtons)
     
    828856#. +> trunk stable
    829857#: plastik/config/configdialog.ui:86
    830 msgid "Check this option if you want windows to be closed when you double click the menu button, similar to Microsoft Windows."
    831 msgstr "Označite ovu opciju ako ÅŸelite da se prozori zatvore kada dvaput kliknete na gumb izbornika, slično kao u Microsoft Windows-ima."
     858msgid ""
     859"Check this option if you want windows to be closed when you double click the "
     860"menu button, similar to Microsoft Windows."
     861msgstr ""
     862"Označite ovu opciju ako ÅŸelite da se prozori zatvore kada dvaput kliknete na "
     863"gumb izbornika, slično kao u Microsoft Windows-ima."
    832864
    833865#. i18n: ectx: property (text), widget (QCheckBox, menuClose)
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/kwin_effects.po

    r1123 r1129  
    1212"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    1313"POT-Creation-Date: 2011-07-08 10:23+0200\n"
    14 "PO-Revision-Date: 2011-03-14 20:48+0100\n"
     14"PO-Revision-Date: 2011-07-12 17:50+0200\n"
    1515"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
    1616"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
     
    1919"Content-Transfer-Encoding: 8bit\n"
    2020"Language: hr\n"
    21 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     21"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     22"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    2223"X-Generator: Lokalize 1.2\n"
    2324"X-Environment: kde\n"
     
    202203#. +> trunk stable
    203204#: coverswitch/coverswitch_config.ui:187
    204 msgid "Only show thumbnail bar if there are at least specified number of windows"
     205msgid ""
     206"Only show thumbnail bar if there are at least specified number of windows"
    205207msgstr "PrikaÅŸi traku sa sličicama samo ako postoji neki određeni broj prozora"
    206208
     
    414416#: cube/cube_config.ui:411
    415417msgid ""
    416 "If enabled the effect will be deactivated after rotating the cube with the mouse,\n"
     418"If enabled the effect will be deactivated after rotating the cube with the "
     419"mouse,\n"
    417420"otherwise it will remain active"
    418421msgstr ""
     
    14561459#: zoom/zoom_config.ui:25 zoom/zoom_config.ui:41
    14571460msgid "On zoom-in and zoom-out change the zoom by the defined zoom-factor."
    1458 msgstr "Pri pribliÅŸavanju ili udaljavanju promijeni zoom za definirani faktor zumiranja."
     1461msgstr ""
     1462"Pri pribliÅŸavanju ili udaljavanju promijeni zoom za definirani faktor "
     1463"zumiranja."
    14591464
    14601465#. i18n: ectx: property (text), widget (QLabel, label)
     
    14671472#. +> trunk stable
    14681473#: zoom/zoom_config.ui:66
    1469 msgid "Enable tracking of the focused location. This needs QAccessible to be enabled per application (\"export QT_ACCESSIBILITY=1\")."
    1470 msgstr "Omogući praćenje fokusirane lokacije. Za ovo treba biti omogućeno QAccessible po aplikaciji (\"export QT_ACCESSIBILITY=1\")."
     1474msgid ""
     1475"Enable tracking of the focused location. This needs QAccessible to be enabled "
     1476"per application (\"export QT_ACCESSIBILITY=1\")."
     1477msgstr ""
     1478"Omogući praćenje fokusirane lokacije. Za ovo treba biti omogućeno QAccessible "
     1479"po aplikaciji (\"export QT_ACCESSIBILITY=1\")."
    14711480
    14721481#. i18n: ectx: property (text), widget (QCheckBox, focusTrackingCheckBox)
     
    15391548#. +> trunk stable
    15401549#: zoom/zoom_config.ui:138
    1541 #, fuzzy
    15421550msgid "Push"
    1543 msgstr "Pushto"
     1551msgstr "Guranje"
    15441552
    15451553#. i18n: ectx: property (text), item, widget (QComboBox, mouseTrackingComboBox)
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/kxkb.po

    r1123 r1129  
    33# DoDo <DoDoEntertainment@gmail.com>, 2009.
    44# Andrej Dundovic <adundovi@gmail.com>, 2009, 2010.
     5# Marko DimjaÅ¡ević <marko@dimjasevic.net>, 2011.
    56msgid ""
    67msgstr ""
     
    89"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    910"POT-Creation-Date: 2011-07-08 10:23+0200\n"
    10 "PO-Revision-Date: 2010-03-18 11:06+0100\n"
    11 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
     11"PO-Revision-Date: 2011-07-12 17:54+0200\n"
     12"Last-Translator: Marko DimjaÅ¡ević <marko@dimjasevic.net>\n"
    1213"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
    1314"MIME-Version: 1.0\n"
     
    1516"Content-Transfer-Encoding: 8bit\n"
    1617"Language: hr\n"
    17 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    18 "X-Generator: Lokalize 1.0\n"
     18"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     19"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     20"X-Generator: Lokalize 1.2\n"
    1921"X-Environment: kde\n"
    2022"X-Accelerator-Marker: &\n"
     
    2325#. +> trunk stable
    2426#: flags.cpp:132
    25 #, fuzzy, kde-format
     27#, kde-format
    2628msgctxt "short layout label - full layout name"
    2729msgid "%1 - %2"
    28 msgstr "%1 – %2"
     30msgstr "%1 - %2"
    2931
    3032#. +> trunk stable
    3133#: flags.cpp:140
    32 #, fuzzy, kde-format
     34#, kde-format
    3335msgctxt "layout - variant"
    3436msgid "%1 - %2"
    35 msgstr "%1 – %2"
     37msgstr "%1 - %2"
    3638
    3739#. +> trunk stable
     
    5860#. +> trunk stable
    5961#: kcm_keyboard.cpp:58
    60 msgid "<h1>Keyboard</h1> This control module can be used to configure keyboard parameters and layouts."
    61 msgstr "<h1>Tipkovnica</h1> Ovaj kontrolni modul moÅŸe biti koriÅ¡ten za podeÅ¡avanje parametara i rasporeda tipkovnice."
     62msgid ""
     63"<h1>Keyboard</h1> This control module can be used to configure keyboard "
     64"parameters and layouts."
     65msgstr ""
     66"<h1>Tipkovnica</h1> Ovaj kontrolni modul moÅŸe biti koriÅ¡ten za podeÅ¡avanje "
     67"parametara i rasporeda tipkovnice."
    6268
    6369#. +> trunk stable
     
    6975#. +> trunk stable
    7076#: kcm_keyboard_widget.cpp:203
    71 #, fuzzy, kde-format
     77#, kde-format
    7278#| msgctxt "vendor, keyboard model"
    7379#| msgid "%1 | %2"
     
    7884#. +> trunk stable
    7985#: kcm_keyboard_widget.cpp:213
    80 #, fuzzy, kde-format
     86#, kde-format
    8187msgid "Only up to %1 keyboard layout is supported"
    8288msgid_plural "Only up to %1 keyboard layouts are supported"
    83 msgstr[0] "PodrÅŸane su samo lokalne datoteke."
    84 msgstr[1] "PodrÅŸane su samo lokalne datoteke."
    85 msgstr[2] "PodrÅŸane su samo lokalne datoteke."
     89msgstr[0] "PodrÅŸano je samo do %1 raspored tipkovnice"
     90msgstr[1] "PodrÅŸano je samo do %1 rasporeda tipkovnice"
     91msgstr[2] "PodrÅŸano je samo do %1 rasporeda tipkovnice"
    8692
    8793#. +> trunk stable
    8894#: kcm_keyboard_widget.cpp:561
    89 #, fuzzy
    9095msgctxt "no shortcuts defined"
    9196msgid "None"
     
    9499#. +> trunk stable
    95100#: kcm_keyboard_widget.cpp:577
    96 #, fuzzy, kde-format
     101#, kde-format
    97102#| msgid "%1 shortcuts"
    98103msgid "%1 shortcut"
    99104msgid_plural "%1 shortcuts"
    100105msgstr[0] "%1 prečac"
    101 msgstr[1] "%1 prečac"
    102 msgstr[2] "%1 prečac"
    103 
    104 #. +> trunk stable
    105 #: kcm_view_models.cpp:225
    106 #, fuzzy
     106msgstr[1] "%1 prečaca"
     107msgstr[2] "%1 prečaca"
     108
     109#. +> trunk stable
     110#: kcm_view_models.cpp:225
    107111#| msgid "Map"
    108112msgctxt "layout map name"
    109113msgid "Map"
    110 msgstr "Mapiranje"
     114msgstr "Preslikavanje"
    111115
    112116#. +> trunk stable
     
    127131#. +> trunk stable
    128132#: kcm_view_models.cpp:225
    129 #, fuzzy
    130133msgid "Shortcut"
    131134msgstr "Prečac"
     
    133136#. +> trunk stable
    134137#: keyboard_applet.cpp:52
    135 #, fuzzy
    136138msgid "XKB extension failed to initialize"
    137 msgstr "Biblioteka libsmbclient nije uspjeÅ¡no inicijalizirana."
     139msgstr "XKB-ovo proÅ¡irenje nije se uspjelo inicijalizirati"
    138140
    139141#. +> trunk stable
    140142#: layout_tray_icon.cpp:46 layout_tray_icon.cpp:47
    141 #, fuzzy
    142143#| msgid "Keyboard Layout"
    143144msgctxt "tooltip title"
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/libkdecorations.po

    r1123 r1129  
    33# Zarko Pintar <zarko.pintar@gmail.com>, 2009.
    44# Andrej Dundovic <adundovi@gmail.com>, 2010.
     5# Marko DimjaÅ¡ević <marko@dimjasevic.net>, 2011.
    56msgid ""
    67msgstr ""
     
    89"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    910"POT-Creation-Date: 2011-07-08 10:23+0200\n"
    10 "PO-Revision-Date: 2010-05-30 16:30+0200\n"
    11 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
     11"PO-Revision-Date: 2011-07-12 17:55+0200\n"
     12"Last-Translator: Marko DimjaÅ¡ević <marko@dimjasevic.net>\n"
    1213"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
    1314"MIME-Version: 1.0\n"
     
    1516"Content-Transfer-Encoding: 8bit\n"
    1617"Language: hr\n"
    17 "X-Generator: Lokalize 1.0\n"
    18 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     18"X-Generator: Lokalize 1.2\n"
     19"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     20"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    1921"X-Environment: kde\n"
    2022"X-Accelerator-Marker: &\n"
     
    101103#. +> trunk stable
    102104#: kdecoration_plugins_p.cpp:109
    103 #, fuzzy
    104105#| msgid "No window decoration plugin library was found."
    105106msgid "Loading of window decoration plugin library disabled in configuration."
    106 msgstr "Nije pronađen priključak biblioteke za dekoraciju prozora."
     107msgstr ""
     108"U postavkama je onemogućeno učitavanje biblioteki za priključke za dekoraciju "
     109"prozora."
    107110
    108111#. +> trunk stable
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/libplasmaclock.po

    r1123 r1129  
    44# Andrej Dundovic <andrej@dundovic.com.hr>, 2009, 2010.
    55# Marko Dimjasevic <marko@dimjasevic.net>, 2010, 2011.
     6# Marko DimjaÅ¡ević <marko@dimjasevic.net>, 2011.
    67msgid ""
    78msgstr ""
     
    910"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    1011"POT-Creation-Date: 2011-07-08 10:23+0200\n"
    11 "PO-Revision-Date: 2011-02-15 16:31+0100\n"
    12 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     12"PO-Revision-Date: 2011-07-12 17:57+0200\n"
     13"Last-Translator: Marko DimjaÅ¡ević <marko@dimjasevic.net>\n"
    1314"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
    1415"MIME-Version: 1.0\n"
     
    1617"Content-Transfer-Encoding: 8bit\n"
    1718"Language: hr\n"
    18 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     19"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     20"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    1921"X-Generator: Lokalize 1.2\n"
    2022"X-Environment: kde\n"
     
    4951#. +> trunk stable
    5052#: calendartable.cpp:663
    51 #, fuzzy, kde-format
     53#, kde-format
    5254msgctxt "Not day off: Holiday name (holiday region)"
    5355msgid "%1 (%2)"
     
    5658#. +> trunk stable
    5759#: calendartable.cpp:672
    58 #, fuzzy, kde-format
     60#, kde-format
    5961#| msgid "<i>Event</i>: %1<br>"
    6062msgid "<i>Event</i>: %1"
    61 msgstr "<i>Događaj</i>: %1<br>"
     63msgstr "<i>Događaj</i>: %1"
    6264
    6365#. +> trunk stable
    6466#: calendartable.cpp:679
    65 #, fuzzy, kde-format
     67#, kde-format
    6668#| msgid "<i>Todo</i>: %1<br>"
    6769msgid "<i>Todo</i>: %1"
    68 msgstr "<i>Za napraviti</i>: %1<br>"
     70msgstr "<i>Za napraviti</i>: %1"
    6971
    7072#. +> trunk stable
     
    7375msgctxt "All-day calendar event summary"
    7476msgid "<br>%1"
    75 msgstr ""
     77msgstr "<br>%1"
    7678
    7779#. +> trunk stable
     
    8082msgctxt "Time and summary for a calendarevent"
    8183msgid "%1<br>%2"
    82 msgstr ""
     84msgstr "%1<br>%2"
    8385
    8486#. +> trunk stable
    8587#: calendartable.cpp:701
    86 #, fuzzy, kde-format
     88#, kde-format
    8789msgctxt "Start and end time and summary for a calendar event"
    8890msgid "%1 - %2<br>%3"
    89 msgstr ""
    90 "Qt: %1\n"
    91 "KDE: %2\n"
    92 "%3: %4\n"
     91msgstr "%1 - %2<br>%3"
    9392
    9493#. +> trunk stable
     
    130129#: clockapplet.cpp:218
    131130#, kde-format
    132 msgctxt "Text sent to the text to speech service when minutes==0 and it is the 24 hour clock"
     131msgctxt ""
     132"Text sent to the text to speech service when minutes==0 and it is the 24 hour "
     133"clock"
    133134msgid "It is 1 o clock"
    134135msgid_plural "It is %1 o clock"
     
    242243#: timezonesConfig.ui:43
    243244msgid ""
    244 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n"
    245 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n"
     245"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3."
     246"org/TR/REC-html40/strict.dtd\">\n"
     247"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">"
     248"\n"
    246249"p, li { white-space: pre-wrap; }\n"
    247 "</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; font-weight:400; font-style:normal;\">\n"
    248 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Your <span style=\" font-weight:600;\">Local</span> time and time zone are defined in System Settings, in the Date and Time tab. As default, your plasma clock will use this setting.</p>\n"
    249 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">The plasma clock tooltip can display the time in several other time zones: to do so, select one or several more time zones in the list. Click on a line to select it and click on it again to deselect it. </p>\n"
    250 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">After you validate your choices with the OK button, when your mouse is over the clock, a tooltip will display the time in all the selected time zones.</p>\n"
    251 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">To select a <span style=\" font-weight:600;\">Default</span> time zone: you can either scroll over the clock with your mouse wheel and set the one you want or you can set it with \"Clock defaults to:\". .</p></body></html>"
     250"</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; "
     251"font-weight:400; font-style:normal;\">\n"
     252"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     253"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Your <span style=\" "
     254"font-weight:600;\">Local</span> time and time zone are defined in System "
     255"Settings, in the Date and Time tab. As default, your plasma clock will use "
     256"this setting.</p>\n"
     257"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     258"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">The plasma clock "
     259"tooltip can display the time in several other time zones: to do so, select "
     260"one or several more time zones in the list. Click on a line to select it and "
     261"click on it again to deselect it. </p>\n"
     262"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     263"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">After you validate "
     264"your choices with the OK button, when your mouse is over the clock, a tooltip "
     265"will display the time in all the selected time zones.</p>\n"
     266"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     267"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">To select a <span "
     268"style=\" font-weight:600;\">Default</span> time zone: you can either scroll "
     269"over the clock with your mouse wheel and set the one you want or you can set "
     270"it with \"Clock defaults to:\". .</p></body></html>"
    252271msgstr ""
    253 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n"
    254 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n"
     272"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3."
     273"org/TR/REC-html40/strict.dtd\">\n"
     274"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">"
     275"\n"
    255276"p, li { white-space: pre-wrap; }\n"
    256 "</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; font-weight:400; font-style:normal;\">\n"
    257 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">VaÅ¡e <span style=\" font-weight:600;\">lokalno</span> vrijeme i vremenska zona su definirane u Postavkama sustava, u kartici Datum i vrijeme. Uobičajeno će plasma-sat koristiti te postavke.</p>\n"
    258 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Iskočna pomoć plasma-sata moÅŸe prikazivati vrijeme iz nekoliko drugih vremenskih zona: da biste to postigli, odaberite jednu ili viÅ¡e vremenskih zona iz popisa. Kliknite na liniju za odabir iste i kliknite ponovo na nju da biste uklonili odabir iste. </p>\n"
    259 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Nakon Å¡to potvrdite svoj odabir gumbom 'U redu', svaki put kad se pokazivač miÅ¡a nađe iznad sata, pojavit će se iskočna pomoć s prikazom vremena u odabranim vremenskim zonama.</p>\n"
    260 "<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Za odabrati <span style=\" font-weight:600;\">uobičajenu</span> vremensku zonu: kotačićem miÅ¡a moÅŸete klizati iznad sata i postaviti vremensku zonu koju ÅŸelite ili je postaviti s \"Uobičajena vremenska zona:\".</p></body></html>"
     277"</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; "
     278"font-weight:400; font-style:normal;\">\n"
     279"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     280"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">VaÅ¡e <span style=\" "
     281"font-weight:600;\">lokalno</span> vrijeme i vremenska zona su definirane u "
     282"Postavkama sustava, u kartici Datum i vrijeme. Uobičajeno će plasma-sat "
     283"koristiti te postavke.</p>\n"
     284"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     285"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Iskočna pomoć "
     286"plasma-sata moÅŸe prikazivati vrijeme iz nekoliko drugih vremenskih zona: da "
     287"biste to postigli, odaberite jednu ili viÅ¡e vremenskih zona iz popisa. "
     288"Kliknite na liniju za odabir iste i kliknite ponovo na nju da biste uklonili "
     289"odabir iste. </p>\n"
     290"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     291"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Nakon Å¡to potvrdite "
     292"svoj odabir gumbom 'U redu', svaki put kad se pokazivač miÅ¡a nađe iznad sata, "
     293"pojavit će se iskočna pomoć s prikazom vremena u odabranim vremenskim zonama."
     294"</p>\n"
     295"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; "
     296"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Za odabrati <span "
     297"style=\" font-weight:600;\">uobičajenu</span> vremensku zonu: kotačićem miÅ¡a "
     298"moÅŸete klizati iznad sata i postaviti vremensku zonu koju ÅŸelite ili je "
     299"postaviti s \"Uobičajena vremenska zona:\".</p></body></html>"
    261300
    262301#. i18n: ectx: property (text), widget (QLabel, label)
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/plasma-desktop.po

    r1123 r1129  
    55# Marko Dimjasevic <marko@dimjasevic.net>, 2009, 2010, 2011.
    66# Andrej Dundovic <andrej@dundovic.com.hr>, 2009, 2010.
     7# Marko DimjaÅ¡ević <marko@dimjasevic.net>, 2011.
    78msgid ""
    89msgstr ""
     
    1011"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    1112"POT-Creation-Date: 2011-07-08 10:23+0200\n"
    12 "PO-Revision-Date: 2011-02-18 18:14+0100\n"
    13 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     13"PO-Revision-Date: 2011-07-12 17:58+0200\n"
     14"Last-Translator: Marko DimjaÅ¡ević <marko@dimjasevic.net>\n"
    1415"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
    1516"MIME-Version: 1.0\n"
     
    1819"Language: hr\n"
    1920"X-Generator: Lokalize 1.2\n"
    20 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     21"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     22"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    2123"X-Environment: kde\n"
    2224"X-Accelerator-Marker: &\n"
     
    134136#. +> trunk stable
    135137#: data/plasma-shell-desktop.kcfg:15
    136 msgid "Set to true if each virtual desktop should get its own, unique Plasma view."
    137 msgstr "Postavite na uključeno ako ÅŸelite da svaka virtualna radna povrÅ¡ina ima svoj posebni Plasma izgled."
     138msgid ""
     139"Set to true if each virtual desktop should get its own, unique Plasma view."
     140msgstr ""
     141"Postavite na uključeno ako ÅŸelite da svaka virtualna radna povrÅ¡ina ima svoj "
     142"posebni Plasma izgled."
    138143
    139144#. +> trunk stable
     
    219224#: main.cpp:42
    220225msgid "The KDE desktop, panels and widgets workspace application."
    221 msgstr "Aplikacija za KDE-ov radni prostor s widgetima, panelima i radnom povrÅ¡inom."
     226msgstr ""
     227"Aplikacija za KDE-ov radni prostor s widgetima, panelima i radnom povrÅ¡inom."
    222228
    223229#. +> trunk stable
     
    304310#: panelcontroller.cpp:191
    305311msgid "Press left mouse button and drag to a screen edge to change panel edge"
    306 msgstr "Pritisnite lijevi gumb miÅ¡a i vucite prema rubu zaslona kako biste promijenili rub panela"
     312msgstr ""
     313"Pritisnite lijevi gumb miÅ¡a i vucite prema rubu zaslona kako biste "
     314"promijenili rub panela"
    307315
    308316#. +> trunk stable
     
    314322#: panelcontroller.cpp:197
    315323msgid "Press left mouse button and drag vertically to change panel height"
    316 msgstr "Pritisnite lijevi gumb miÅ¡a i vucite vertikalno kako biste promijenili visinu panela"
     324msgstr ""
     325"Pritisnite lijevi gumb miÅ¡a i vucite vertikalno kako biste promijenili visinu "
     326"panela"
    317327
    318328#. +> trunk stable
     
    324334#: panelcontroller.cpp:206
    325335msgid "Show more options about panel alignment, visibility and other settings"
    326 msgstr "PrikaÅŸi viÅ¡e opcija o poravnanju panela, vidljivosti i drugim postavkama"
     336msgstr ""
     337"PrikaÅŸi viÅ¡e opcija o poravnanju panela, vidljivosti i drugim postavkama"
    327338
    328339#. +> trunk stable
     
    344355#: panelcontroller.cpp:275
    345356msgid "Add a spacer to the panel useful to add some space between two widgets"
    346 msgstr "Dodaj razmak u panel koji se koristi za stvaranje prostora između widgeta"
     357msgstr ""
     358"Dodaj razmak u panel koji se koristi za stvaranje prostora između widgeta"
    347359
    348360#. +> trunk stable
     
    381393#: plasmaapp.cpp:1350
    382394#, kde-format
    383 msgid "A new widget has become available on the network:<br><b>%1</b> - <i>%2</i>"
     395msgid ""
     396"A new widget has become available on the network:<br><b>%1</b> - <i>%2</i>"
    384397msgstr "Novi widget je postao dostupan na mreÅŸi:<br><b>%1</b> – <i>%2</i>"
    385398
    386399#. +> trunk stable
    387400#: plasmaapp.cpp:1361
    388 #, fuzzy
    389401#| msgid "Add to current activity"
    390402msgid "Unlock and add to current activity"
    391 msgstr "Dodaj trenutnu aktivnost"
     403msgstr "Otključaj i dodaj u trenutnu aktivnost"
    392404
    393405#. +> trunk stable
     
    398410#. +> trunk stable
    399411#: plasmaapp.cpp:1425
    400 #, fuzzy
    401412msgid "Run applications"
    402 msgstr "Dodaj aplikacije"
     413msgstr "Pokreni aplikacije"
    403414
    404415#. +> trunk stable
    405416#: plasmaapp.cpp:1426
    406417msgid "This activity template requests to run the following applications"
    407 msgstr ""
     418msgstr "Ovaj predloÅŸak aktivnosti zahtijeva pokretanje sljedećih aplikacija"
    408419
    409420#. +> trunk stable
    410421#: plasmaapp.cpp:1427
    411 #, fuzzy
    412422msgid "Run selected"
    413 msgstr "Sve odabrano"
     423msgstr "Pokreni odabrane"
    414424
    415425#. +> trunk stable
    416426#: plasmaapp.cpp:1428
    417 #, fuzzy
    418427msgid "Run none"
    419 msgstr "Način rada rada"
     428msgstr "NiÅ¡ta ne pokreći"
    420429
    421430#. +> trunk stable
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/plasma_applet_folderview.po

    r1123 r1129  
    55# Andrej Dundović <adundovi@gmail.com>, 2009.
    66# Marko Dimjasevic <marko@dimjasevic.net>, 2010.
     7# Marko DimjaÅ¡ević <marko@dimjasevic.net>, 2011.
    78msgid ""
    89msgstr ""
     
    1011"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    1112"POT-Creation-Date: 2011-07-08 10:23+0200\n"
    12 "PO-Revision-Date: 2010-07-22 18:42+0200\n"
    13 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     13"PO-Revision-Date: 2011-07-12 17:59+0200\n"
     14"Last-Translator: Marko DimjaÅ¡ević <marko@dimjasevic.net>\n"
    1415"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
    1516"MIME-Version: 1.0\n"
     
    1718"Content-Transfer-Encoding: 8bit\n"
    1819"Language: hr\n"
    19 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    20 "X-Generator: Lokalize 1.0\n"
     20"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     21"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     22"X-Generator: Lokalize 1.2\n"
    2123"X-Environment: kde\n"
    2224"X-Accelerator-Marker: &\n"
     
    2527#. +> trunk stable
    2628#: folderview.cpp:616
    27 #, fuzzy
    2829msgid "Title"
    2930msgstr "Naslov"
     
    3233#: folderview.cpp:618 folderview.cpp:620 folderview.cpp:2030
    3334#: folderview.cpp:2032
    34 #, fuzzy
    3535msgid "None"
    36 msgstr "Nijedan"
     36msgstr "NiÅ¡ta"
    3737
    3838#. +> trunk stable
    3939#: folderview.cpp:618 folderview.cpp:621 folderview.cpp:2034
    40 #, fuzzy
    4140msgid "Default"
    42 msgstr "Uobičajeno"
     41msgstr "Zadano"
    4342
    4443#. +> trunk stable
    4544#: folderview.cpp:618 folderview.cpp:622 folderview.cpp:2037
    46 #, fuzzy
    4745msgid "Full path"
    48 msgstr "Å irina &celog zaslona"
     46msgstr "Cijela putanja"
    4947
    5048#. +> trunk stable
     
    7674#. +> trunk stable
    7775#: folderview.cpp:678
    78 msgctxt "Title of the page that lets the user choose which location should the folderview show"
     76msgctxt ""
     77"Title of the page that lets the user choose which location should the "
     78"folderview show"
    7979msgid "Location"
    8080msgstr "Mjesto"
     
    8282#. +> trunk stable
    8383#: folderview.cpp:679
    84 msgctxt "Title of the page that lets the user choose how the folderview should be shown"
     84msgctxt ""
     85"Title of the page that lets the user choose how the folderview should be shown"
    8586msgid "Display"
    8687msgstr "Prikaz"
     
    8889#. +> trunk stable
    8990#: folderview.cpp:680
    90 msgctxt "Title of the page that lets the user choose how to filter the folderview contents"
     91msgctxt ""
     92"Title of the page that lets the user choose how to filter the folderview "
     93"contents"
    9194msgid "Filter"
    9295msgstr "Filtar"
     
    246249#. +> trunk stable
    247250#: folderviewDisplayConfig.ui:116
    248 msgid "Use this control to choose if you want the icons to be arranged top to bottom starting on the left side of the view, or arranged left to right starting at the top of the view."
    249 msgstr "Koristite ovu kontrolu za odabir razmjeÅ¡taja ikona. Åœelite li da se ikone razmjeste odozgo prema dolje s lijeve strane pogleda ili s lijeva na desno s početkom na vrhu?"
     251msgid ""
     252"Use this control to choose if you want the icons to be arranged top to bottom "
     253"starting on the left side of the view, or arranged left to right starting at "
     254"the top of the view."
     255msgstr ""
     256"Koristite ovu kontrolu za odabir razmjeÅ¡taja ikona. Åœelite li da se ikone "
     257"razmjeste odozgo prema dolje s lijeve strane pogleda ili s lijeva na desno s "
     258"početkom na vrhu?"
    250259
    251260#. i18n: ectx: property (text), widget (QLabel, label)
     
    258267#. +> trunk stable
    259268#: folderviewDisplayConfig.ui:136
    260 msgid "Use this control to choose the criteria by which the icons will be sorted in the view."
    261 msgstr "Koristite ovu kontrolu za odabir kriterija po kojem će se ikone sortirati u prikazu."
     269msgid ""
     270"Use this control to choose the criteria by which the icons will be sorted in "
     271"the view."
     272msgstr ""
     273"Koristite ovu kontrolu za odabir kriterija po kojem će se ikone sortirati u "
     274"prikazu."
    262275
    263276#. i18n: ectx: property (text), widget (QLabel, label_4)
     
    276289#. +> trunk stable
    277290#: folderviewDisplayConfig.ui:181
    278 msgid "Use this slider to increase or decrease the size of the icons in the view."
     291msgid ""
     292"Use this slider to increase or decrease the size of the icons in the view."
    279293msgstr "Koristite ovaj klizač za povećanje/smanjenje veličine ikona u pogledu."
    280294
     
    294308#. +> trunk stable
    295309#: folderviewDisplayConfig.ui:224
    296 msgid "Check this option if you want to see previews of the file contents in the icons."
    297 msgstr "Uključite ovu opciju ako ÅŸelite vidjeti pretpreglede sadrÅŸaja datoteka u ikonama."
     310msgid ""
     311"Check this option if you want to see previews of the file contents in the "
     312"icons."
     313msgstr ""
     314"Uključite ovu opciju ako ÅŸelite vidjeti pretpreglede sadrÅŸaja datoteka u "
     315"ikonama."
    298316
    299317#. i18n: ectx: property (whatsThis), widget (QPushButton, previewsAdvanced)
    300318#. +> trunk stable
    301319#: folderviewDisplayConfig.ui:234
    302 msgid "Click this button to choose for which types of files previews will be shown."
    303 msgstr "Kliknite na ovaj gumb da biste odabrali koje za koje tipove datoteka će biti prikazani pretpregledi."
     320msgid ""
     321"Click this button to choose for which types of files previews will be shown."
     322msgstr ""
     323"Kliknite na ovaj gumb da biste odabrali koje za koje tipove datoteka će biti "
     324"prikazani pretpregledi."
    304325
    305326#. i18n: ectx: property (text), widget (QPushButton, previewsAdvanced)
     
    321342"Check this option if you do not want the icons to be moveable in the view.\n"
    322343"\n"
    323 "This option is useful if you want to avoid accidentally moving the icons while interacting with them."
     344"This option is useful if you want to avoid accidentally moving the icons "
     345"while interacting with them."
    324346msgstr ""
    325347"Uključite ovu opciju ako ne şelite da se ikone mogu premjestati po pogledu.\n"
    326348"\n"
    327 "Ova opcija je korisna ako ÅŸelite spriječiti nehotično pomicanje ikona dok klikate po njima."
     349"Ova opcija je korisna ako ÅŸelite spriječiti nehotično pomicanje ikona dok "
     350"klikate po njima."
    328351
    329352#. i18n: ectx: property (text), widget (QLabel, label_12)
     
    339362"Check this option if you want the icons to be arranged in a grid.\n"
    340363"\n"
    341 "When this option is checked, icons will automatically snap to the nearest grid cell when you move them around in the view."
     364"When this option is checked, icons will automatically snap to the nearest "
     365"grid cell when you move them around in the view."
    342366msgstr ""
    343367"Uključite ovu opciju ako şelite da se ikone razmjeste po mreşi.\n"
    344368"\n"
    345 "Kad je ta opcija uključena, ikone automatski skoće u najbliÅŸu ćeliju mreÅŸe dok ih pomičete po pogledu."
     369"Kad je ta opcija uključena, ikone automatski skoće u najbliÅŸu ćeliju mreÅŸe "
     370"dok ih pomičete po pogledu."
    346371
    347372#. i18n: ectx: property (text), widget (QLabel, label_9)
     
    360385#. +> trunk stable
    361386#: folderviewDisplayConfig.ui:341
    362 msgid "Use this control to choose how many lines of text will be shown below the icons."
    363 msgstr "Koristite ovu kontrolu za odabir koliko linija teksta će se prikazati ispod ikona."
     387msgid ""
     388"Use this control to choose how many lines of text will be shown below the "
     389"icons."
     390msgstr ""
     391"Koristite ovu kontrolu za odabir koliko linija teksta će se prikazati ispod "
     392"ikona."
    364393
    365394#. i18n: ectx: property (specialValueText), widget (KIntSpinBox, numLinesEdit)
     
    384413#. +> trunk stable
    385414#: folderviewDisplayConfig.ui:389
    386 msgid "Click this button to choose the color which is used for the text labels in the view."
    387 msgstr "Kliknite na ovaj gumb da biste odabrali boju koja će biti koriÅ¡tena za natpise u pogledu."
     415msgid ""
     416"Click this button to choose the color which is used for the text labels in "
     417"the view."
     418msgstr ""
     419"Kliknite na ovaj gumb da biste odabrali boju koja će biti koriÅ¡tena za "
     420"natpise u pogledu."
    388421
    389422#. i18n: ectx: property (text), widget (QLabel, label_10)
     
    397430#: folderviewDisplayConfig.ui:416
    398431msgid ""
    399 "<html><body><p>Check this option if you want the text labels to cast a shadow on the background.</p>\n"
     432"<html><body><p>Check this option if you want the text labels to cast a shadow "
     433"on the background.</p>\n"
    400434"<p></p>\n"
    401 "<p>Shadows help make the text easier to read by making it stand out more from the background.</p>\n"
     435"<p>Shadows help make the text easier to read by making it stand out more from "
     436"the background.</p>\n"
    402437"<p></p>\n"
    403 "<p><i>Note that with dark text colors, this option will cause the text to glow with a bright halo, instead of casting a shadow.</i></p></body></html>"
    404 msgstr ""
    405 "<html><body><p>Odaberite ovu opciju ako ÅŸelite da natpisi bacaju sjenu na pozadinu.</p>\n"
     438"<p><i>Note that with dark text colors, this option will cause the text to "
     439"glow with a bright halo, instead of casting a shadow.</i></p></body></html>"
     440msgstr ""
     441"<html><body><p>Odaberite ovu opciju ako ÅŸelite da natpisi bacaju sjenu na "
     442"pozadinu.</p>\n"
    406443"<p></p>\n"
    407 "<p>Sjene olakÅ¡avaju čitanje teksta jer tekst izgleda kao da je \"bliÅŸe\" od pozadine.</p>\n"
     444"<p>Sjene olakÅ¡avaju čitanje teksta jer tekst izgleda kao da je \"bliÅŸe\" od "
     445"pozadine.</p>\n"
    408446"<p></p>\n"
    409 "<p><i>Primijetite da će sa tamnim bojama teksta ovaj efekt izazvati svijetljenje teksta umjesto bacanja sjene.</i></p></body></html>"
     447"<p><i>Primijetite da će sa tamnim bojama teksta ovaj efekt izazvati "
     448"svijetljenje teksta umjesto bacanja sjene.</i></p></body></html>"
    410449
    411450#. i18n: ectx: property (toolTip), widget (QComboBox, filterType)
     
    413452#: folderviewFilterConfig.ui:34
    414453msgid ""
    415 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n"
    416 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n"
     454"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3."
     455"org/TR/REC-html40/strict.dtd\">\n"
     456"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">"
     457"\n"
    417458"p, li { white-space: pre-wrap; }\n"
    418 "</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; font-weight:400; font-style:normal;\">\n"
    419 "<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">If you have selected \"Show Files Matching\" or \"Hide Files Matching\", only the files matching BOTH the conditions will be shown or hidden respectively.</p>\n"
    420 "<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">For example, if you have \"*\" as your pattern, but have nothing selected in the MIME types, no files will be shown.</p></body></html>"
    421 msgstr ""
    422 "<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/REC-html40/strict.dtd\">\n"
    423 "<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">\n"
     459"</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; "
     460"font-weight:400; font-style:normal;\">\n"
     461"<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; "
     462"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">If you have selected "
     463"\"Show Files Matching\" or \"Hide Files Matching\", only the files matching "
     464"BOTH the conditions will be shown or hidden respectively.</p>\n"
     465"<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; "
     466"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">For example, if you "
     467"have \"*\" as your pattern, but have nothing selected in the MIME types, no "
     468"files will be shown.</p></body></html>"
     469msgstr ""
     470"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3."
     471"org/TR/REC-html40/strict.dtd\">\n"
     472"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css\">"
     473"\n"
    424474"p, li { white-space: pre-wrap; }\n"
    425 "</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; font-weight:400; font-style:normal;\">\n"
    426 "<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Ako ste odabrali \"PrikaÅŸi datoteke koje se podudaraju s\" ili \"Sakrij datoteke koje se podudaraju s\", samo će datoteke koje se podudaraju s oba uvjeta biti prikazane ili sakrivene.</p>\n"
    427 "<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Na primjer, ako imate \"*\" kao izraz, ali niste niÅ¡ta odabrali u mimetipovima, niÅ¡ta neće biti prikazano.</p></body></html>"
     475"</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; "
     476"font-weight:400; font-style:normal;\">\n"
     477"<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; "
     478"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Ako ste odabrali "
     479"\"PrikaÅŸi datoteke koje se podudaraju s\" ili \"Sakrij datoteke koje se "
     480"podudaraju s\", samo će datoteke koje se podudaraju s oba uvjeta biti "
     481"prikazane ili sakrivene.</p>\n"
     482"<p style=\" margin-top:12px; margin-bottom:12px; margin-left:0px; "
     483"margin-right:0px; -qt-block-indent:0; text-indent:0px;\">Na primjer, ako "
     484"imate \"*\" kao izraz, ali niste niÅ¡ta odabrali u mimetipovima, niÅ¡ta neće "
     485"biti prikazano.</p></body></html>"
    428486
    429487#. i18n: ectx: property (text), item, widget (QComboBox, filterType)
     
    461519#: folderviewFilterConfig.ui:112
    462520msgid ""
    463 "Note that if you have selected \"Show Files Matching\" or \"Hide Files Matching\",\n"
    464 "only the files matching BOTH the conditions will be shown or hidden respectively.\n"
    465 "For example, if you have \"*\" as your pattern, but have nothing selected in the MIME types, no files will be shown."
    466 msgstr ""
    467 "Primijetite da ko ste odabrali \"PrikaÅŸi datoteke koje se podudaraju s\" ili \"Sakrij datoteke koje se podudaraju s\", samo će datoteke koje se podudaraju s oba uvjeta biti prikazane ili sakrivene.\n"
     521"Note that if you have selected \"Show Files Matching\" or \"Hide Files "
     522"Matching\",\n"
     523"only the files matching BOTH the conditions will be shown or hidden "
     524"respectively.\n"
     525"For example, if you have \"*\" as your pattern, but have nothing selected in "
     526"the MIME types, no files will be shown."
     527msgstr ""
     528"Primijetite da ko ste odabrali \"PrikaÅŸi datoteke koje se podudaraju s\" ili "
     529"\"Sakrij datoteke koje se podudaraju s\", samo će datoteke koje se podudaraju "
     530"s oba uvjeta biti prikazane ili sakrivene.\n"
    468531"\n"
    469 "Na primjer, ako imate \"*\" kao izraz, ali niste niÅ¡ta odabrali u mimetipovima, niÅ¡ta neće biti prikazano."
     532"Na primjer, ako imate \"*\" kao izraz, ali niste niÅ¡ta odabrali u "
     533"mimetipovima, niÅ¡ta neće biti prikazano."
    470534
    471535#. i18n: ectx: property (text), widget (QLabel, label)
     
    502566#. +> trunk stable
    503567#: folderviewFilterConfig.ui:175
    504 msgid "Space-separated list of extensions, e.g. *.txt *.od* to display only office- and text-files"
    505 msgstr "Popis ekstenzija odvojen razmakom, npr. *.txt *.od* za prikaz samo tekstualnih i uredskih datoteka"
     568msgid ""
     569"Space-separated list of extensions, e.g. *.txt *.od* to display only office- "
     570"and text-files"
     571msgstr ""
     572"Popis ekstenzija odvojen razmakom, npr. *.txt *.od* za prikaz samo "
     573"tekstualnih i uredskih datoteka"
    506574
    507575#. i18n: ectx: property (clickMessage), widget (KLineEdit, filterFilesPattern)
     
    571639#. +> trunk stable
    572640#: tooltipwidget.cpp:143
    573 #, fuzzy, kde-format
     641#, kde-format
    574642#| msgid "1 MPixel"
    575643#| msgid_plural "%1 MPixels"
    576644msgid "%1 MPixels"
    577 msgstr "%1 MegaPiksel"
     645msgstr "%1 MegaPixela"
    578646
    579647#. +> trunk stable
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/plasma_applet_launcher.po

    r1123 r1129  
    55# Andrej Dundovic <adundovi@gmail.com>, 2009, 2010.
    66# Marko Dimjasevic <marko@dimjasevic.net>, 2010.
     7# Marko DimjaÅ¡ević <marko@dimjasevic.net>, 2011.
    78msgid ""
    89msgstr ""
     
    1011"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    1112"POT-Creation-Date: 2011-07-08 10:23+0200\n"
    12 "PO-Revision-Date: 2010-11-06 12:51+0100\n"
    13 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     13"PO-Revision-Date: 2011-07-12 18:00+0200\n"
     14"Last-Translator: Marko DimjaÅ¡ević <marko@dimjasevic.net>\n"
    1415"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
    1516"MIME-Version: 1.0\n"
     
    1718"Content-Transfer-Encoding: 8bit\n"
    1819"Language: hr\n"
    19 "X-Generator: Lokalize 1.1\n"
    20 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     20"X-Generator: Lokalize 1.2\n"
     21"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     22"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    2123"X-Environment: kde\n"
    2224"X-Accelerator-Marker: &\n"
     
    4042#. +> trunk stable
    4143#: applet/applet.cpp:85
    42 msgid "Favorites, applications, computer places, recently used items and desktop sessions"
    43 msgstr "Omiljeno, aplikacije, mjesta na računalu, nedavno koriÅ¡tene stvari i sjednice radne povrÅ¡ine"
     44msgid ""
     45"Favorites, applications, computer places, recently used items and desktop "
     46"sessions"
     47msgstr ""
     48"Omiljeno, aplikacije, mjesta na računalu, nedavno koriÅ¡tene stvari i sjednice "
     49"radne povrÅ¡ine"
    4450
    4551#. +> trunk stable
     
    110116#. +> trunk stable
    111117#: core/leavemodel.cpp:55
    112 #, fuzzy
    113118#| msgid "Lock Screen"
    114119msgid "Lock screen"
     
    117122#. +> trunk stable
    118123#: core/leavemodel.cpp:57
    119 #, fuzzy
    120124msgid "Switch user"
    121125msgstr "Zamijeni korisnika"
     
    144148#. +> trunk stable
    145149#: core/leavemodel.cpp:67
    146 #, fuzzy
    147150msgid "Restart computer"
    148 msgstr "Ponovno pokretanje &računala"
     151msgstr "Ponovo pokreni računalo"
    149152
    150153#. +> trunk stable
     
    412415#. +> trunk stable
    413416#: ui/contextmenufactory.cpp:236
    414 #, fuzzy
    415417msgid "Uninstall"
    416 msgstr "Odinstaliraj"
     418msgstr "Ukloni"
    417419
    418420#. +> trunk stable
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/plasma_applet_system-monitor.po

    r1123 r1129  
    44# Andrej Dundović <adundovi@gmail.com>, 2009.
    55# Andrej Dundovic <adundovi@gmail.com>, 2010.
     6# Marko DimjaÅ¡ević <marko@dimjasevic.net>, 2011.
    67msgid ""
    78msgstr ""
     
    910"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    1011"POT-Creation-Date: 2011-07-08 10:23+0200\n"
    11 "PO-Revision-Date: 2010-02-21 10:30+0100\n"
    12 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
     12"PO-Revision-Date: 2011-07-12 18:00+0200\n"
     13"Last-Translator: Marko DimjaÅ¡ević <marko@dimjasevic.net>\n"
    1314"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
    1415"MIME-Version: 1.0\n"
     
    1617"Content-Transfer-Encoding: 8bit\n"
    1718"Language: hr\n"
    18 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    19 "X-Generator: Lokalize 1.0\n"
     19"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     20"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     21"X-Generator: Lokalize 1.2\n"
    2022"X-Environment: kde\n"
    2123"X-Accelerator-Marker: &\n"
     
    188190#. +> trunk stable
    189191#: temperature.cpp:97
    190 #, fuzzy
    191192msgid "Offset"
    192193msgstr "Pomak:"
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/plasma_engine_weather.po

    r1123 r1129  
    1111"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    1212"POT-Creation-Date: 2011-07-08 10:23+0200\n"
    13 "PO-Revision-Date: 2011-04-15 08:43+0200\n"
     13"PO-Revision-Date: 2011-07-12 18:01+0200\n"
    1414"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
    1515"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
     
    1919"Language: hr\n"
    2020"X-Generator: Lokalize 1.2\n"
    21 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     21"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     22"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    2223"X-Environment: kde\n"
    2324"X-Accelerator-Marker: &\n"
     
    28092810#. +> trunk stable
    28102811#: ions/bbcukmet/ion_bbcukmet.cpp:923 ions/envcan/ion_envcan.cpp:1680
    2811 #, fuzzy
    28122812#| msgid "Sat"
    28132813msgctxt "Short for Saturday"
     
    28172817#. +> trunk stable
    28182818#: ions/bbcukmet/ion_bbcukmet.cpp:927 ions/envcan/ion_envcan.cpp:1684
    2819 #, fuzzy
    28202819#| msgid "Sun"
    28212820msgctxt "Short for Sunday"
     
    28252824#. +> trunk stable
    28262825#: ions/bbcukmet/ion_bbcukmet.cpp:931 ions/envcan/ion_envcan.cpp:1688
    2827 #, fuzzy
    28282826#| msgid "Mon"
    28292827msgctxt "Short for Monday"
     
    28332831#. +> trunk stable
    28342832#: ions/bbcukmet/ion_bbcukmet.cpp:935 ions/envcan/ion_envcan.cpp:1692
    2835 #, fuzzy
    28362833#| msgid "Tue"
    28372834msgctxt "Short for Tuesday"
     
    28412838#. +> trunk stable
    28422839#: ions/bbcukmet/ion_bbcukmet.cpp:939 ions/envcan/ion_envcan.cpp:1696
    2843 #, fuzzy
    28442840#| msgid "Wed"
    28452841msgctxt "Short for Wednesday"
     
    28492845#. +> trunk stable
    28502846#: ions/bbcukmet/ion_bbcukmet.cpp:943 ions/envcan/ion_envcan.cpp:1700
    2851 #, fuzzy
    28522847#| msgid "Thu"
    28532848msgctxt "Short for Thursday"
     
    28572852#. +> trunk stable
    28582853#: ions/bbcukmet/ion_bbcukmet.cpp:946 ions/envcan/ion_envcan.cpp:1703
    2859 #, fuzzy
    28602854#| msgid "Fri"
    28612855msgctxt "Short for Friday"
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/plasmagenericshell.po

    r1123 r1129  
    55# Andrej Dundovic <adundovi@gmail.com>, 2009, 2010.
    66# Marko Dimjasevic <marko@dimjasevic.net>, 2010.
     7# Marko DimjaÅ¡ević <marko@dimjasevic.net>, 2011.
    78msgid ""
    89msgstr ""
     
    1011"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    1112"POT-Creation-Date: 2011-07-08 10:23+0200\n"
    12 "PO-Revision-Date: 2010-11-06 13:25+0100\n"
    13 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     13"PO-Revision-Date: 2011-07-12 18:02+0200\n"
     14"Last-Translator: Marko DimjaÅ¡ević <marko@dimjasevic.net>\n"
    1415"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
    1516"MIME-Version: 1.0\n"
     
    1718"Content-Transfer-Encoding: 8bit\n"
    1819"Language: hr\n"
    19 "X-Generator: Lokalize 1.1\n"
    20 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     20"X-Generator: Lokalize 1.2\n"
     21"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     22"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    2123"X-Environment: kde\n"
    2224"X-Accelerator-Marker: &\n"
     
    4547#. +> trunk stable
    4648#: backgrounddialog.cpp:224
    47 msgid "This picture of a monitor contains a preview of what the current settings will look like on your desktop."
    48 msgstr "Slika zaslona sadrÅŸi prikaz na koji će način trenutne postavke izgledati na vaÅ¡oj radnoj povrÅ¡ini."
     49msgid ""
     50"This picture of a monitor contains a preview of what the current settings "
     51"will look like on your desktop."
     52msgstr ""
     53"Slika zaslona sadrÅŸi prikaz na koji će način trenutne postavke izgledati na "
     54"vaÅ¡oj radnoj povrÅ¡ini."
    4955
    5056#. +> trunk stable
     
    145151#. +> trunk stable
    146152#: mouseinputbutton.cpp:71
    147 msgid "Hold down the modifier keys you want, then click a mouse button or scroll a mouse wheel here"
    148 msgstr "DrÅŸite modifikatorsku tipku koju ÅŸelite, zatim ovdje pritisnite gumb miÅ¡a ili zavrtite kotačić miÅ¡a"
     153msgid ""
     154"Hold down the modifier keys you want, then click a mouse button or scroll a "
     155"mouse wheel here"
     156msgstr ""
     157"DrÅŸite modifikatorsku tipku koju ÅŸelite, zatim ovdje pritisnite gumb miÅ¡a ili "
     158"zavrtite kotačić miÅ¡a"
    149159
    150160#. +> trunk stable
     
    201211#. +> trunk stable
    202212#: scripting/i18n.cpp:33
    203 #, fuzzy
    204213msgid "i18n() takes at least one argument"
    205 msgstr "i18n() uzima barem jedan argument"
     214msgstr "i18n() treba barem jedan argument"
    206215
    207216#. +> trunk stable
    208217#: scripting/i18n.cpp:52
    209 #, fuzzy
    210218msgid "i18nc() takes at least two arguments"
    211 msgstr "i18nc() uzima barem 2 argumenta"
     219msgstr "i18nc() treba barem dva argumenta"
    212220
    213221#. +> trunk stable
    214222#: scripting/i18n.cpp:72
    215 #, fuzzy
    216223msgid "i18np() takes at least two arguments"
    217 msgstr "i18np() uzima barem 2 argumenta"
     224msgstr "i18np() treba barem dva argumenta"
    218225
    219226#. +> trunk stable
    220227#: scripting/i18n.cpp:97
    221 #, fuzzy
    222228msgid "i18ncp() takes at least three arguments"
    223 msgstr "i18ncp() uzima barem 3 argumenta"
     229msgstr "i18ncp() treba barem tri argumenta"
    224230
    225231#. +> trunk stable
     
    288294#: widgetsexplorer/appletsfiltering.cpp:321
    289295#, kde-format
    290 msgctxt "%1 is a type of widgets, as defined by e.g. some plasma-packagestructure-*.desktop files"
     296msgctxt ""
     297"%1 is a type of widgets, as defined by e.g. some plasma-packagestructure-*."
     298"desktop files"
    291299msgid "Download New %1"
    292300msgstr "Skini novi %1"
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/plasmapkg.po

    r1123 r1129  
    44# Andrej Dundovic <adundovi@gmail.com>, 2009, 2010.
    55# Marko Dimjasevic <marko@dimjasevic.net>, 2010.
     6# Marko DimjaÅ¡ević <marko@dimjasevic.net>, 2011.
    67msgid ""
    78msgstr ""
     
    910"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    1011"POT-Creation-Date: 2011-07-08 10:23+0200\n"
    11 "PO-Revision-Date: 2010-11-06 13:31+0100\n"
    12 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     12"PO-Revision-Date: 2011-07-12 18:06+0200\n"
     13"Last-Translator: Marko DimjaÅ¡ević <marko@dimjasevic.net>\n"
    1314"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
    1415"MIME-Version: 1.0\n"
     
    1617"Content-Transfer-Encoding: 8bit\n"
    1718"Language: hr\n"
    18 "X-Generator: Lokalize 1.1\n"
    19 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     19"X-Generator: Lokalize 1.2\n"
     20"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     21"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    2022"X-Environment: kde\n"
    2123"X-Accelerator-Marker: &\n"
     
    3032msgctxt "EMAIL OF TRANSLATORS"
    3133msgid "Your emails"
    32 msgstr "zarko.pintar@gmail.com, DoDoEntertainment@gmail.com, adundovi@gmail.com"
     34msgstr ""
     35"zarko.pintar@gmail.com, DoDoEntertainment@gmail.com, adundovi@gmail.com"
    3336
    3437#. +> trunk stable
     
    3942#. +> trunk stable
    4043#: main.cpp:80
    41 #, fuzzy
    4244msgid "Addon Name"
    43 msgstr "Ime zvuka"
     45msgstr "Naziv dodatka"
    4446
    4547#. +> trunk stable
    4648#: main.cpp:81
    47 #, fuzzy
    4849msgid "Service Type"
    4950msgstr "Tip usluge"
     
    5152#. +> trunk stable
    5253#: main.cpp:82
    53 #, fuzzy
    5454msgid "Path"
    5555msgstr "Putanja"
     
    6767#. +> trunk stable
    6868#: main.cpp:126
    69 #, fuzzy
    7069msgid "DataEngine"
    71 msgstr "PodrÅ¡ke za podatke"
     70msgstr "Podatkovni mehanizam"
    7271
    7372#. +> trunk stable
    7473#: main.cpp:127
    75 #, fuzzy
    7674#| msgctxt "package type"
    7775#| msgid "layout-template"
    7876msgid "Layout Template"
    79 msgstr "predloÅŸak-izgleda"
     77msgstr "PredloÅŸak izgleda"
    8078
    8179#. +> trunk stable
    8280#: main.cpp:128
    83 #, fuzzy
    8481msgid "Plasmoid"
    85 msgstr "plasmoid"
     82msgstr "Plasmoid"
    8683
    8784#. +> trunk stable
    8885#: main.cpp:129
    89 #, fuzzy
    9086#| msgctxt "package type"
    9187#| msgid "runner"
    9288msgid "Runner"
    93 msgstr "pokretač"
     89msgstr "Pokretač"
    9490
    9591#. +> trunk stable
    9692#: main.cpp:130
    97 #, fuzzy
    9893msgid "Theme"
    9994msgstr "Tema"
     
    10196#. +> trunk stable
    10297#: main.cpp:131
    103 #, fuzzy
    10498msgid "Wallpaper Images"
    105 msgstr "Sljedeća slika podloge"
     99msgstr "Slike za pozadinu"
    106100
    107101#. +> trunk stable
    108102#: main.cpp:132
    109 #, fuzzy
    110103#| msgctxt "package type"
    111104#| msgid "wallpaperplugin"
    112105msgid "Wallpaper Plugin"
    113 msgstr "priključakpodloge"
     106msgstr "Priključak za pozadinsku sliku"
    114107
    115108#. +> trunk stable
     
    146139#: main.cpp:184
    147140msgid "For install or remove, operates on packages installed for all users."
    148 msgstr "Za instalaciju ili uklanjanje, radi s paketima instaliranima za sve korisnike."
     141msgstr ""
     142"Za instalaciju ili uklanjanje, radi s paketima instaliranima za sve korisnike."
    149143
    150144#. +> trunk stable
    151145#: main.cpp:190
    152 msgctxt "theme, wallpaper, etc. are keywords, but they may be translated, as both versions are recognized by the application (if translated, should be same as messages with 'package type' context below)"
    153 msgid "The type of package, e.g. theme, wallpaper, plasmoid, dataengine, runner, layout-template, etc."
    154 msgstr "Vrsta paketa, npr. tema, podloga, plasmoid, podatkovni mehanizam (dataengine), pokretač, predloÅŸak-izgleda itd."
     146msgctxt ""
     147"theme, wallpaper, etc. are keywords, but they may be translated, as both "
     148"versions are recognized by the application (if translated, should be same as "
     149"messages with 'package type' context below)"
     150msgid ""
     151"The type of package, e.g. theme, wallpaper, plasmoid, dataengine, runner, "
     152"layout-template, etc."
     153msgstr ""
     154"Vrsta paketa, npr. tema, podloga, plasmoid, podatkovni mehanizam "
     155"(dataengine), pokretač, predloÅŸak-izgleda itd."
    155156
    156157#. +> trunk stable
     
    184185#. +> trunk stable
    185186#: main.cpp:203
    186 msgid "Absolute path to the package root. If not supplied, then the standard data directories for this KDE session will be searched instead."
    187 msgstr "Apsolutna putanja do korijena paketa. Ako nije zadana, tada će biti pretraÅŸeni standardni direktoriji podataka za trenutnu KDE sjednicu."
     187msgid ""
     188"Absolute path to the package root. If not supplied, then the standard data "
     189"directories for this KDE session will be searched instead."
     190msgstr ""
     191"Apsolutna putanja do korijena paketa. Ako nije zadana, tada će biti "
     192"pretraÅŸeni standardni direktoriji podataka za trenutnu KDE sjednicu."
    188193
    189194#. +> trunk stable
     
    243248#. +> trunk stable
    244249#: main.cpp:329
    245 msgctxt "The user entered conflicting options packageroot and global, this is the error message telling the user he can use only one"
    246 msgid "The packageroot and global options conflict each other, please select only one."
    247 msgstr "Korijen paketa i globalne opcije se međusobno sukobljavaju. Molim odaberite samo jedno."
     250msgctxt ""
     251"The user entered conflicting options packageroot and global, this is the "
     252"error message telling the user he can use only one"
     253msgid ""
     254"The packageroot and global options conflict each other, please select only "
     255"one."
     256msgstr ""
     257"Korijen paketa i globalne opcije se međusobno sukobljavaju. Molim odaberite "
     258"samo jedno."
    248259
    249260#. +> trunk stable
     
    279290#. +> trunk stable
    280291#: main.cpp:374
    281 msgctxt "No option was given, this is the error message telling the user he needs at least one, do not translate install, remove, upgrade nor list"
     292msgctxt ""
     293"No option was given, this is the error message telling the user he needs at "
     294"least one, do not translate install, remove, upgrade nor list"
    282295msgid "One of install, remove, upgrade or list is required."
    283296msgstr "Potrebno je jedno od install, remove, upgrade ili list."
  • TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdelibs/kdecalendarsystems.po

    r1123 r1129  
    1313"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    1414"POT-Creation-Date: 2011-07-08 10:24+0200\n"
    15 "PO-Revision-Date: 2011-05-05 10:21+0200\n"
     15"PO-Revision-Date: 2011-07-12 17:17+0200\n"
    1616"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
    1717"Language-Team: Croatian <kde-croatia-list@lists.sourceforge.net>\n"
     
    2020"Content-Transfer-Encoding: 8bit\n"
    2121"Language: hr\n"
    22 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     22"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
     23"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    2324"X-Generator: Lokalize 1.2\n"
    2425"X-Poedit-Language: Croatian\n"
     
    3940msgctxt "@item Calendar system"
    4041msgid "Gregorian"
    41 msgstr "Gruzijski"
     42msgstr "Gregorijanski"
    4243
    4344#. +> trunk stable
     
    5758msgctxt "@item Calendar system"
    5859msgid "Gregorian (Proleptic)"
    59 msgstr "Gruzijski (Proleptski)"
     60msgstr "Gregorijanski (Proleptski)"
    6061
    6162#. +> trunk stable
     
    138139#: kcalendarsystemcoptic.cpp:52
    139140#, c-format
    140 msgctxt "(kdedt-format) Coptic, AM, full era year format used for %EY, e.g. 2000 AM"
     141msgctxt ""
     142"(kdedt-format) Coptic, AM, full era year format used for %EY, e.g. 2000 AM"
    141143msgid "%Ey %EC"
    142144msgstr "%Ey %EC"
     
    900902#: kcalendarsystemethiopian.cpp:56
    901903#, c-format
    902 msgctxt "(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM"
     904msgctxt ""
     905"(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM"
    903906msgid "%Ey %EC"
    904907msgstr "%Ey %EC"
     
    16601663#: kcalendarsystemgregorian.cpp:66 kcalendarsystemqdate.cpp:96
    16611664#, c-format
    1662 msgctxt "(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC"
     1665msgctxt ""
     1666"(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC"
    16631667msgid "%Ey %EC"
    16641668msgstr "%Ey %EC"
     
    16941698#: kcalendarsystemqdate.cpp:106
    16951699#, c-format
    1696 msgctxt "(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD"
     1700msgctxt ""
     1701"(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD"
    16971702msgid "%Ey %EC"
    16981703msgstr "%Ey %EC"
     
    23542359#: kcalendarsystemhebrew.cpp:291
    23552360#, c-format
    2356 msgctxt "(kdedt-format) Hebrew, AM, full era year format used for %EY, e.g. 2000 AM"
     2361msgctxt ""
     2362"(kdedt-format) Hebrew, AM, full era year format used for %EY, e.g. 2000 AM"
    23572363msgid "%Ey %EC"
    23582364msgstr "%Ey %EC"
     
    29172923#: kcalendarsystemindiannational.cpp:76
    29182924#, c-format
    2919 msgctxt "(kdedt-format) Indian National, SE, full era year format used for %EY, e.g. 2000 SE"
     2925msgctxt ""
     2926"(kdedt-format) Indian National, SE, full era year format used for %EY, e.g. "
     2927"2000 SE"
    29202928msgid "%Ey %EC"
    29212929msgstr "%Ey %EC"
     
    36313639#: kcalendarsystemislamiccivil.cpp:74
    36323640#, c-format
    3633 msgctxt "(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH"
     3641msgctxt ""
     3642"(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH"
    36343643msgid "%Ey %EC"
    36353644msgstr "%Ey %EC"
     
    42804289#: kcalendarsystemjalali.cpp:82
    42814290#, c-format
    4282 msgctxt "(kdedt-format) Jalali, AP, full era year format used for %EY, e.g. 2000 AP"
     4291msgctxt ""
     4292"(kdedt-format) Jalali, AP, full era year format used for %EY, e.g. 2000 AP"
    42834293msgid "%Ey %EC"
    42844294msgstr "%Ey %EC"
     
    49554965#: kcalendarsystemjapanese.cpp:70
    49564966#, c-format
    4957 msgctxt "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year = 1, e.g. Meiji 1"
     4967msgctxt ""
     4968"(kdedt-format) Japanese, Meiji, full era year format used for %EY, year = 1, "
     4969"e.g. Meiji 1"
    49584970msgid "%EC Gannen"
    49594971msgstr "%EC Gannen"
     
    49624974#: kcalendarsystemjapanese.cpp:72
    49634975#, c-format
    4964 msgctxt "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year > 1, e.g. Meiji 22"
     4976msgctxt ""
     4977"(kdedt-format) Japanese, Meiji, full era year format used for %EY, year > 1, "
     4978"e.g. Meiji 22"
    49654979msgid "%EC %Ey"
    49664980msgstr "%EC %Ey"
     
    49754989#: kcalendarsystemjapanese.cpp:77
    49764990#, c-format
    4977 msgctxt "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year = 1, e.g. Taishō 1"
     4991msgctxt ""
     4992"(kdedt-format) Japanese, Taishō, full era year format used for %EY, year = 1, "
     4993"e.g. Taishō 1"
    49784994msgid "%EC Gannen"
    49794995msgstr "%EC Gannen"
     
    49824998#: kcalendarsystemjapanese.cpp:79
    49834999#, c-format
    4984 msgctxt "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year > 1, e.g. Taishō 22"
     5000msgctxt ""
     5001"(kdedt-format) Japanese, Taishō, full era year format used for %EY, year > 1, "
     5002"e.g. Taishō 22"
    49855003msgid "%EC %Ey"
    49865004msgstr "%EC %Ey"
     
    49955013#: kcalendarsystemjapanese.cpp:84
    49965014#, c-format
    4997 msgctxt "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year = 1, e.g. Shōwa 1"
     5015msgctxt ""
     5016"(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year = 1, "
     5017"e.g. Shōwa 1"
    49985018msgid "%EC Gannen"
    49995019msgstr "%EC Gannen"
     
    50025022#: kcalendarsystemjapanese.cpp:86
    50035023#, c-format
    5004 msgctxt "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year > 1, e.g. Shōwa 22"
     5024msgctxt ""
     5025"(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year > 1, "
     5026"e.g. Shōwa 22"
    50055027msgid "%EC %Ey"
    50065028msgstr "%EC %Ey"
     
    50155037#: kcalendarsystemjapanese.cpp:91
    50165038#, c-format
    5017 msgctxt "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year = 1, e.g. Heisei 1"
     5039msgctxt ""
     5040"(kdedt-format) Japanese, Heisei, full era year format used for %EY, year = 1, "
     5041"e.g. Heisei 1"
    50185042msgid "%EC Gannen"
    50195043msgstr "%EC Gannen"
     
    50225046#: kcalendarsystemjapanese.cpp:93
    50235047#, c-format
    5024 msgctxt "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year > 1, e.g. Heisei 22"
     5048msgctxt ""
     5049"(kdedt-format) Japanese, Heisei, full era year format used for %EY, year > 1, "
     5050"e.g. Heisei 22"
    50255051msgid "%EC %Ey"
    50265052msgstr "%EC %Ey"
     
    50595085#: kcalendarsystemjulian.cpp:88
    50605086#, c-format
    5061 msgctxt "(kdedt-format) Julian, BC, full era year format used for %EY, e.g. 2000 BC"
     5087msgctxt ""
     5088"(kdedt-format) Julian, BC, full era year format used for %EY, e.g. 2000 BC"
    50625089msgid "%Ey %EC"
    50635090msgstr "%Ey %EC"
     
    50905117#: kcalendarsystemjulian.cpp:98
    50915118#, c-format
    5092 msgctxt "(kdedt-format) Julian, AD, full era year format used for %EY, e.g. 2000 AD"
     5119msgctxt ""
     5120"(kdedt-format) Julian, AD, full era year format used for %EY, e.g. 2000 AD"
    50935121msgid "%Ey %EC"
    50945122msgstr "%Ey %EC"
     
    57295757#: kcalendarsystemminguo.cpp:63
    57305758#, c-format
    5731 msgctxt "(kdedt-format) Taiwan, ROC, full era year format used for %EY, e.g. ROC 99"
     5759msgctxt ""
     5760"(kdedt-format) Taiwan, ROC, full era year format used for %EY, e.g. ROC 99"
    57325761msgid "%EC %Ey"
    57335762msgstr "%EC %Ey"
     
    57485777#: kcalendarsystemthai.cpp:64
    57495778#, c-format
    5750 msgctxt "(kdedt-format) Thai, BE, full era year format used for %EY, e.g. 2000 BE"
     5779msgctxt ""
     5780"(kdedt-format) Thai, BE, full era year format used for %EY, e.g. 2000 BE"
    57515781msgid "%Ey %EC"
    57525782msgstr "%Ey %EC"
Note: See TracChangeset for help on using the changeset viewer.