Changeset 1036 for kde-croatia


Ignore:
Timestamp:
May 26, 2011, 3:08:15 AM (13 years ago)
Author:
kde-how-scripter
Message:

SF-KDE: Ažuriranje datoteka bazirano na zadnjim template datotekama + padeži.

Location:
kde-croatia/kde4/summit/hr/summit/messages
Files:
33 edited

Legend:

Unmodified
Added
Removed
  • kde-croatia/kde4/summit/hr/summit/messages/extragear-base/plasma_applet_networkmanagement.po

    r1027 r1036  
    77"Project-Id-Version: \n"
    88"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    9 "POT-Creation-Date: 2011-05-20 07:30+0200\n"
     9"POT-Creation-Date: 2011-05-25 09:36+0200\n"
    1010"PO-Revision-Date: 2011-03-03 22:15+0100\n"
    1111"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     
    324324
    325325#. +> trunk
    326 #: nmpopup.cpp:88 nmpopup.cpp:752
     326#: nmpopup.cpp:88 nmpopup.cpp:758
    327327msgctxt "title on the LHS of the plasmoid"
    328328msgid "<h3>Interfaces</h3>"
     
    388388
    389389#. +> trunk
    390 #: nmpopup.cpp:669
     390#: nmpopup.cpp:675
    391391msgctxt "pressed show more button"
    392392msgid "Show Less..."
     
    394394
    395395#. +> trunk
    396 #: nmpopup.cpp:674
     396#: nmpopup.cpp:680
    397397msgctxt "unpressed show more button"
    398398msgid "Show More..."
  • kde-croatia/kde4/summit/hr/summit/messages/extragear-graphics/digikam.po

    r1031 r1036  
    77"Project-Id-Version: \n"
    88"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    9 "POT-Creation-Date: 2011-05-22 08:35+0200\n"
     9"POT-Creation-Date: 2011-05-25 09:36+0200\n"
    1010"PO-Revision-Date: 2011-03-11 10:04+0100\n"
    1111"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     
    35233523
    35243524#. +> trunk
    3525 #: digikam/views/digikamview.cpp:881 libs/database/schemaupdater.cpp:965
     3525#: digikam/views/digikamview.cpp:881 libs/database/schemaupdater.cpp:964
    35263526#, fuzzy
    35273527msgid "Last Search"
     
    68516851
    68526852#. +> trunk
    6853 #: libs/database/schemaupdater.cpp:211
     6853#: libs/database/schemaupdater.cpp:210
    68546854msgid "The database is not valid: the \"DBVersion\" setting does not exist. The current database schema version cannot be verified. Try to start with an empty database. "
    68556855msgstr ""
    68566856
    68576857#. +> trunk
    6858 #: libs/database/schemaupdater.cpp:240
     6858#: libs/database/schemaupdater.cpp:239
    68596859msgid "The database has been used with a more recent version of digiKam and has been updated to a database schema which cannot be used with this version. (This means this digiKam version is too old, or the database format is too recent.) Please use the more recent version of digiKam that you used before. "
    68606860msgstr ""
    68616861
    68626862#. +> trunk
    6863 #: libs/database/schemaupdater.cpp:312
     6863#: libs/database/schemaupdater.cpp:311
    68646864#: libs/database/thumbnailschemaupdater.cpp:173
    68656865msgid ""
     
    68696869
    68706870#. +> trunk
    6871 #: libs/database/schemaupdater.cpp:334
     6871#: libs/database/schemaupdater.cpp:333
    68726872#, kde-format
    68736873msgid "Failed to open a database transaction on your database file \"%1\". This is unusual. Please check that you can access the file and no other process has currently locked the file. If the problem persists you can get help from the digikam-devel@kde.org mailing list. As well, please have a look at what digiKam prints on the console. "
     
    68756875
    68766876#. +> trunk
    6877 #: libs/database/schemaupdater.cpp:391
     6877#: libs/database/schemaupdater.cpp:390
    68786878#, kde-format
    68796879msgid "The schema updating process from version 4 to 6 failed, caused by an error that we did not expect. You can try to discard your old database and start with an empty one. (In this case, please move the database files \"%1\" and \"%2\" from the directory \"%3\"). More probably you will want to report this error to the digikam-devel@kde.org mailing list. As well, please have a look at what digiKam prints on the console. "
     
    68816881
    68826882#. +> trunk
    6883 #: libs/database/schemaupdater.cpp:419
     6883#: libs/database/schemaupdater.cpp:418
    68846884msgid "Failed to update the database schema from version 5 to version 6. Please read the error messages printed on the console and report this error as a bug at bugs.kde.org. "
    68856885msgstr ""
    68866886
    68876887#. +> trunk
    6888 #: libs/database/schemaupdater.cpp:578
     6888#: libs/database/schemaupdater.cpp:577
    68896889msgid "The database update action cannot be found. Please ensure that the dbconfig.xml file of the current version of digiKam is installed at the correct place. "
    68906890msgstr ""
    68916891
    68926892#. +> trunk
    6893 #: libs/database/schemaupdater.cpp:597
     6893#: libs/database/schemaupdater.cpp:596
    68946894msgid "Updated schema to version 6."
    68956895msgstr ""
    68966896
    68976897#. +> trunk
    6898 #: libs/database/schemaupdater.cpp:624
     6898#: libs/database/schemaupdater.cpp:623
    68996899#, kde-format
    69006900msgid "Failed to copy the old database file (\"%1\") to its new location (\"%2\"). Error message: \"%3\". Please make sure that the file can be copied, or delete it."
     
    69026902
    69036903#. +> trunk
    6904 #: libs/database/schemaupdater.cpp:644
     6904#: libs/database/schemaupdater.cpp:643
    69056905msgid "Copied database file"
    69066906msgstr ""
    69076907
    69086908#. +> trunk
    6909 #: libs/database/schemaupdater.cpp:649
     6909#: libs/database/schemaupdater.cpp:648
    69106910#, kde-format
    69116911msgid "The old database file (\"%1\") has been copied to the new location (\"%2\") but it cannot be opened. Please delete both files and try again, starting with an empty database. "
     
    69136913
    69146914#. +> trunk
    6915 #: libs/database/schemaupdater.cpp:669
     6915#: libs/database/schemaupdater.cpp:668
    69166916msgid "Opened new database file"
    69176917msgstr ""
    69186918
    69196919#. +> trunk
    6920 #: libs/database/schemaupdater.cpp:690
     6920#: libs/database/schemaupdater.cpp:689
    69216921#, kde-format
    69226922msgid "Could not update from the old SQLite2 file (\"%1\"). Please delete this file and try again, starting with an empty database. "
     
    69246924
    69256925#. +> trunk
    6926 #: libs/database/schemaupdater.cpp:706
     6926#: libs/database/schemaupdater.cpp:705
    69276927msgid "Updated from 0.7 database"
    69286928msgstr ""
    69296929
    69306930#. +> trunk
    6931 #: libs/database/schemaupdater.cpp:794
     6931#: libs/database/schemaupdater.cpp:793
    69326932msgid "Prepared table creation"
    69336933msgstr ""
    69346934
    69356935#. +> trunk
    6936 #: libs/database/schemaupdater.cpp:813
     6936#: libs/database/schemaupdater.cpp:812
    69376937msgid "Created tables"
    69386938msgstr ""
    69396939
    69406940#. +> trunk
    6941 #: libs/database/schemaupdater.cpp:826
     6941#: libs/database/schemaupdater.cpp:825
    69426942msgid "No album library path has been found in the configuration file. Giving up the schema updating process. Please try with an empty database, or repair your configuration."
    69436943msgstr ""
    69446944
    69456945#. +> trunk
    6946 #: libs/database/schemaupdater.cpp:847
     6946#: libs/database/schemaupdater.cpp:846
    69476947#, kde-format
    69486948msgid "There was an error associating your albumLibraryPath (\"%1\") with a storage volume of your system. This problem may indicate that there is a problem with your installation. If you are working on Linux, check that HAL is installed and running. In any case, you can seek advice from the digikam-devel@kde.org mailing list. The database updating process will now be aborted because we do not want to create a new database based on false assumptions from a broken installation."
     
    69506950
    69516951#. +> trunk
    6952 #: libs/database/schemaupdater.cpp:874
     6952#: libs/database/schemaupdater.cpp:873
    69536953msgid "Configured one album root"
    69546954msgstr ""
    69556955
    69566956#. +> trunk
    6957 #: libs/database/schemaupdater.cpp:900
     6957#: libs/database/schemaupdater.cpp:899
    69586958msgid "Imported albums"
    69596959msgstr ""
    69606960
    69616961#. +> trunk
    6962 #: libs/database/schemaupdater.cpp:936
     6962#: libs/database/schemaupdater.cpp:935
    69636963msgid "Imported images information"
    69646964msgstr ""
    69656965
    69666966#. +> trunk
    6967 #: libs/database/schemaupdater.cpp:967
     6967#: libs/database/schemaupdater.cpp:966
    69686968#, fuzzy
    69696969msgid "Last Search (0.9)"
     
    69716971
    69726972#. +> trunk
    6973 #: libs/database/schemaupdater.cpp:1024
     6973#: libs/database/schemaupdater.cpp:1023
    69746974msgid "Initialized and imported file suffix filter"
    69756975msgstr ""
    69766976
    69776977#. +> trunk
    6978 #: libs/database/schemaupdater.cpp:1046
     6978#: libs/database/schemaupdater.cpp:1045
    69796979msgid "Did the initial full scan"
    69806980msgstr ""
    69816981
    69826982#. +> trunk
    6983 #: libs/database/schemaupdater.cpp:1070
     6983#: libs/database/schemaupdater.cpp:1069
    69846984msgid "Imported creation dates"
    69856985msgstr ""
    69866986
    69876987#. +> trunk
    6988 #: libs/database/schemaupdater.cpp:1100
     6988#: libs/database/schemaupdater.cpp:1099
    69896989msgid "Imported comments"
    69906990msgstr ""
    69916991
    69926992#. +> trunk
    6993 #: libs/database/schemaupdater.cpp:1126
     6993#: libs/database/schemaupdater.cpp:1125
    69946994msgid "Imported ratings"
    69956995msgstr ""
    69966996
    69976997#. +> trunk
    6998 #: libs/database/schemaupdater.cpp:1137
     6998#: libs/database/schemaupdater.cpp:1136
    69996999msgid "Dropped v3 tables"
    70007000msgstr ""
  • kde-croatia/kde4/summit/hr/summit/messages/extragear-kdevelop/kdevcmake.po

    r1016 r1036  
    66"Project-Id-Version: \n"
    77"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    8 "POT-Creation-Date: 2011-05-12 09:39+0200\n"
     8"POT-Creation-Date: 2011-05-25 09:36+0200\n"
    99"PO-Revision-Date: 2010-01-24 16:58+0100\n"
    1010"Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
     
    319319
    320320#. +> trunk
    321 #: cmakemanager.cpp:1417
     321#: cmakemanager.cpp:1418
    322322#, kde-format
    323323msgid "Modify target '%2' as follows:"
     
    325325
    326326#. +> trunk
    327 #: cmakemanager.cpp:1424
     327#: cmakemanager.cpp:1425
    328328#, fuzzy
    329329msgid "CMakeLists changes failed."
     
    337337
    338338#. +> trunk
    339 #: cmakemanager.cpp:1433
     339#: cmakemanager.cpp:1434
    340340#, fuzzy, kde-format
    341341msgid "Rename '%1' to '%2':"
     
    343343
    344344#. +> trunk
    345 #: cmakemanager.cpp:1452
     345#: cmakemanager.cpp:1453
    346346msgid "Changes to CMakeLists failed, abort rename?"
    347347msgstr ""
  • kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/desktop_extragear-multimedia_amarok.po

    r1031 r1036  
    77"Project-Id-Version: desktop files\n"
    88"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    9 "POT-Creation-Date: 2011-05-22 08:35+0200\n"
     9"POT-Creation-Date: 2011-05-25 09:37+0200\n"
    1010"PO-Revision-Date: 2010-07-08 15:31+0200\n"
    1111"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     
    7878
    7979#. +> trunk
    80 #: playground/src/context/engines/jsengine/metadata.desktop:42
     80#: playground/src/context/engines/jsengine/metadata.desktop:43
    8181msgctxt "Comment"
    8282msgid "Javascript Sample Engine"
     
    322322
    323323#. +> trunk
    324 #: src/context/scriptengine/javascript/amarok-scriptengine-applet-simple-javascript.desktop:46
     324#: src/context/scriptengine/javascript/amarok-scriptengine-applet-simple-javascript.desktop:47
    325325msgctxt "Comment"
    326326msgid "Native Amarok applet written in JavaScript"
     
    372372
    373373#. +> trunk
    374 #: src/core-impl/collections/audiocd/amarok_collection-audiocdcollection.desktop:49
     374#: src/core-impl/collections/audiocd/amarok_collection-audiocdcollection.desktop:50
    375375msgctxt "Comment"
    376376msgid "AudioCd collection plugin for Amarok"
     
    432432
    433433#. +> trunk
    434 #: src/core-impl/collections/db/sql/mysqlecollection/amarok_collection-mysqlecollection.desktop:48
    435 #: src/core-impl/collections/db/sql/mysqlservercollection/amarok_collection-mysqlservercollection.desktop:48
     434#: src/core-impl/collections/db/sql/mysqlecollection/amarok_collection-mysqlecollection.desktop:49
     435#: src/core-impl/collections/db/sql/mysqlservercollection/amarok_collection-mysqlservercollection.desktop:49
    436436msgctxt "Comment"
    437437msgid "Collection plugin for Amarok"
     
    494494
    495495#. +> trunk
    496 #: src/core-impl/collections/playdarcollection/amarok_collection-playdarcollection.desktop:28
     496#: src/core-impl/collections/playdarcollection/amarok_collection-playdarcollection.desktop:29
    497497msgctxt "Comment"
    498498msgid "Music that Playdar can find"
     
    524524
    525525#. +> trunk
    526 #: src/data/amarok.notifyrc:50
     526#: src/data/amarok.notifyrc:51
    527527msgctxt "Name"
    528528msgid "Track Change"
     
    530530
    531531#. +> trunk
    532 #: src/data/amarok.notifyrc:92
     532#: src/data/amarok.notifyrc:94
    533533msgctxt "Comment"
    534534msgid "Amarok changed to a new track"
     
    542542
    543543#. +> trunk
    544 #: src/services/ampache/amarok_service_ampache.desktop:54
     544#: src/services/ampache/amarok_service_ampache.desktop:55
    545545msgctxt "Comment"
    546546msgid "Listen to music from an Ampache server"
     
    566566
    567567#. +> trunk
    568 #: src/services/gpodder/amarok_service_gpodder.desktop:24
     568#: src/services/gpodder/amarok_service_gpodder.desktop:26
    569569#, fuzzy
    570570msgctxt "Comment"
     
    582582
    583583#. +> trunk
    584 #: src/services/jamendo/amarok_service_jamendo.desktop:56
     584#: src/services/jamendo/amarok_service_jamendo.desktop:57
    585585msgctxt "Comment"
    586586msgid "Listen to and download music uploaded by independent artists"
     
    594594
    595595#. +> trunk
    596 #: src/services/lastfm/amarok_service_lastfm.desktop:55
     596#: src/services/lastfm/amarok_service_lastfm.desktop:56
    597597msgctxt "Comment"
    598598msgid "A service that integrates Last.fm functionality into Amarok"
     
    642642
    643643#. +> trunk
    644 #: src/services/mp3tunes/amarok_service_mp3tunes.desktop:44
     644#: src/services/mp3tunes/amarok_service_mp3tunes.desktop:45
    645645msgctxt "Comment"
    646646msgid "Browse and listen to the music stored in your MP3tunes account"
     
    655655
    656656#. +> trunk
    657 #: src/services/mp3tunes/amarok_service_mp3tunes_config.desktop:49
     657#: src/services/mp3tunes/amarok_service_mp3tunes_config.desktop:50
    658658msgctxt "Comment"
    659659msgid "Configure mp3tunes credentials"
     
    667667
    668668#. +> trunk
    669 #: src/services/opmldirectory/amarok_service_opmldirectory.desktop:52
     669#: src/services/opmldirectory/amarok_service_opmldirectory.desktop:53
    670670msgctxt "Comment"
    671671msgid "Browse and subscribe to a huge list of podcasts"
  • kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/desktop_extragear-multimedia_k3b.po

    r1031 r1036  
    88"Project-Id-Version: desktop files\n"
    99"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    10 "POT-Creation-Date: 2011-05-22 08:35+0200\n"
     10"POT-Creation-Date: 2011-05-25 09:37+0200\n"
    1111"PO-Revision-Date: 2011-05-21 13:00+0200\n"
    1212"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
     
    2929
    3030#. +> trunk stable
    31 #: k3bsetup/k3bsetup.actions:41
     31#: k3bsetup/k3bsetup.actions:42
    3232msgctxt "Description"
    3333msgid "Authentication is required to update permissions of devices and programs"
     
    4141
    4242#. +> trunk stable
    43 #: k3bsetup/k3bsetup.desktop:46
     43#: k3bsetup/k3bsetup.desktop:47
    4444msgctxt "Keywords"
    4545msgid "K3bSetup,k3bsetup"
     
    4747
    4848#. +> trunk stable
    49 #: k3bsetup/k3bsetup.desktop:90
     49#: k3bsetup/k3bsetup.desktop:92
    5050msgctxt "Name"
    5151msgid "K3bSetup"
     
    5353
    5454#. +> trunk stable
    55 #: k3bsetup/k3bsetup.desktop:157
     55#: k3bsetup/k3bsetup.desktop:159
    5656msgctxt "GenericName"
    5757msgid "CD/DVD/BD Burning Setup"
     
    263263
    264264#. +> trunk stable
    265 #: plugins/project/audiometainforenamer/k3baudiometainforenamerplugin.desktop:41
     265#: plugins/project/audiometainforenamer/k3baudiometainforenamerplugin.desktop:42
    266266msgctxt "Comment"
    267267msgid "Plugin to rename audio files in a data project based on the meta info."
     
    275275
    276276#. +> trunk stable
    277 #: plugins/project/audioprojectcddb/k3baudioprojectcddbplugin.desktop:45
     277#: plugins/project/audioprojectcddb/k3baudioprojectcddbplugin.desktop:46
    278278msgctxt "Comment"
    279279msgid "Plugin to query a cddb server for information about an audio project."
     
    282282# pmap: =/nom=K3b/gen=K3b-a/dat=K3b-u/aku=K3b/lok=K3b-u/ins=K3b-om/_r=m/_b=j/
    283283#. +> trunk stable
    284 #: src/k3b-cue.desktop:7 src/k3b-iso.desktop:7 src/k3b.desktop:93
     284#: src/k3b-cue.desktop:7 src/k3b-iso.desktop:7 src/k3b.desktop:95
    285285msgctxt "Name"
    286286msgid "K3b"
     
    294294
    295295#. +> trunk stable
    296 #: src/k3b.desktop:49
     296#: src/k3b.desktop:50
    297297msgctxt "Comment"
    298298msgid "Disk writing program"
     
    348348
    349349#. +> trunk
    350 #: src/k3b.notifyrc:426
     350#: src/k3b.notifyrc:428
    351351msgctxt "Comment"
    352352msgid "K3b is currently busy and cannot start any other operations"
     
    354354
    355355#. +> trunk
    356 #: src/k3b.notifyrc:449
     356#: src/k3b.notifyrc:452
    357357msgctxt "Name"
    358358msgid "No problems found"
     
    360360
    361361#. +> trunk
    362 #: src/k3b.notifyrc:469
     362#: src/k3b.notifyrc:474
    363363msgctxt "Comment"
    364364msgid "No problems found in system configuration"
     
    366366
    367367#. +> trunk
    368 #: src/k3b.notifyrc:492
     368#: src/k3b.notifyrc:498
    369369msgctxt "Name"
    370370msgid "Mount/unmount failed"
     
    372372
    373373#. +> trunk
    374 #: src/k3b.notifyrc:510
     374#: src/k3b.notifyrc:518
    375375msgctxt "Comment"
    376376msgid "Medium cannot be mount or unmounted"
     
    378378
    379379#. +> trunk
    380 #: src/k3b.notifyrc:532
     380#: src/k3b.notifyrc:541
    381381msgctxt "Name"
    382382msgid "Track data not found"
     
    384384
    385385#. +> trunk
    386 #: src/k3b.notifyrc:550
     386#: src/k3b.notifyrc:561
    387387msgctxt "Comment"
    388388msgid "Track information has not been found in the online database"
  • kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/desktop_extragear-multimedia_kmid.po

    r1031 r1036  
    66"Project-Id-Version: desktop files\n"
    77"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    8 "POT-Creation-Date: 2011-05-22 08:35+0200\n"
     8"POT-Creation-Date: 2011-05-25 09:37+0200\n"
    99"PO-Revision-Date: 2010-01-24 16:33+0100\n"
    1010"Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
     
    2727
    2828#. +> trunk
    29 #: alsa/kmid_alsa.desktop:46
     29#: alsa/kmid_alsa.desktop:47
    3030msgctxt "Comment"
    3131msgid "ALSA sequencer backend"
     
    4040
    4141#. +> trunk
    42 #: dummy/kmid_dummy.desktop:44
     42#: dummy/kmid_dummy.desktop:45
    4343#, fuzzy
    4444msgctxt "Comment"
     
    5454
    5555#. +> trunk
    56 #: examples/kmidtest/kmidtest.desktop:31
     56#: examples/kmidtest/kmidtest.desktop:32
    5757#, fuzzy
    5858msgctxt "GenericName"
     
    7575
    7676#. +> trunk
    77 #: mac/kmid_mac.desktop:44
     77#: mac/kmid_mac.desktop:45
    7878#, fuzzy
    7979msgctxt "Comment"
     
    102102
    103103#. +> trunk
    104 #: src/kmid_part.desktop:40
     104#: src/kmid_part.desktop:41
    105105#, fuzzy
    106106msgctxt "GenericName"
     
    116116
    117117#. +> trunk
    118 #: win/kmid_win.desktop:44
     118#: win/kmid_win.desktop:45
    119119#, fuzzy
    120120msgctxt "Comment"
  • kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/desktop_extragear-multimedia_kplayer.po

    r1031 r1036  
    66"Project-Id-Version: desktop files\n"
    77"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    8 "POT-Creation-Date: 2011-05-22 08:35+0200\n"
     8"POT-Creation-Date: 2011-05-25 09:37+0200\n"
    99"PO-Revision-Date: 2010-01-24 16:33+0100\n"
    1010"Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
     
    7070
    7171#. +> trunk
    72 #: kplayer/kplayer.desktop:33 kplayer/kplayerpart.desktop:5
     72#: kplayer/kplayer.desktop:34 kplayer/kplayerpart.desktop:5
    7373msgctxt "Name"
    7474msgid "KPlayer"
     
    7676
    7777#. +> trunk
    78 #: kplayer/kplayer.desktop:82
     78#: kplayer/kplayer.desktop:83
    7979#, fuzzy
    8080msgctxt "GenericName"
  • kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/k3b.po

    r1035 r1036  
    77"Project-Id-Version: \n"
    88"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    9 "POT-Creation-Date: 2011-05-04 11:04+0200\n"
     9"POT-Creation-Date: 2011-05-25 09:37+0200\n"
    1010"PO-Revision-Date: 2011-05-21 13:34+0200\n"
    1111"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
     
    1515"Content-Transfer-Encoding: 8bit\n"
    1616"Language: hr\n"
    17 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
    18 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
     17"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
    1918"X-Generator: Lokalize 1.2\n"
    2019"X-Environment: kde\n"
     
    5453#. +> trunk stable
    5554#: ../plugins/decoder/flac/k3bflacdecoder.cpp:369
    56 #| msgid "FLAC"
    5755msgid "FLAC"
    5856msgstr "FLAC"
     
    276274#: ../plugins/encoder/external/base_k3bexternalencoderconfigwidget.ui:22
    277275msgid ""
    278 "<p>This dialog can be used to setup external command line applications as "
    279 "audio encoders. These can then be used by K3b to encode audio data (Tracks "
    280 "from an audio CD or the titles from an audio project) to formats that are "
    281 "normally not supported (i.e. no encoder plugin exists).\n"
    282 "<p>K3b comes with a selection of predefined external applications that "
    283 "depends on the installed applications."
     276"<p>This dialog can be used to setup external command line applications as audio encoders. These can then be used by K3b to encode audio data (Tracks from an audio CD or the titles from an audio project) to formats that are normally not supported (i.e. no encoder plugin exists).\n"
     277"<p>K3b comes with a selection of predefined external applications that depends on the installed applications."
    284278msgstr ""
    285279
     
    353347#, no-c-format
    354348msgid ""
    355 "Please insert the command used to encode the audio data. The command has to "
    356 "read raw little endian (see <em>Swap Byte Order</em>) 16-bit stereo audio "
    357 "frames from stdin.\n"
     349"Please insert the command used to encode the audio data. The command has to read raw little endian (see <em>Swap Byte Order</em>) 16-bit stereo audio frames from stdin.\n"
    358350"<p>The following strings will be replaced by K3b:<br>\n"
    359 "<b>%f</b> - The filename of the resulting file. This is where the command has "
    360 "to write its output to.<br>\n"
    361 "<em>The following refer to metadata stored for example in the ID3 tag of an "
    362 "mp3 file (Be aware that these values might be empty).</em><br>\n"
     351"<b>%f</b> - The filename of the resulting file. This is where the command has to write its output to.<br>\n"
     352"<em>The following refer to metadata stored for example in the ID3 tag of an mp3 file (Be aware that these values might be empty).</em><br>\n"
    363353"<b>%t</b> - Title<br>\n"
    364354"<b>%a</b> - Artist<br>\n"
     
    391381#: ../plugins/encoder/external/base_k3bexternalencodereditwidget.ui:119
    392382msgid ""
    393 "<p> If this option is checked K3b will swap the byte order of the input data. "
    394 "Thus, the command has to read big endian audio frames.\n"
    395 "<p>If the resulting audio file sounds bad it is highly likely that the byte "
    396 "order is wrong and this option has to be checked."
     383"<p> If this option is checked K3b will swap the byte order of the input data. Thus, the command has to read big endian audio frames.\n"
     384"<p>If the resulting audio file sounds bad it is highly likely that the byte order is wrong and this option has to be checked."
    397385msgstr ""
    398386
     
    412400#. +> trunk stable
    413401#: ../plugins/encoder/external/base_k3bexternalencodereditwidget.ui:132
    414 msgid ""
    415 "<p>If this option is checked K3b will write a wave header. This is useful in "
    416 "case the encoder application cannot read plain raw audio data."
     402msgid "<p>If this option is checked K3b will write a wave header. This is useful in case the encoder application cannot read plain raw audio data."
    417403msgstr ""
    418404
     
    588574#: ../plugins/encoder/lame/base_k3blameencodersettingswidget.ui:267
    589575msgid ""
    590 "<p>Bitrate is of course the main influence on quality. The higher the "
    591 "bitrate, the higher the quality. But for a given bitrate, we have a choice of "
    592 "algorithms to determine the best scalefactors and huffman encoding (noise "
    593 "shaping).\n"
     576"<p>Bitrate is of course the main influence on quality. The higher the bitrate, the higher the quality. But for a given bitrate, we have a choice of algorithms to determine the best scalefactors and huffman encoding (noise shaping).\n"
    594577"<p>The quality increases from 0 to 9 while the encoding speed drops.\n"
    595578"<p>9 uses the slowest & best possible version of all algorithms.\n"
    596 "<p><b>7 is the recommended setting</b> while 4 still produced reasonable "
    597 "quality at good speed.\n"
    598 "<p>0 disables almost all algorithms including psy-model resulting in poor "
    599 "quality.\n"
     579"<p><b>7 is the recommended setting</b> while 4 still produced reasonable quality at good speed.\n"
     580"<p>0 disables almost all algorithms including psy-model resulting in poor quality.\n"
    600581"<p><b>This setting has no influence on the size of the resulting file.</b>"
    601582msgstr ""
     
    641622#: ../plugins/encoder/lame/base_k3blameencodersettingswidget.ui:347
    642623msgid ""
    643 "<p>If this option is checked, LAME will enforce the 7680 bit limitation on "
    644 "total frame size.<br>\n"
    645 "This results in many wasted bits for high bitrate encodings but will ensure "
    646 "strict ISO compatibility. This compatibility might be important for hardware "
    647 "players."
     624"<p>If this option is checked, LAME will enforce the 7680 bit limitation on total frame size.<br>\n"
     625"This results in many wasted bits for high bitrate encodings but will ensure strict ISO compatibility. This compatibility might be important for hardware players."
    648626msgstr ""
    649627
     
    663641#. +> trunk stable
    664642#: ../plugins/encoder/lame/base_k3blameencodersettingswidget.ui:360
    665 msgid ""
    666 "<p>If this option is checked, a cyclic redundancy check (CRC) code will be "
    667 "added to each frame, allowing transmission errors that could occur on the MP3 "
    668 "stream to be detected; however, it takes 16 bits per frame that would "
    669 "otherwise be used for encoding, thus slightly reducing the sound quality."
     643msgid "<p>If this option is checked, a cyclic redundancy check (CRC) code will be added to each frame, allowing transmission errors that could occur on the MP3 stream to be detected; however, it takes 16 bits per frame that would otherwise be used for encoding, thus slightly reducing the sound quality."
    670644msgstr ""
    671645
     
    742716"<p>Select the channel mode of the resulting Mp3 file:\n"
    743717"<p><b>Stereo</b><br>\n"
    744 "In this mode, the encoder makes no use of potential correlations between the "
    745 "two input channels; it can, however, negotiate the bit demand between both "
    746 "channel, i.e. give one channel more bits if the other contains silence or "
    747 "needs fewer bits because of a lower complexity.\n"
     718"In this mode, the encoder makes no use of potential correlations between the two input channels; it can, however, negotiate the bit demand between both channel, i.e. give one channel more bits if the other contains silence or needs fewer bits because of a lower complexity.\n"
    748719"<p><b>Joint-Stereo</b><br>\n"
    749 "In this mode, the encoder will make use of correlations between both channels."
    750 " The signal will be matrixed into a sum (\"mid\"), computed by L+R, and "
    751 "difference (\"side\") signal, computed by L-R, and more bits are allocated to "
    752 "the mid channel. This will effectively increase the bandwidth if the signal "
    753 "does not have too much stereo separation, thus giving a significant gain in "
    754 "encoding quality.\n"
     720"In this mode, the encoder will make use of correlations between both channels. The signal will be matrixed into a sum (\"mid\"), computed by L+R, and difference (\"side\") signal, computed by L-R, and more bits are allocated to the mid channel. This will effectively increase the bandwidth if the signal does not have too much stereo separation, thus giving a significant gain in encoding quality.\n"
    755721"<p><b>Mono</b><br>\n"
    756 "The input will be encoded as a mono signal. If it was a stereo signal, it "
    757 "will be downsampled to mono. The downmix is calculated as the sum of the left "
    758 "and right channel, attenuated by 6 dB."
     722"The input will be encoded as a mono signal. If it was a stereo signal, it will be downsampled to mono. The downmix is calculated as the sum of the left and right channel, attenuated by 6 dB."
    759723msgstr ""
    760724
     
    856820#. +> trunk stable
    857821#: ../plugins/encoder/ogg/base_k3boggvorbisencodersettingswidget.ui:32
    858 msgid ""
    859 "<p>Vorbis' audio quality is not best measured in kilobits per second, but on "
    860 "a scale from -1 to 10 called \"quality\". <p>For now, quality -1 is roughly "
    861 "equivalent to 45kbps average, 5 is roughly 160kbps, and 10 gives about "
    862 "400kbps. Most people seeking very-near-CD-quality audio encode at a quality "
    863 "of 5 or, for lossless stereo coupling, 6. The default setting is quality 3, "
    864 "which at approximately 110kbps gives a smaller filesize and significantly "
    865 "better fidelity than .mp3 compression at 128kbps. <p><em>This explanation was "
    866 "copied from the www.vorbis.com FAQ.</em>"
     822msgid "<p>Vorbis' audio quality is not best measured in kilobits per second, but on a scale from -1 to 10 called \"quality\". <p>For now, quality -1 is roughly equivalent to 45kbps average, 5 is roughly 160kbps, and 10 gives about 400kbps. Most people seeking very-near-CD-quality audio encode at a quality of 5 or, for lossless stereo coupling, 6. The default setting is quality 3, which at approximately 110kbps gives a smaller filesize and significantly better fidelity than .mp3 compression at 128kbps. <p><em>This explanation was copied from the www.vorbis.com FAQ.</em>"
    867823msgstr ""
    868824
     
    914870#. +> trunk stable
    915871#: ../plugins/encoder/ogg/k3boggvorbisencoderconfigwidget.cpp:64
    916 msgid ""
    917 "<p>Vorbis' audio quality is not best measured in kilobits per second, but on "
    918 "a scale from -1 to 10 called <em>quality</em>.<p>For now, quality -1 is "
    919 "roughly equivalent to 45kbps average, 5 is roughly 160kbps, and 10 gives "
    920 "about 400kbps. Most people seeking very-near-CD-quality audio encode at a "
    921 "quality of 5 or, for lossless stereo coupling, 6. The quality 3 gives, at "
    922 "approximately 110kbps a smaller filesize and significantly better fidelity "
    923 "than .mp3 compression at 128kbps.<p><em>This explanation is based on the one "
    924 "from the www.vorbis.com FAQ.</em>"
     872msgid "<p>Vorbis' audio quality is not best measured in kilobits per second, but on a scale from -1 to 10 called <em>quality</em>.<p>For now, quality -1 is roughly equivalent to 45kbps average, 5 is roughly 160kbps, and 10 gives about 400kbps. Most people seeking very-near-CD-quality audio encode at a quality of 5 or, for lossless stereo coupling, 6. The quality 3 gives, at approximately 110kbps a smaller filesize and significantly better fidelity than .mp3 compression at 128kbps.<p><em>This explanation is based on the one from the www.vorbis.com FAQ.</em>"
    925873msgstr ""
    926874
     
    947895#: ../plugins/encoder/sox/base_k3bsoxencoderconfigwidget.ui:63
    948896msgid ""
    949 "<p>The sample data encoding is signed linear (2's complement), unsigned "
    950 "linear, u-law (logarithmic), A-law (logarithmic), ADPCM, IMA_ADPCM, GSM, or "
    951 "Floating-point.</p>\n"
    952 "<p><b>U-law</b> (actually shorthand for mu-law) and <b>A-law</b> are the U.S. "
    953 "and international standards for logarithmic telephone sound compression. When "
    954 "uncompressed u-law has roughly the precision of 14-bit PCM audio and A-law "
    955 "has roughly the precision of 13-bit PCM audio. A-law and u-law data is "
    956 "sometimes encoded using a reversed bit-ordering (i.e. MSB becomes LSB).<br> <"
    957 "b>ADPCM </b> is a form of sound compression that has a good compromise "
    958 "between good sound quality and fast encoding/decoding time. It is used for "
    959 "telephone sound compression and places where full fidelity is not as "
    960 "important. When uncompressed it has roughly the precision of 16-bit PCM audio."
    961 " Popular versions of ADPCM include G.726, MS ADPCM, and IMA ADPCM. It has "
    962 "different meanings in different file handlers. In .wav files it represents MS "
    963 "ADPCM files, in all others it means G.726 ADPCM. <br> <b>IMA ADPCM</b> is a "
    964 "specific form of ADPCM compression, slightly simpler and slightly lower "
    965 "fidelity than Microsoft's flavor of ADPCM. IMA ADPCM is also called DVI ADPCM."
    966 "<br> <b>GSM</b> is a standard used for telephone sound compression in "
    967 "European countries and is gaining popularity because of its good quality. It "
    968 "is usually CPU intensive to work with GSM audio data.</p> <p><em>Description "
    969 "based on the SoX manpage</em></p>"
     897"<p>The sample data encoding is signed linear (2's complement), unsigned linear, u-law (logarithmic), A-law (logarithmic), ADPCM, IMA_ADPCM, GSM, or Floating-point.</p>\n"
     898"<p><b>U-law</b> (actually shorthand for mu-law) and <b>A-law</b> are the U.S. and international standards for logarithmic telephone sound compression. When uncompressed u-law has roughly the precision of 14-bit PCM audio and A-law has roughly the precision of 13-bit PCM audio. A-law and u-law data is sometimes encoded using a reversed bit-ordering (i.e. MSB becomes LSB).<br> <b>ADPCM </b> is a form of sound compression that has a good compromise between good sound quality and fast encoding/decoding time. It is used for telephone sound compression and places where full fidelity is not as important. When uncompressed it has roughly the precision of 16-bit PCM audio. Popular versions of ADPCM include G.726, MS ADPCM, and IMA ADPCM. It has different meanings in different file handlers. In .wav files it represents MS ADPCM files, in all others it means G.726 ADPCM. <br> <b>IMA ADPCM</b> is a specific form of ADPCM compression, slightly simpler and slightly lower fidelity than Microsoft's flavor of ADPCM. IMA ADPCM is also called DVI ADPCM.<br> <b>GSM</b> is a standard used for telephone sound compression in European countries and is gaining popularity because of its good quality. It is usually CPU intensive to work with GSM audio data.</p> <p><em>Description based on the SoX manpage</em></p>"
    970899msgstr ""
    971900
     
    12131142#. +> trunk stable
    12141143#: ../plugins/project/audiometainforenamer/k3baudiometainforenamerplugin.cpp:146
    1215 msgid ""
    1216 "<qt>This specifies how the files should be renamed. Currently only the "
    1217 "special strings <em>%a</em> (Artist), <em>%n</em> (Track number), and <em>%t<"
    1218 "/em> (Title) are supported."
     1144msgid "<qt>This specifies how the files should be renamed. Currently only the special strings <em>%a</em> (Artist), <em>%n</em> (Track number), and <em>%t</em> (Title) are supported."
    12191145msgstr ""
    12201146
     
    18111737#: k3bappdevicemanager.cpp:289
    18121738#, kde-format
    1813 msgid ""
    1814 "<p>Please enter the preferred read speed for <b>%1</b>. This speed will be "
    1815 "used for the currently mounted medium.<p>This is especially useful to slow "
    1816 "down the drive when watching movies which are read directly from the drive "
    1817 "and the spinning noise is intrusive.<p>Be aware that this has no influence on "
    1818 "K3b since it will change the reading speed again when copying CDs or DVDs."
     1739msgid "<p>Please enter the preferred read speed for <b>%1</b>. This speed will be used for the currently mounted medium.<p>This is especially useful to slow down the drive when watching movies which are read directly from the drive and the spinning noise is intrusive.<p>Be aware that this has no influence on K3b since it will change the reading speed again when copying CDs or DVDs."
    18191740msgstr ""
    18201741
     
    19021823#. +> trunk stable
    19031824#: k3bdatamodewidget.cpp:38
    1904 msgid ""
    1905 "<p><b>Data Mode</b><p>Data tracks may be written in two different modes:</p><"
    1906 "p><b>Auto</b><br>Let K3b select the best suited data mode.</p><p><b>Mode 1</b>"
    1907 "<br>This is the <em>original</em> writing mode as introduced in the <em>"
    1908 "Yellow Book</em> standard. It is the preferred mode when writing pure data "
    1909 "CDs.</p><p><b>Mode 2</b><br>To be exact <em>XA Mode 2 Form 1</em>, but since "
    1910 "the other modes are rarely used it is common to refer to it as <em>Mode 2</em>"
    1911 ".</p><p><b>Be aware:</b> Do not mix different modes on one CD. Some older "
    1912 "drives may have problems reading mode 1 multisession CDs."
     1825msgid "<p><b>Data Mode</b><p>Data tracks may be written in two different modes:</p><p><b>Auto</b><br>Let K3b select the best suited data mode.</p><p><b>Mode 1</b><br>This is the <em>original</em> writing mode as introduced in the <em>Yellow Book</em> standard. It is the preferred mode when writing pure data CDs.</p><p><b>Mode 2</b><br>To be exact <em>XA Mode 2 Form 1</em>, but since the other modes are rarely used it is common to refer to it as <em>Mode 2</em>.</p><p><b>Be aware:</b> Do not mix different modes on one CD. Some older drives may have problems reading mode 1 multisession CDs."
    19131826msgstr ""
    19141827
     
    19571870#. +> trunk stable
    19581871#: k3bdirview.cpp:206
    1959 msgid ""
    1960 "K3b uses vcdxrip from the vcdimager package to rip Video CDs. Please make "
    1961 "sure it is installed."
     1872msgid "K3b uses vcdxrip from the vcdimager package to rip Video CDs. Please make sure it is installed."
    19621873msgstr ""
    19631874
     
    19811892#: k3bdirview.cpp:257
    19821893#, kde-format
    1983 msgid ""
    1984 "<p>K3b was unable to unmount medium <b>%1</b> in device <em>%2 - %3</em>"
    1985 msgstr ""
    1986 "<p>K3b nije mogao demontirati medij <b>%1</b> u uređaju <em>%2 – %3</em>"
     1894msgid "<p>K3b was unable to unmount medium <b>%1</b> in device <em>%2 - %3</em>"
     1895msgstr "<p>K3b nije mogao demontirati medij <b>%1</b> u uređaju <em>%2 – %3</em>"
    19871896
    19881897#. +> trunk stable
     
    21402049#. +> trunk stable
    21412050#: k3bdiskinfoview.cpp:300 k3bdiskinfoview.cpp:302 k3bdiskinfoview.cpp:306
    2142 #: projects/k3bfillstatusdisplay.cpp:188 projects/k3bfillstatusdisplay.cpp:191
    2143 #: projects/k3bfillstatusdisplay.cpp:196
     2051#: projects/k3bfillstatusdisplay.cpp:180 projects/k3bfillstatusdisplay.cpp:188
     2052#: projects/k3bfillstatusdisplay.cpp:191 projects/k3bfillstatusdisplay.cpp:196
     2053#: projects/k3bfillstatusdisplay.cpp:849
    21442054#, kde-format
    21452055msgid "%1 min"
     
    24512361#. +> trunk stable
    24522362#: k3binteractiondialog.cpp:205
    2453 msgid ""
    2454 "<p>Load a set of settings either from the default K3b settings, settings "
    2455 "saved before, or the last used ones."
     2363msgid "<p>Load a set of settings either from the default K3b settings, settings saved before, or the last used ones."
    24562364msgstr ""
    24572365
    24582366#. +> trunk stable
    24592367#: k3binteractiondialog.cpp:207
    2460 msgid ""
    2461 "<p>Saves the current settings of the action dialog.<p>These settings can be "
    2462 "loaded with the <em>Load saved settings</em> button.<p><b>The K3b defaults "
    2463 "are not overwritten by this.</b>"
     2368msgid "<p>Saves the current settings of the action dialog.<p>These settings can be loaded with the <em>Load saved settings</em> button.<p><b>The K3b defaults are not overwritten by this.</b>"
    24642369msgstr ""
    24652370
     
    24712376#. +> stable
    24722377#: k3binteractiondialog.cpp:288
    2473 msgid ""
    2474 "<p>K3b handles three sets of settings in action dialogs: the defaults, the "
    2475 "saved settings, and the last used settings. Please choose which of these sets "
    2476 "should be loaded if an action dialog is opened again.<p><em>Be aware that "
    2477 "this choice can always be changed from the K3b configuration dialog.</em>"
     2378msgid "<p>K3b handles three sets of settings in action dialogs: the defaults, the saved settings, and the last used settings. Please choose which of these sets should be loaded if an action dialog is opened again.<p><em>Be aware that this choice can always be changed from the K3b configuration dialog.</em>"
    24782379msgstr ""
    24792380
     
    25862487#: k3blsofwrapperdialog.cpp:73
    25872488#, kde-format
    2588 msgid ""
    2589 "<p>Device <b>'%1'</b> is already in use by other applications (<em>%2</em>).<"
    2590 "p>It is highly recommended to quit those before continuing. Otherwise K3b "
    2591 "might not be able to fully access the device.<p><em>Hint: Sometimes shutting "
    2592 "down an application does not happen instantly. In that case you might have to "
    2593 "use the '%3' button."
    2594 msgstr ""
    2595 
    2596 #. +> trunk stable
     2489msgid "<p>Device <b>'%1'</b> is already in use by other applications (<em>%2</em>).<p>It is highly recommended to quit those before continuing. Otherwise K3b might not be able to fully access the device.<p><em>Hint: Sometimes shutting down an application does not happen instantly. In that case you might have to use the '%3' button."
     2490msgstr ""
     2491
     2492#. +> trunk
     2493#: k3blsofwrapperdialog.cpp:101
     2494#, fuzzy, kde-format
     2495msgid "<p>Do you really want K3b to kill the following processes: <em>%1</em>?</p>"
     2496msgstr "<qt>Da li zaista ÅŸelite da obriÅ¡ete zabeleÅ¡ku <b>%1</b>?</qt>"
     2497
     2498#. +> stable
    25972499#: k3blsofwrapperdialog.cpp:101
    25982500msgid "<p>Do you really want K3b to kill the following processes: <em>"
     
    28312733#. +> trunk stable
    28322734#: k3bsystemproblemdialog.cpp:200
    2833 msgid ""
    2834 "K3b did not find an optical writing device in your system. Thus, you will not "
    2835 "be able to burn CDs or DVDs. However, you can still use other K3b features "
    2836 "such as audio track extraction, audio transcoding or ISO9660 image creation."
     2735msgid "K3b did not find an optical writing device in your system. Thus, you will not be able to burn CDs or DVDs. However, you can still use other K3b features such as audio track extraction, audio transcoding or ISO9660 image creation."
    28372736msgstr ""
    28382737
     
    28642763#. +> trunk stable
    28652764#: k3bsystemproblemdialog.cpp:219
    2866 msgid ""
    2867 "Although K3b supports all cdrtools versions since 1.10 it is highly "
    2868 "recommended to at least use version 2.0."
     2765msgid "Although K3b supports all cdrtools versions since 1.10 it is highly recommended to at least use version 2.0."
    28692766msgstr ""
    28702767
     
    28832780#: k3bsystemproblemdialog.cpp:240
    28842781#, kde-format
    2885 msgid ""
    2886 "Since Linux kernel 2.6.8 %1 will not work when run suid root for security "
    2887 "reasons anymore."
     2782msgid "Since Linux kernel 2.6.8 %1 will not work when run suid root for security reasons anymore."
    28882783msgstr ""
    28892784
     
    28962791#. +> trunk stable
    28972792#: k3bsystemproblemdialog.cpp:251
    2898 msgid ""
    2899 "It is highly recommended to configure cdrecord to run with root privileges, "
    2900 "as then cdrecord runs with high priority that increases the overall stability "
    2901 "of the burning process. As well as this, it allows the size of the burning "
    2902 "buffer to be changed, and a lot of user problems can be solved this way."
     2793msgid "It is highly recommended to configure cdrecord to run with root privileges, as then cdrecord runs with high priority that increases the overall stability of the burning process. As well as this, it allows the size of the burning buffer to be changed, and a lot of user problems can be solved this way."
    29032794msgstr ""
    29042795
     
    29152806#. +> trunk stable
    29162807#: k3bsystemproblemdialog.cpp:276
    2917 msgid ""
    2918 "It is highly recommended to configure cdrdao to run with root privileges to "
    2919 "increase the overall stability of the burning process."
     2808msgid "It is highly recommended to configure cdrdao to run with root privileges to increase the overall stability of the burning process."
    29202809msgstr ""
    29212810
    29222811#. +> trunk stable
    29232812#: k3bsystemproblemdialog.cpp:291
    2924 msgid ""
    2925 "K3b uses growisofs to actually write DVDs. Without growisofs you will not be "
    2926 "able to write DVDs. Make sure to install at least version 5.10."
     2813msgid "K3b uses growisofs to actually write DVDs. Without growisofs you will not be able to write DVDs. Make sure to install at least version 5.10."
    29272814msgstr ""
    29282815
     
    29342821#. +> trunk stable
    29352822#: k3bsystemproblemdialog.cpp:300
    2936 msgid ""
    2937 "K3b needs at least growisofs version 5.10 to write DVDs. All older versions "
    2938 "will not work and K3b will refuse to use them."
     2823msgid "K3b needs at least growisofs version 5.10 to write DVDs. All older versions will not work and K3b will refuse to use them."
    29392824msgstr ""
    29402825
     
    29482833#. +> trunk stable
    29492834#: k3bsystemproblemdialog.cpp:307
    2950 msgid ""
    2951 "K3b will not be able to copy DVDs on-the-fly or write a DVD+RW in multiple "
    2952 "sessions using a growisofs version older than 5.12."
     2835msgid "K3b will not be able to copy DVDs on-the-fly or write a DVD+RW in multiple sessions using a growisofs version older than 5.12."
    29532836msgstr ""
    29542837
    29552838#. +> trunk stable
    29562839#: k3bsystemproblemdialog.cpp:315
    2957 msgid ""
    2958 "It is highly recommended to use growisofs 7.0 or higher. K3b will not be able "
    2959 "to write a DVD+RW in multiple sessions using a growisofs version older than 7."
    2960 "0."
     2840msgid "It is highly recommended to use growisofs 7.0 or higher. K3b will not be able to write a DVD+RW in multiple sessions using a growisofs version older than 7.0."
    29612841msgstr ""
    29622842
     
    29682848#. +> trunk stable
    29692849#: k3bsystemproblemdialog.cpp:349
    2970 msgid ""
    2971 "K3b needs at least mkisofs version 1.14. Older versions may introduce "
    2972 "problems when creating data projects."
     2850msgid "K3b needs at least mkisofs version 1.14. Older versions may introduce problems when creating data projects."
    29732851msgstr ""
    29742852
     
    29812859#. +> trunk stable
    29822860#: k3bsystemproblemdialog.cpp:375
    2983 msgid ""
    2984 "K3b is not able to unmount automounted devices. Thus, especially DVD+RW "
    2985 "rewriting might fail. There is no need to report this as a bug or feature "
    2986 "wish; it is not possible to solve this problem from within K3b."
     2861msgid "K3b is not able to unmount automounted devices. Thus, especially DVD+RW rewriting might fail. There is no need to report this as a bug or feature wish; it is not possible to solve this problem from within K3b."
    29872862msgstr ""
    29882863
    29892864#. +> trunk stable
    29902865#: k3bsystemproblemdialog.cpp:379
    2991 msgid ""
    2992 "Replace the automounting entries in /etc/fstab with old-fashioned ones or use "
    2993 "a user-space mounting solution like pmount or ivman."
     2866msgid "Replace the automounting entries in /etc/fstab with old-fashioned ones or use a user-space mounting solution like pmount or ivman."
    29942867msgstr ""
    29952868
     
    30012874#. +> trunk stable
    30022875#: k3bsystemproblemdialog.cpp:389
    3003 msgid ""
    3004 "Your kernel does not support writing without SCSI emulation but there is at "
    3005 "least one writer in your system not configured to use SCSI emulation."
     2876msgid "Your kernel does not support writing without SCSI emulation but there is at least one writer in your system not configured to use SCSI emulation."
    30062877msgstr ""
    30072878
    30082879#. +> trunk stable
    30092880#: k3bsystemproblemdialog.cpp:393
    3010 msgid ""
    3011 "The best and recommended solution is to enable ide-scsi (SCSI emulation) for "
    3012 "all devices. This way you will not have any problems. Be aware that you may "
    3013 "still enable DMA on ide-scsi emulated drives."
     2881msgid "The best and recommended solution is to enable ide-scsi (SCSI emulation) for all devices. This way you will not have any problems. Be aware that you may still enable DMA on ide-scsi emulated drives."
    30142882msgstr ""
    30152883
     
    30232891#: k3bsystemproblemdialog.cpp:410 k3bsystemproblemdialog.cpp:431
    30242892#, kde-format
    3025 msgid ""
    3026 "The configured version of %1 does not support writing to ATAPI devices "
    3027 "without SCSI emulation and there is at least one writer in your system not "
    3028 "configured to use SCSI emulation."
     2893msgid "The configured version of %1 does not support writing to ATAPI devices without SCSI emulation and there is at least one writer in your system not configured to use SCSI emulation."
    30292894msgstr ""
    30302895
     
    30322897#: k3bsystemproblemdialog.cpp:415 k3bsystemproblemdialog.cpp:439
    30332898#, kde-format
    3034 msgid ""
    3035 "The best, and recommended, solution is to use ide-scsi (SCSI emulation) for "
    3036 "all writer devices: this way you will not have any problems; or, you can "
    3037 "install (or select as the default) a more recent version of %1."
     2899msgid "The best, and recommended, solution is to use ide-scsi (SCSI emulation) for all writer devices: this way you will not have any problems; or, you can install (or select as the default) a more recent version of %1."
    30382900msgstr ""
    30392901
     
    30412903#: k3bsystemproblemdialog.cpp:414
    30422904#, kde-format
    3043 msgid ""
    3044 "The best and recommended solution is to enable ide-scsi (SCSI emulation) for "
    3045 "all devices. This way you will not have any problems. Or you install (or "
    3046 "select as the default) a more recent version of %1."
     2905msgid "The best and recommended solution is to enable ide-scsi (SCSI emulation) for all devices. This way you will not have any problems. Or you install (or select as the default) a more recent version of %1."
    30472906msgstr ""
    30482907
    30492908#. +> trunk stable
    30502909#: k3bsystemproblemdialog.cpp:437
    3051 msgid ""
    3052 "Install cdrdao >= 1.1.8 which supports writing to ATAPI devices directly."
     2910msgid "Install cdrdao >= 1.1.8 which supports writing to ATAPI devices directly."
    30532911msgstr ""
    30542912
    30552913#. +> trunk stable
    30562914#: k3bsystemproblemdialog.cpp:453
    3057 msgid ""
    3058 "K3b will not be able to write DVD-R Dual Layer media using a growisofs "
    3059 "version older than 6.0."
     2915msgid "K3b will not be able to write DVD-R Dual Layer media using a growisofs version older than 6.0."
    30602916msgstr ""
    30612917
     
    30742930#: k3bsystemproblemdialog.cpp:468
    30752931#, kde-format
    3076 msgid ""
    3077 "K3b needs write access to all the devices to perform certain tasks. Without "
    3078 "it you might encounter problems with %1 - %2"
     2932msgid "K3b needs write access to all the devices to perform certain tasks. Without it you might encounter problems with %1 - %2"
    30792933msgstr ""
    30802934
     
    30822936#: k3bsystemproblemdialog.cpp:470
    30832937#, kde-format
    3084 msgid ""
    3085 "Make sure you have write access to %1. In case you are not using devfs or "
    3086 "udev click \"Modify Permissions...\" and setup permissions by hand."
     2938msgid "Make sure you have write access to %1. In case you are not using devfs or udev click \"Modify Permissions...\" and setup permissions by hand."
    30872939msgstr ""
    30882940
     
    30952947#. +> trunk stable
    30962948#: k3bsystemproblemdialog.cpp:477
    3097 msgid ""
    3098 "With most modern CD/DVD/BD devices enabling DMA highly increases read/write "
    3099 "performance. If you experience very low writing speeds this is probably the "
    3100 "cause."
     2949msgid "With most modern CD/DVD/BD devices enabling DMA highly increases read/write performance. If you experience very low writing speeds this is probably the cause."
    31012950msgstr ""
    31022951
     
    31152964#. +> trunk stable
    31162965#: k3bsystemproblemdialog.cpp:496
    3117 msgid ""
    3118 "Sometimes it may be necessary to specify user parameters in addition to the "
    3119 "parameters generated by K3b. This is simply a warning to make sure that these "
    3120 "parameters are really wanted and will not be part of some bug report."
     2966msgid "Sometimes it may be necessary to specify user parameters in addition to the parameters generated by K3b. This is simply a warning to make sure that these parameters are really wanted and will not be part of some bug report."
    31212967msgstr ""
    31222968
     
    31242970#: k3bsystemproblemdialog.cpp:499
    31252971#, kde-format
    3126 msgid ""
    3127 "To remove the user parameters for the external program %1 open the K3b "
    3128 "settings page 'Programs' and choose the tab 'User Parameters'."
     2972msgid "To remove the user parameters for the external program %1 open the K3b settings page 'Programs' and choose the tab 'User Parameters'."
    31292973msgstr ""
    31302974
     
    31362980#. +> trunk stable
    31372981#: k3bsystemproblemdialog.cpp:521
    3138 msgid ""
    3139 "K3b could not load or find the MP3 decoder plugin. This means that you will "
    3140 "not be able to create Audio CDs from MP3 files. Many Linux distributions do "
    3141 "not include MP3 support for legal reasons."
     2982msgid "K3b could not load or find the MP3 decoder plugin. This means that you will not be able to create Audio CDs from MP3 files. Many Linux distributions do not include MP3 support for legal reasons."
    31422983msgstr ""
    31432984
    31442985#. +> trunk stable
    31452986#: k3bsystemproblemdialog.cpp:524
    3146 msgid ""
    3147 "To enable MP3 support, please install the MAD MP3 decoding library as well as "
    3148 "the K3b MAD MP3 decoder plugin (the latter may already be installed but not "
    3149 "functional due to the missing libmad). Some distributions allow installation "
    3150 "of MP3 support via an online update tool."
     2987msgid "To enable MP3 support, please install the MAD MP3 decoding library as well as the K3b MAD MP3 decoder plugin (the latter may already be installed but not functional due to the missing libmad). Some distributions allow installation of MP3 support via an online update tool."
    31512988msgstr ""
    31522989
     
    31582995#. +> trunk stable
    31592996#: k3bsystemproblemdialog.cpp:540
    3160 msgid ""
    3161 "Your system's locale charset (i.e. the charset used to encode filenames) is "
    3162 "set to ANSI_X3.4-1968. It is highly unlikely that this has been done "
    3163 "intentionally. Most likely the locale is not set at all. An invalid setting "
    3164 "will result in problems when creating data projects."
     2997msgid "Your system's locale charset (i.e. the charset used to encode filenames) is set to ANSI_X3.4-1968. It is highly unlikely that this has been done intentionally. Most likely the locale is not set at all. An invalid setting will result in problems when creating data projects."
    31652998msgstr ""
    31662999
    31673000#. +> trunk stable
    31683001#: k3bsystemproblemdialog.cpp:544
    3169 msgid ""
    3170 "To properly set the locale charset make sure the LC_* environment variables "
    3171 "are set. Normally the distribution setup tools take care of this."
     3002msgid "To properly set the locale charset make sure the LC_* environment variables are set. Normally the distribution setup tools take care of this."
    31723003msgstr ""
    31733004
     
    31793010#. +> trunk stable
    31803011#: k3bsystemproblemdialog.cpp:558
    3181 msgid ""
    3182 "It is not recommended to run K3b under the root user account. This introduces "
    3183 "unnecessary security risks."
     3012msgid "It is not recommended to run K3b under the root user account. This introduces unnecessary security risks."
    31843013msgstr ""
    31853014
    31863015#. +> trunk stable
    31873016#: k3bsystemproblemdialog.cpp:560
    3188 msgid ""
    3189 "Run K3b from a proper user account and setup the device and external tool "
    3190 "permissions appropriately."
     3017msgid "Run K3b from a proper user account and setup the device and external tool permissions appropriately."
    31913018msgstr ""
    31923019
     
    32183045#. +> trunk stable
    32193046#: k3btempdirselectionwidget.cpp:83
    3220 msgid ""
    3221 "<p>This is the folder in which K3b will save the <em>image files</em>.<p>"
    3222 "Please make sure that it resides on a partition that has enough free space."
     3047msgid "<p>This is the folder in which K3b will save the <em>image files</em>.<p>Please make sure that it resides on a partition that has enough free space."
    32233048msgstr ""
    32243049
     
    33633188#. +> trunk stable
    33643189#: k3bwriterselectionwidget.cpp:173
    3365 msgid ""
    3366 "<p>Select the medium that you want to use for burning.<p>In most cases there "
    3367 "will only be one medium available which does not leave much choice."
     3190msgid "<p>Select the medium that you want to use for burning.<p>In most cases there will only be one medium available which does not leave much choice."
    33683191msgstr ""
    33693192
    33703193#. +> trunk stable
    33713194#: k3bwriterselectionwidget.cpp:176
    3372 msgid ""
    3373 "<p>Select the speed with which you want to burn.<p><b>Auto</b><br>This will "
    3374 "choose the maximum writing speed possible with the used medium. This is the "
    3375 "recommended selection for most media.</p><p><b>Ignore</b> (DVD only)<br>This "
    3376 "will leave the speed selection to the writer device. Use this if K3b is "
    3377 "unable to set the writing speed.<p>1x refers to 175 KB/s for CD, 1385 KB/s "
    3378 "for DVD, and 4496 KB/s for Blu-ray.</p><p><b>Caution:</b> Make sure your "
    3379 "system is able to send the data fast enough to prevent buffer underruns."
     3195msgid "<p>Select the speed with which you want to burn.<p><b>Auto</b><br>This will choose the maximum writing speed possible with the used medium. This is the recommended selection for most media.</p><p><b>Ignore</b> (DVD only)<br>This will leave the speed selection to the writer device. Use this if K3b is unable to set the writing speed.<p>1x refers to 175 KB/s for CD, 1385 KB/s for DVD, and 4496 KB/s for Blu-ray.</p><p><b>Caution:</b> Make sure your system is able to send the data fast enough to prevent buffer underruns."
    33803196msgstr ""
    33813197
    33823198#. +> trunk stable
    33833199#: k3bwriterselectionwidget.cpp:187
    3384 msgid ""
    3385 "<p>K3b uses the command line tools cdrecord, growisofs, and cdrdao to "
    3386 "actually write a CD or DVD.<p>Normally K3b chooses the best suited "
    3387 "application for every task automatically but in some cases it may be possible "
    3388 "that one of the applications does not work as intended with a certain writer. "
    3389 "In this case one may select the application manually."
     3200msgid "<p>K3b uses the command line tools cdrecord, growisofs, and cdrdao to actually write a CD or DVD.<p>Normally K3b chooses the best suited application for every task automatically but in some cases it may be possible that one of the applications does not work as intended with a certain writer. In this case one may select the application manually."
    33903201msgstr ""
    33913202
     
    34103221#. +> trunk stable
    34113222#: k3bwriterselectionwidget.cpp:607
    3412 msgid ""
    3413 "<p>K3b is not able to perfectly determine the maximum writing speed of an "
    3414 "optical writer. Writing speed is always reported subject to the inserted "
    3415 "medium.<p>Please enter the writing speed here and K3b will remember it for "
    3416 "future sessions (Example: 16x)."
     3223msgid "<p>K3b is not able to perfectly determine the maximum writing speed of an optical writer. Writing speed is always reported subject to the inserted medium.<p>Please enter the writing speed here and K3b will remember it for future sessions (Example: 16x)."
    34173224msgstr ""
    34183225
     
    34293236#. +> trunk stable
    34303237#: k3bwritingmodewidget.cpp:29
    3431 msgid ""
    3432 "<em>Disk At Once</em> or more properly <em>Session At Once</em>. The laser is "
    3433 "never turned off while writing the CD or DVD. This is the preferred mode to "
    3434 "write audio CDs since it allows pregaps other than 2 seconds. Not all writers "
    3435 "support DAO.<br>DVD-R(W)s written in DAO provide the best DVD-Video "
    3436 "compatibility."
     3238msgid "<em>Disk At Once</em> or more properly <em>Session At Once</em>. The laser is never turned off while writing the CD or DVD. This is the preferred mode to write audio CDs since it allows pregaps other than 2 seconds. Not all writers support DAO.<br>DVD-R(W)s written in DAO provide the best DVD-Video compatibility."
    34373239msgstr ""
    34383240
    34393241#. +> trunk stable
    34403242#: k3bwritingmodewidget.cpp:35
    3441 msgid ""
    3442 "<em>Track At Once</em> should be supported by every CD writer. The laser will "
    3443 "be turned off after every track.<br>Most CD writers need this mode for "
    3444 "writing multisession CDs."
     3243msgid "<em>Track At Once</em> should be supported by every CD writer. The laser will be turned off after every track.<br>Most CD writers need this mode for writing multisession CDs."
    34453244msgstr ""
    34463245
    34473246#. +> trunk stable
    34483247#: k3bwritingmodewidget.cpp:41
    3449 msgid ""
    3450 "RAW writing mode. The error correction data is created by the software "
    3451 "instead of the writer device.<br>Try this if your CD writer fails to write in "
    3452 "DAO and TAO."
     3248msgid "RAW writing mode. The error correction data is created by the software instead of the writer device.<br>Try this if your CD writer fails to write in DAO and TAO."
    34533249msgstr ""
    34543250
    34553251#. +> trunk stable
    34563252#: k3bwritingmodewidget.cpp:45
    3457 msgid ""
    3458 "Incremental sequential is the default writing mode for DVD-R(W). It allows "
    3459 "multisession DVD-R(W)s. It only applies to DVD-R(W)."
     3253msgid "Incremental sequential is the default writing mode for DVD-R(W). It allows multisession DVD-R(W)s. It only applies to DVD-R(W)."
    34603254msgstr ""
    34613255
    34623256#. +> trunk stable
    34633257#: k3bwritingmodewidget.cpp:48
    3464 msgid ""
    3465 "Restricted Overwrite allows to use a DVD-RW just like a DVD-RAM or a DVD+RW. "
    3466 "The media may just be overwritten. It is not possible to write multisession "
    3467 "DVD-RWs in this mode but K3b uses growisofs to grow an ISO9660 filesystem "
    3468 "within the first session, thus allowing new files to be added to an already "
    3469 "burned disk."
     3258msgid "Restricted Overwrite allows to use a DVD-RW just like a DVD-RAM or a DVD+RW. The media may just be overwritten. It is not possible to write multisession DVD-RWs in this mode but K3b uses growisofs to grow an ISO9660 filesystem within the first session, thus allowing new files to be added to an already burned disk."
    34703259msgstr ""
    34713260
     
    34823271#. +> trunk stable
    34833272#: k3bwritingmodewidget.cpp:106
    3484 msgid ""
    3485 "Be aware that the writing mode is ignored when writing DVD+R(W) and BD-R(E) "
    3486 "since there is only one way to write them."
     3273msgid "Be aware that the writing mode is ignored when writing DVD+R(W) and BD-R(E) since there is only one way to write them."
    34873274msgstr ""
    34883275
     
    35213308#. +> trunk stable
    35223309#: main.cpp:38
    3523 msgid ""
    3524 "<p>K3b is a full-featured CD/DVD/Blu-ray burning and ripping application.<br/>"
    3525 "It supports a variety of project types as well as copying of optical media, "
    3526 "burning of different types of images, and ripping Audio CDs, Video CDs, and "
    3527 "Video DVDs.<br/>Its convenient user interface is targeted at all audiences, "
    3528 "trying to be as simple as possible for novice users while also providing all "
    3529 "features an advanced user might need."
     3310msgid "<p>K3b is a full-featured CD/DVD/Blu-ray burning and ripping application.<br/>It supports a variety of project types as well as copying of optical media, burning of different types of images, and ripping Audio CDs, Video CDs, and Video DVDs.<br/>Its convenient user interface is targeted at all audiences, trying to be as simple as possible for novice users while also providing all features an advanced user might need."
    35303311msgstr ""
    35313312
     
    37113492#. +> trunk stable
    37123493#: main.cpp:82
    3713 msgid ""
    3714 "For libsamplerate which is used for generic resampling in the audio decoder "
    3715 "framework."
     3494msgid "For libsamplerate which is used for generic resampling in the audio decoder framework."
    37163495msgstr ""
    37173496
     
    37843563#. +> trunk stable
    37853564#: main.cpp:103
    3786 msgid ""
    3787 "Rob created a great theme and came up with the idea for transparent themes."
     3565msgid "Rob created a great theme and came up with the idea for transparent themes."
    37883566msgstr ""
    37893567
     
    38903668#. +> trunk stable
    38913669#: main.cpp:129
    3892 msgid ""
    3893 "Set the device to be used for new projects. (This option has no effect: its "
    3894 "main purpose is to enable handling of empty media from the KDE Media Manager.)"
     3670msgid "Set the device to be used for new projects. (This option has no effect: its main purpose is to enable handling of empty media from the KDE Media Manager.)"
    38953671msgstr ""
    38963672
     
    40693845#. +> trunk stable
    40703846#: misc/k3bimagewritingdialog.cpp:607
    4071 msgid ""
    4072 "<p><b>Image types supported by K3b:</p><p><b>Plain image</b><br/>Plain images "
    4073 "are written as is to the medium using a single data track. Typical plain "
    4074 "images are iso images as created by K3b's data project.<p><b>Cue/bin images<"
    4075 "/b><br/>Cue/bin images consist of a cue file describing the table of contents "
    4076 "of the medium and an image file which contains the actual data. The data will "
    4077 "be written to the medium according to the cue file.<p><b>Audio Cue image</b><"
    4078 "br/>Audio cue images are a special kind of cue/bin image containing an image "
    4079 "of an audio CD. The actual audio data can be encoded using any audio format "
    4080 "supported by K3b. Audio cue files can also be imported into K3b audio "
    4081 "projects which allows to change the order and add or remove tracks.<p><b>"
    4082 "Cdrecord clone images</b><br/>K3b creates a cdrecord clone image of a "
    4083 "single-session CD when copying a CD in clone mode. These images can be reused "
    4084 "here.<p><b>Cdrdao TOC files</b><br/>K3b supports writing cdrdao's own image "
    4085 "format, the toc files."
     3847msgid "<p><b>Image types supported by K3b:</p><p><b>Plain image</b><br/>Plain images are written as is to the medium using a single data track. Typical plain images are iso images as created by K3b's data project.<p><b>Cue/bin images</b><br/>Cue/bin images consist of a cue file describing the table of contents of the medium and an image file which contains the actual data. The data will be written to the medium according to the cue file.<p><b>Audio Cue image</b><br/>Audio cue images are a special kind of cue/bin image containing an image of an audio CD. The actual audio data can be encoded using any audio format supported by K3b. Audio cue files can also be imported into K3b audio projects which allows to change the order and add or remove tracks.<p><b>Cdrecord clone images</b><br/>K3b creates a cdrecord clone image of a single-session CD when copying a CD in clone mode. These images can be reused here.<p><b>Cdrdao TOC files</b><br/>K3b supports writing cdrdao's own image format, the toc files."
    40863848msgstr ""
    40873849
    40883850#. +> trunk stable
    40893851#: misc/k3bimagewritingdialog.cpp:707
    4090 msgid ""
    4091 "<p>The actual file size does not match the size declared in the file header. "
    4092 "If it has been downloaded make sure the download is complete.</p><p>Only "
    4093 "continue if you know what you are doing.</p>"
     3852msgid "<p>The actual file size does not match the size declared in the file header. If it has been downloaded make sure the download is complete.</p><p>Only continue if you know what you are doing.</p>"
    40943853msgstr ""
    40953854
     
    42534012#. +> trunk stable
    42544013#: misc/k3bmediacopydialog.cpp:218
    4255 msgid ""
    4256 "<p>If this option is checked K3b will disable the source drive's ECC/EDC "
    4257 "error correction. This way sectors that are unreadable by intention can be "
    4258 "read.<p>This may be useful for cloning CDs with copy protection based on "
    4259 "corrupted sectors."
     4014msgid "<p>If this option is checked K3b will disable the source drive's ECC/EDC error correction. This way sectors that are unreadable by intention can be read.<p>This may be useful for cloning CDs with copy protection based on corrupted sectors."
    42604015msgstr ""
    42614016
    42624017#. +> trunk stable
    42634018#: misc/k3bmediacopydialog.cpp:223
    4264 msgid ""
    4265 "<p>If this option is checked K3b will search for CD-Text on the source CD. "
    4266 "Disable it if your CD drive has problems with reading CD-Text or you want to "
    4267 "stick to Cddb info."
     4019msgid "<p>If this option is checked K3b will search for CD-Text on the source CD. Disable it if your CD drive has problems with reading CD-Text or you want to stick to Cddb info."
    42684020msgstr ""
    42694021
    42704022#. +> trunk stable
    42714023#: misc/k3bmediacopydialog.cpp:226
    4272 msgid ""
    4273 "<p>If this option is checked and K3b is not able to read a data sector from "
    4274 "the source medium it will be replaced with zeros on the resulting copy."
     4024msgid "<p>If this option is checked and K3b is not able to read a data sector from the source medium it will be replaced with zeros on the resulting copy."
    42754025msgstr ""
    42764026
    42774027#. +> trunk
    42784028#: misc/k3bmediacopydialog.cpp:231
    4279 msgid ""
    4280 "<p>This is the normal copy mode for DVD, Blu-ray, and most CD media types. It "
    4281 "allows copying Audio CDs, multi and single session Data Media, and Enhanced "
    4282 "Audio CDs (an Audio CD containing an additional data session).<p>For Video "
    4283 "CDs please use the CD Cloning mode."
     4029msgid "<p>This is the normal copy mode for DVD, Blu-ray, and most CD media types. It allows copying Audio CDs, multi and single session Data Media, and Enhanced Audio CDs (an Audio CD containing an additional data session).<p>For Video CDs please use the CD Cloning mode."
    42844030msgstr ""
    42854031
    42864032#. +> stable
    42874033#: misc/k3bmediacopydialog.cpp:231
    4288 msgid ""
    4289 "<p>This is the normal copy mode for DVD, Blu-ray, and most CD media types. It "
    4290 "allows copying Audio CDs, multi and single session Data Media, and Enhanced "
    4291 "Audio CDs (an Audio CD containing an additional data session).<p>For VideoCDs "
    4292 "please use the CD Cloning mode."
     4034msgid "<p>This is the normal copy mode for DVD, Blu-ray, and most CD media types. It allows copying Audio CDs, multi and single session Data Media, and Enhanced Audio CDs (an Audio CD containing an additional data session).<p>For VideoCDs please use the CD Cloning mode."
    42934035msgstr ""
    42944036
    42954037#. +> trunk
    42964038#: misc/k3bmediacopydialog.cpp:236
    4297 msgid ""
    4298 "<p>In CD Cloning mode K3b performs a raw copy of the CD. That means it does "
    4299 "not care about the content but simply copies the CD bit by bit. It may be "
    4300 "used to copy Video CDs or CDs which contain erroneous sectors.<p><b>Caution:<"
    4301 "/b> Only single session CDs can be cloned."
     4039msgid "<p>In CD Cloning mode K3b performs a raw copy of the CD. That means it does not care about the content but simply copies the CD bit by bit. It may be used to copy Video CDs or CDs which contain erroneous sectors.<p><b>Caution:</b> Only single session CDs can be cloned."
    43024040msgstr ""
    43034041
    43044042#. +> stable
    43054043#: misc/k3bmediacopydialog.cpp:236
    4306 msgid ""
    4307 "<p>In CD Cloning mode K3b performs a raw copy of the CD. That means it does "
    4308 "not care about the content but simply copies the CD bit by bit. It may be "
    4309 "used to copy VideoCDs or CDs which contain erroneous sectors.<p><b>Caution:<"
    4310 "/b> Only single session CDs can be cloned."
     4044msgid "<p>In CD Cloning mode K3b performs a raw copy of the CD. That means it does not care about the content but simply copies the CD bit by bit. It may be used to copy VideoCDs or CDs which contain erroneous sectors.<p><b>Caution:</b> Only single session CDs can be cloned."
    43114045msgstr ""
    43124046
    43134047#. +> trunk stable
    43144048#: misc/k3bmediacopydialog.cpp:273 projects/k3bprojectburndialog.cpp:213
    4315 msgid ""
    4316 "There does not seem to be enough free space in the temporary folder. Write "
    4317 "anyway?"
     4049msgid "There does not seem to be enough free space in the temporary folder. Write anyway?"
    43184050msgstr ""
    43194051
     
    43684100#. +> trunk stable
    43694101#: misc/k3bmediaformattingdialog.cpp:88
    4370 msgid ""
    4371 "<p>If this option is checked K3b will format a DVD-RW even if it is empty. It "
    4372 "may also be used to force K3b to format a DVD+RW, BD-RE or a DVD-RW in "
    4373 "restricted overwrite mode.<p><b>Caution:</b> It is not recommended to format "
    4374 "a DVD often as it may become unusable after only 10-20 reformat procedures.<p>"
    4375 "DVD+RW and BD-RE media only needs to be formatted once. After that it just "
    4376 "needs to be overwritten. The same applies to DVD-RW in restricted overwrite "
    4377 "mode."
     4102msgid "<p>If this option is checked K3b will format a DVD-RW even if it is empty. It may also be used to force K3b to format a DVD+RW, BD-RE or a DVD-RW in restricted overwrite mode.<p><b>Caution:</b> It is not recommended to format a DVD often as it may become unusable after only 10-20 reformat procedures.<p>DVD+RW and BD-RE media only needs to be formatted once. After that it just needs to be overwritten. The same applies to DVD-RW in restricted overwrite mode."
    43784103msgstr ""
    43794104
     
    43854110#. +> trunk stable
    43864111#: misc/k3bmediaformattingdialog.cpp:99
    4387 msgid ""
    4388 "<p>If this option is checked K3b will tell the writer to perform a quick "
    4389 "format.<p>Erasing a rewritable medium completely can take a very long time "
    4390 "and some writers perform a full format even if quick format is enabled."
     4112msgid "<p>If this option is checked K3b will tell the writer to perform a quick format.<p>Erasing a rewritable medium completely can take a very long time and some writers perform a full format even if quick format is enabled."
    43914113msgstr ""
    43924114
     
    45794301#. +> trunk stable
    45804302#: option/base_k3bmiscoptiontab.ui:51
    4581 msgid ""
    4582 "<p>This is the default temporary directory. This is where K3b will store "
    4583 "temporary files such as iso images or decoded audio files.<p>Be aware that "
    4584 "the temporary directory may also be changed in every project burn dialog."
     4303msgid "<p>This is the default temporary directory. This is where K3b will store temporary files such as iso images or decoded audio files.<p>Be aware that the temporary directory may also be changed in every project burn dialog."
    45854304msgstr ""
    45864305
     
    46014320#. +> trunk stable
    46024321#: option/base_k3bmiscoptiontab.ui:72
    4603 msgid ""
    4604 "<p>If this option is checked K3b will check the system configuration for any "
    4605 "problems on startup and when the user changes the settings."
     4322msgid "<p>If this option is checked K3b will check the system configuration for any problems on startup and when the user changes the settings."
    46064323msgstr ""
    46074324
     
    46274344#. +> trunk
    46284345#: option/base_k3bmiscoptiontab.ui:91
    4629 msgid ""
    4630 "<p>If this option is checked K3b will display the progress in KDE "
    4631 "notification area. If K3b is run outside KDE environment a separate progress "
    4632 "window may be shown instead.</p>"
     4346msgid "<p>If this option is checked K3b will display the progress in KDE notification area. If K3b is run outside KDE environment a separate progress window may be shown instead.</p>"
    46334347msgstr ""
    46344348
     
    46494363#. +> trunk stable
    46504364#: option/base_k3bmiscoptiontab.ui:104
    4651 msgid ""
    4652 "<p>If this option is checked K3b will hide the main window while displaying "
    4653 "the progress dialog."
     4365msgid "<p>If this option is checked K3b will hide the main window while displaying the progress dialog."
    46544366msgstr ""
    46554367
     
    46574369#. +> stable
    46584370#: option/base_k3bmiscoptiontab.ui:83
    4659 msgid ""
    4660 "<p>If this option is checked K3b will display the progress in an OSD which "
    4661 "always stays on top of all other windows."
     4371msgid "<p>If this option is checked K3b will display the progress in an OSD which always stays on top of all other windows."
    46624372msgstr ""
    46634373
     
    46894399#. +> trunk stable
    46904400#: option/base_k3bmiscoptiontab.ui:127
    4691 msgid ""
    4692 "<p>If this option is checked K3b will not close action dialogs such as the CD "
    4693 "Copy dialog after the process has been finished. It will be kept open to "
    4694 "start a new process, for instance, copying another CD."
     4401msgid "<p>If this option is checked K3b will not close action dialogs such as the CD Copy dialog after the process has been finished. It will be kept open to start a new process, for instance, copying another CD."
    46954402msgstr ""
    46964403
     
    47234430#. +> trunk stable
    47244431#: option/base_k3bpluginoptiontab.ui:47 option/k3bpluginoptiontab.cpp:40
    4725 msgid ""
    4726 "<p>Here all <em>K3b Plugins</em> may be configured. Be aware that this does "
    4727 "not include the <em>KPart Plugins</em> which embed themselves in the K3b menu "
    4728 "structure.</p>"
     4432msgid "<p>Here all <em>K3b Plugins</em> may be configured. Be aware that this does not include the <em>KPart Plugins</em> which embed themselves in the K3b menu structure.</p>"
    47294433msgstr ""
    47304434
     
    48174521#. +> trunk stable
    48184522#: option/k3badvancedoptiontab.cpp:100
    4819 msgid ""
    4820 "Show advanced GUI elements like allowing to choose between cdrecord and cdrdao"
     4523msgid "Show advanced GUI elements like allowing to choose between cdrecord and cdrdao"
    48214524msgstr ""
    48224525
     
    48384541#. +> trunk stable
    48394542#: option/k3badvancedoptiontab.cpp:105
    4840 msgid ""
    4841 "<p>If this option is checked additional GUI elements which allow to influence "
    4842 "the behavior of K3b are shown. This includes the manual selection of the used "
    4843 "burning tool. (Choose between cdrecord and cdrdao when writing a CD or "
    4844 "between cdrecord and growisofs when writing a DVD/BD.)<p><b>Be aware that K3b "
    4845 "does not support all possible tools in all project types and actions.</b>"
     4543msgid "<p>If this option is checked additional GUI elements which allow to influence the behavior of K3b are shown. This includes the manual selection of the used burning tool. (Choose between cdrecord and cdrdao when writing a CD or between cdrecord and growisofs when writing a DVD/BD.)<p><b>Be aware that K3b does not support all possible tools in all project types and actions.</b>"
    48464544msgstr ""
    48474545
    48484546#. +> trunk stable
    48494547#: option/k3badvancedoptiontab.cpp:113
    4850 msgid ""
    4851 "<p>Each medium has an official maximum capacity which is stored in a "
    4852 "read-only area of the medium and is guaranteed by the vendor. However, this "
    4853 "official maximum is not always the actual maximum. Many media have an actual "
    4854 "total capacity that is slightly larger than the official amount.<p>If this "
    4855 "option is checked K3b will disable a safety check that prevents burning "
    4856 "beyond the official capacity.<p><b>Caution:</b> Enabling this option can "
    4857 "cause failures in the end of the burning process if K3b attempts to write "
    4858 "beyond the official capacity. It makes sense to first determine the actual "
    4859 "maximum capacity of the media brand with a simulated burn."
     4548msgid "<p>Each medium has an official maximum capacity which is stored in a read-only area of the medium and is guaranteed by the vendor. However, this official maximum is not always the actual maximum. Many media have an actual total capacity that is slightly larger than the official amount.<p>If this option is checked K3b will disable a safety check that prevents burning beyond the official capacity.<p><b>Caution:</b> Enabling this option can cause failures in the end of the burning process if K3b attempts to write beyond the official capacity. It makes sense to first determine the actual maximum capacity of the media brand with a simulated burn."
    48604549msgstr ""
    48614550
    48624551#. +> trunk stable
    48634552#: option/k3badvancedoptiontab.cpp:124
    4864 msgid ""
    4865 "<p>If this option is checked K3b will automatically erase CD-RWs and format "
    4866 "DVD-RWs if one is found instead of an empty media before writing."
     4553msgid "<p>If this option is checked K3b will automatically erase CD-RWs and format DVD-RWs if one is found instead of an empty media before writing."
    48674554msgstr ""
    48684555
     
    48704557#: option/k3badvancedoptiontab.cpp:128
    48714558#, kde-format
    4872 msgid ""
    4873 "<p>K3b uses a software buffer during the burning process to avoid gaps in the "
    4874 "data stream due to high system load. The default sizes used are %1 MB for CD "
    4875 "and %2 MB for DVD burning.<p>If this option is checked the value specified "
    4876 "will be used for both CD and DVD burning."
     4559msgid "<p>K3b uses a software buffer during the burning process to avoid gaps in the data stream due to high system load. The default sizes used are %1 MB for CD and %2 MB for DVD burning.<p>If this option is checked the value specified will be used for both CD and DVD burning."
    48774560msgstr ""
    48784561
    48794562#. +> trunk stable
    48804563#: option/k3badvancedoptiontab.cpp:134
    4881 msgid ""
    4882 "<p>If this option is checked K3b will not eject the medium once the burn "
    4883 "process finishes. This can be helpful in case one leaves the computer after "
    4884 "starting the burning and does not want the tray to be open all the time.<p>"
    4885 "However, on Linux systems a freshly burned medium has to be reloaded. "
    4886 "Otherwise the system will not detect the changes and still treat it as an "
    4887 "empty medium."
     4564msgid "<p>If this option is checked K3b will not eject the medium once the burn process finishes. This can be helpful in case one leaves the computer after starting the burning and does not want the tray to be open all the time.<p>However, on Linux systems a freshly burned medium has to be reloaded. Otherwise the system will not detect the changes and still treat it as an empty medium."
    48884565msgstr ""
    48894566
    48904567#. +> trunk stable
    48914568#: option/k3badvancedoptiontab.cpp:140
    4892 msgid ""
    4893 "<p>If this option is checked K3b will continue in some situations which would "
    4894 "otherwise be deemed as unsafe.<p>This setting for example disables the check "
    4895 "for medium speed verification. Thus, one can force K3b to burn a high speed "
    4896 "medium on a low speed writer.<p><b>Caution:</b> Enabling this option may "
    4897 "result in damaged media."
     4569msgid "<p>If this option is checked K3b will continue in some situations which would otherwise be deemed as unsafe.<p>This setting for example disables the check for medium speed verification. Thus, one can force K3b to burn a high speed medium on a low speed writer.<p><b>Caution:</b> Enabling this option may result in damaged media."
    48984570msgstr ""
    48994571
     
    49054577#. +> trunk stable
    49064578#: option/k3bdeviceoptiontab.cpp:45
    4907 msgid ""
    4908 "K3b tries to detect all your devices properly. If K3b is unable to detect "
    4909 "your drive, you need to modify their permissions to give K3b write access to "
    4910 "all devices."
     4579msgid "K3b tries to detect all your devices properly. If K3b is unable to detect your drive, you need to modify their permissions to give K3b write access to all devices."
    49114580msgstr ""
    49124581
     
    50224691#. +> trunk stable
    50234692#: option/k3bexternalbinoptiontab.cpp:37
    5024 msgid ""
    5025 "Specify the paths to the external programs that K3b needs to work properly, "
    5026 "or press \"Search\" to let K3b search for the programs."
     4693msgid "Specify the paths to the external programs that K3b needs to work properly, or press \"Search\" to let K3b search for the programs."
    50274694msgstr ""
    50284695
     
    50474714#. +> trunk
    50484715#: option/k3bexternalbinwidget.cpp:80
    5049 msgid ""
    5050 "<p>If K3b finds more than one installed version of a program it will choose "
    5051 "one as the <em>default</em>, which will be used to do the work. If you want "
    5052 "to change the default, check desired version on the list."
     4716msgid "<p>If K3b finds more than one installed version of a program it will choose one as the <em>default</em>, which will be used to do the work. If you want to change the default, check desired version on the list."
    50534717msgstr ""
    50544718
    50554719#. +> stable
    50564720#: option/k3bexternalbinwidget.cpp:121
    5057 msgid ""
    5058 "<p>If K3b finds more than one installed version of a program it will choose "
    5059 "one as the <em>default</em>, which will be used to do the work. If you want "
    5060 "to change the default, select the desired version and press this button."
     4721msgid "<p>If K3b finds more than one installed version of a program it will choose one as the <em>default</em>, which will be used to do the work. If you want to change the default, select the desired version and press this button."
    50614722msgstr ""
    50624723
     
    50794740#. +> trunk stable
    50804741#: option/k3bexternalbinwidget.cpp:113 option/k3bexternalbinwidget.cpp:123
     4742#, fuzzy
    50814743msgid "Search Path"
    5082 msgstr ""
     4744msgstr "Putanja pretraÅŸivanja"
    50834745
    50844746#. +> trunk stable
    50854747#: option/k3bexternalbinwidget.cpp:115
    5086 msgid ""
    5087 "<qt><b>Hint:</b> to force K3b to use another than the default name for the "
    5088 "executable specify it in the search path.</qt>"
    5089 msgstr ""
     4748#, fuzzy
     4749msgid "<qt><b>Hint:</b> to force K3b to use another than the default name for the executable specify it in the search path.</qt>"
     4750msgstr "<qt><b>Savjet:</b> kako biste prisilili K3b na koriÅ¡tenje posebnog naziva izvrÅ¡nog programa, navedite ga u putanji pretraÅŸivanja.</qt>"
    50904751
    50914752#. +> stable
     
    51444805#. +> trunk stable
    51454806#: option/k3bmiscoptiontab.cpp:56
    5146 msgid ""
    5147 "K3b handles three sets of settings in action dialogs (action dialogs include "
    5148 "the CD Copy dialog or the Audio CD project dialog):"
     4807msgid "K3b handles three sets of settings in action dialogs (action dialogs include the CD Copy dialog or the Audio CD project dialog):"
    51494808msgstr ""
    51504809
    51514810#. +> trunk stable
    51524811#: option/k3bmiscoptiontab.cpp:59
    5153 msgid ""
    5154 "One of these sets is loaded once an action dialog is opened. This setting "
    5155 "defines which set it will be."
     4812msgid "One of these sets is loaded once an action dialog is opened. This setting defines which set it will be."
    51564813msgstr ""
    51574814
     
    51834840#. +> trunk stable
    51844841#: option/k3bmiscoptiontab.cpp:128
    5185 msgid ""
    5186 "You specified a file for the temporary folder. K3b will use its base path as "
    5187 "the temporary folder."
     4842msgid "You specified a file for the temporary folder. K3b will use its base path as the temporary folder."
    51884843msgstr ""
    51894844
     
    53284983#: option/k3bthemeoptiontab.cpp:186
    53294984#, kde-format
    5330 msgid ""
    5331 "<qt>Are you sure you want to remove the <strong>%1</strong> theme?<br><br>"
    5332 "This will delete the files installed by this theme.</qt>"
     4985msgid "<qt>Are you sure you want to remove the <strong>%1</strong> theme?<br><br>This will delete the files installed by this theme.</qt>"
    53334986msgstr ""
    53344987
     
    54305083"<p>Set the ISO-9660 conformance level.\n"
    54315084"<ul>\n"
    5432 "<li>Level 1: Files may only consist of one section and filenames are "
    5433 "restricted to 8.3 characters.</li>\n"
     5085"<li>Level 1: Files may only consist of one section and filenames are restricted to 8.3 characters.</li>\n"
    54345086"<li>Level 2: Files may only consist of one section.</li>\n"
    54355087"<li>Level 3: No restrictions.</li>\n"
    54365088"</ul>\n"
    5437 "<p>With all ISO-9660 levels, all filenames are restricted to upper case "
    5438 "letters, numbers and the underscore (_). The maximum filename length is 31 "
    5439 "characters, the directory nesting level is restricted to 8 and the maximum "
    5440 "path length is limited to 255 characters. (These restrictions may be violated "
    5441 "with the additional ISO-9660 features K3b offers.)"
     5089"<p>With all ISO-9660 levels, all filenames are restricted to upper case letters, numbers and the underscore (_). The maximum filename length is 31 characters, the directory nesting level is restricted to 8 and the maximum path length is limited to 255 characters. (These restrictions may be violated with the additional ISO-9660 features K3b offers.)"
    54425090msgstr ""
    54435091
     
    55495197#: projects/base_k3badvanceddataimagesettings.ui:239
    55505198msgid ""
    5551 "<p>If this option is checked, K3b will generate the System Use Sharing "
    5552 "Protocol records (SUSP) specified by the Rock Ridge Interchange Protocol "
    5553 "(IEEE-P1282).\n"
    5554 "<p>Rock Ridge extends the ISO-9660 filesystem by features equal to the UNIX "
    5555 "filesystems (permissions, symbolic links, very long filenames, ...). It uses "
    5556 "ISO-8859 or UTF-16 based characters and allows 255 octets.\n"
    5557 "<p>Rock Ridge extensions are located at the end of each ISO-9660 directory "
    5558 "record. This makes the Rock Ridge tree closely coupled to the ISO-9660 tree.\n"
    5559 "<p><b>It is highly recommended to use Rock Ridge extensions on every data CD "
    5560 "or DVD.</b>"
     5199"<p>If this option is checked, K3b will generate the System Use Sharing Protocol records (SUSP) specified by the Rock Ridge Interchange Protocol (IEEE-P1282).\n"
     5200"<p>Rock Ridge extends the ISO-9660 filesystem by features equal to the UNIX filesystems (permissions, symbolic links, very long filenames, ...). It uses ISO-8859 or UTF-16 based characters and allows 255 octets.\n"
     5201"<p>Rock Ridge extensions are located at the end of each ISO-9660 directory record. This makes the Rock Ridge tree closely coupled to the ISO-9660 tree.\n"
     5202"<p><b>It is highly recommended to use Rock Ridge extensions on every data CD or DVD.</b>"
    55615203msgstr ""
    55625204
     
    55775219#: projects/base_k3badvanceddataimagesettings.ui:259
    55785220msgid ""
    5579 "<p>If this option is checked, K3b will add additional Joliet extensions to "
    5580 "the ISO-9660 file system.\n"
    5581 "<p>Joliet is not an accepted independent international standard like ISO-9660 "
    5582 "or Rock Ridge. It is mainly used on Windows systems.\n"
    5583 "<p>Joliet does not allow all characters, so the Joliet filenames are not "
    5584 "identical to the filenames on disk (as compared to Rock Ridge). Joliet has a "
    5585 "filename length limitation of 64 chars (independent from the character coding "
    5586 "and type e.g. European vs. Japanese). This is inconvenient, as modern file "
    5587 "systems all allow 255 characters per path name component.\n"
     5221"<p>If this option is checked, K3b will add additional Joliet extensions to the ISO-9660 file system.\n"
     5222"<p>Joliet is not an accepted independent international standard like ISO-9660 or Rock Ridge. It is mainly used on Windows systems.\n"
     5223"<p>Joliet does not allow all characters, so the Joliet filenames are not identical to the filenames on disk (as compared to Rock Ridge). Joliet has a filename length limitation of 64 chars (independent from the character coding and type e.g. European vs. Japanese). This is inconvenient, as modern file systems all allow 255 characters per path name component.\n"
    55885224"<p>Joliet uses UTF-16 coding.\n"
    5589 "<p><b>Caution:</b> With the exception of Linux and FreeBSD, there is no "
    5590 "POSIX-like OS that supports Joliet. So <b>never create Joliet-only CDs or "
    5591 "DVDs</b> for that reason."
     5225"<p><b>Caution:</b> With the exception of Linux and FreeBSD, there is no POSIX-like OS that supports Joliet. So <b>never create Joliet-only CDs or DVDs</b> for that reason."
    55925226msgstr ""
    55935227
     
    56085242#: projects/base_k3badvanceddataimagesettings.ui:273
    56095243msgid ""
    5610 "<p>If this option is checked K3b will create UDF filesystem structures in "
    5611 "addition to the ISO9660 filesystem.\n"
    5612 "<p>The UDF (<em><b>U</b>niversal <b>D</b>isk <b>F</b>ormat</em>) is mainly "
    5613 "used for DVDs."
     5244"<p>If this option is checked K3b will create UDF filesystem structures in addition to the ISO9660 filesystem.\n"
     5245"<p>The UDF (<em><b>U</b>niversal <b>D</b>isk <b>F</b>ormat</em>) is mainly used for DVDs."
    56145246msgstr ""
    56155247
     
    56315263#: projects/base_k3badvanceddataimagesettings.ui:293
    56325264msgid ""
    5633 "<p>If this option is checked, all files in the resulting file system will "
    5634 "have exactly the same permissions as the source files. (Otherwise, all files "
    5635 "will have equal permissions and be owned by root).\n"
    5636 "<p>This is mainly useful for backups.<p><b>Caution:</b> The permissions may "
    5637 "not make much sense on other file systems; for example, if a user that owns a "
    5638 "file on the CD or DVD does not exist."
     5265"<p>If this option is checked, all files in the resulting file system will have exactly the same permissions as the source files. (Otherwise, all files will have equal permissions and be owned by root).\n"
     5266"<p>This is mainly useful for backups.<p><b>Caution:</b> The permissions may not make much sense on other file systems; for example, if a user that owns a file on the CD or DVD does not exist."
    56395267msgstr ""
    56405268
     
    57595387msgid ""
    57605388"<p><b>CD-Text</b>\n"
    5761 "<p>If this option is checked K3b uses some otherwise unused space on the "
    5762 "Audio CD to store additional information, such as the artist's name or the CD "
    5763 "title.\n"
     5389"<p>If this option is checked K3b uses some otherwise unused space on the Audio CD to store additional information, such as the artist's name or the CD title.\n"
    57645390"<p>CD-Text is an extension to the audio CD standard introduced by Sony.\n"
    5765 "<p>CD-Text will only be usable on CD players that support this extension "
    5766 "(mostly car CD players) and software like K3b, of course.\n"
    5767 "<p>Since a CD-Text-enhanced Audio CD will work in any Hifi CD or DVD player "
    5768 "even if the player does not support CD-Text explicitly, enabling it is never "
    5769 "a bad idea (just remember to fill in the CD-Text information)."
     5391"<p>CD-Text will only be usable on CD players that support this extension (mostly car CD players) and software like K3b, of course.\n"
     5392"<p>Since a CD-Text-enhanced Audio CD will work in any Hifi CD or DVD player even if the player does not support CD-Text explicitly, enabling it is never a bad idea (just remember to fill in the CD-Text information)."
    57705393msgstr ""
    57715394
     
    58155438#. +> trunk stable
    58165439#: projects/base_k3baudiotrackwidget.ui:176
    5817 msgid ""
    5818 "<p>Preemphasis is mainly used in audio processing. Higher frequencies in "
    5819 "audio signals usually have lower amplitudes. This can lead to bad signal "
    5820 "quality on noisy transmission because the high frequencies might become too "
    5821 "weak. To avoid this effect, high frequencies are amplified before "
    5822 "transmission (preemphasis); the receiver will then weaken them accordingly "
    5823 "for playback."
     5440msgid "<p>Preemphasis is mainly used in audio processing. Higher frequencies in audio signals usually have lower amplitudes. This can lead to bad signal quality on noisy transmission because the high frequencies might become too weak. To avoid this effect, high frequencies are amplified before transmission (preemphasis); the receiver will then weaken them accordingly for playback."
    58245441msgstr ""
    58255442
     
    58475464msgid ""
    58485465"<p>On an audio CD each track (except for the last) can have a post-gap.\n"
    5849 "This does not mean that K3b adds an additional gap of silence to the track. "
    5850 "This setting simply influences the display on a Hifi audio CD player. The "
    5851 "part of an audio track that is marked as post-gap is counted backwards.\n"
    5852 "<p>This setting is irrelevant for most users as modern CD burners can put "
    5853 "arbitrary audio data in the post-gap when burning in DAO mode.\n"
    5854 "<p><i>In other CD-burning applications the post-gap might be called the "
    5855 "pre-gap. The pre-gap of track 2 is the same as the post-gap of track 1.\n"
     5466"This does not mean that K3b adds an additional gap of silence to the track. This setting simply influences the display on a Hifi audio CD player. The part of an audio track that is marked as post-gap is counted backwards.\n"
     5467"<p>This setting is irrelevant for most users as modern CD burners can put arbitrary audio data in the post-gap when burning in DAO mode.\n"
     5468"<p><i>In other CD-burning applications the post-gap might be called the pre-gap. The pre-gap of track 2 is the same as the post-gap of track 1.\n"
    58565469"<p><b>Changing the post-gap does not change the length of the track.</b>\n"
    5857 "<p><b>When writing in TAO writing mode (not recommended for Audio CDs) the "
    5858 "post-gap will most likely be muted and on some burners forced to 2 seconds.<"
    5859 "/b>"
     5470"<p><b>When writing in TAO writing mode (not recommended for Audio CDs) the post-gap will most likely be muted and on some burners forced to 2 seconds.</b>"
    58605471msgstr ""
    58615472
     
    60405651#: projects/base_k3bdataimagesettings.ui:105
    60415652msgid ""
    6042 "<p>K3b can create ISO9660 filesystems that contain symlinks if the Rock Ridge "
    6043 "extensions are enabled (they are by default). You can change the way symlinks "
    6044 "are handled in a K3b project.\n"
     5653"<p>K3b can create ISO9660 filesystems that contain symlinks if the Rock Ridge extensions are enabled (they are by default). You can change the way symlinks are handled in a K3b project.\n"
    60455654"\n"
    60465655"<p><b>No Change</b><br>\n"
     
    60485657"\n"
    60495658"<p><b>Discard broken symlinks</b><br>\n"
    6050 "K3b will discard all symbolic links that do not point to a file inside the "
    6051 "project. That includes all links to absolute paths like "
    6052 "'/home/myhome/testfile'.\n"
     5659"K3b will discard all symbolic links that do not point to a file inside the project. That includes all links to absolute paths like '/home/myhome/testfile'.\n"
    60535660"\n"
    60545661"<p><b>Discard all symlinks</b><br>\n"
    6055 "K3b will discard all symbolic links that have been added to the project; "
    6056 "meaning that the resulting file system will have no links at all.\n"
     5662"K3b will discard all symbolic links that have been added to the project; meaning that the resulting file system will have no links at all.\n"
    60575663"\n"
    60585664"<p><b>Follow symlinks</b><br>\n"
    6059 "Each symbolic link in the project will be replaced with the contents of the "
    6060 "file it is pointing to. Thus, the resulting filesystem will not contain any "
    6061 "symbolic links.<br>\n"
    6062 "Be aware that in case Rock Ridge extensions are disabled (which is not "
    6063 "recommended) symbolic links are always followed because ISO9660 does not "
    6064 "support symbolic links.\n"
     5665"Each symbolic link in the project will be replaced with the contents of the file it is pointing to. Thus, the resulting filesystem will not contain any symbolic links.<br>\n"
     5666"Be aware that in case Rock Ridge extensions are disabled (which is not recommended) symbolic links are always followed because ISO9660 does not support symbolic links.\n"
    60655667"\n"
    60665668"<p><b>Caution:</b> Symbolic links require Rock Ridge extensions."
     
    61115713msgid ""
    61125714"<p><b>No Change</b><br>\n"
    6113 "If this option is checked, K3b will leave all spaces in filenames as they are."
    6114 "\n"
     5715"If this option is checked, K3b will leave all spaces in filenames as they are.\n"
    61155716"<p><b>Strip</b><br>\n"
    6116 "If this option is checked, K3b will remove all spaces from all filenames.<br>"
    6117 "\n"
     5717"If this option is checked, K3b will remove all spaces from all filenames.<br>\n"
    61185718"Example: 'my good file.ext' becomes 'mygoodfile.ext'\n"
    61195719"<p><b>Extended Strip</b><br>\n"
    6120 "If this option is checked K3b will remove all spaces in all filenames and "
    6121 "capitalize all letters following a space.<br>\n"
     5720"If this option is checked K3b will remove all spaces in all filenames and capitalize all letters following a space.<br>\n"
    61225721"Example: 'my good file.ext' becomes 'myGoodFile.ext'\n"
    61235722"<p><b>Replace</b><br>\n"
    6124 "If this option is checked, K3b will replace all spaces in all filenames with "
    6125 "the specified characters.<br>\n"
     5723"If this option is checked, K3b will replace all spaces in all filenames with the specified characters.<br>\n"
    61265724"Example: 'my good file.ext' becomes 'my_good_file.ext'"
    61275725msgstr ""
     
    62915889#. +> trunk stable
    62925890#: projects/base_k3bmovixoptionswidget.ui:59
    6293 msgid ""
    6294 "<p>If this option is checked the order in which the files are played is "
    6295 "determined randomly every time it is played."
     5891msgid "<p>If this option is checked the order in which the files are played is determined randomly every time it is played."
    62965892msgstr ""
    62975893
     
    63115907#. +> trunk stable
    63125908#: projects/base_k3bmovixoptionswidget.ui:72
    6313 msgid ""
    6314 "<p>If this option is checked the resulting eMovix CD/DVD will not use DMA for "
    6315 "accessing the drive. This will slow down reading from the CD/DVD but may be "
    6316 "necessary on some systems that do not support DMA.</p>"
     5909msgid "<p>If this option is checked the resulting eMovix CD/DVD will not use DMA for accessing the drive. This will slow down reading from the CD/DVD but may be necessary on some systems that do not support DMA.</p>"
    63175910msgstr ""
    63185911
     
    64025995msgid ""
    64035996"<p><b>Audio Player Background</b>\n"
    6404 "<p>During audio playback normally the screen would be black. However, if a "
    6405 "background movie has been selected, eMovix will display it during playback.\n"
    6406 "<p>Additional background movies can be installed. However, this is not as "
    6407 "simple as a few mouse clicks. The background movies are stored in the emovix "
    6408 "shared data folder (mostly <i>/usr/share/emovix</i> or <i>"
    6409 "/usr/local/share/emovix</i>) under <em>backgrounds</em>. So to add a "
    6410 "background one has to copy the file to that folder."
     5997"<p>During audio playback normally the screen would be black. However, if a background movie has been selected, eMovix will display it during playback.\n"
     5998"<p>Additional background movies can be installed. However, this is not as simple as a few mouse clicks. The background movies are stored in the emovix shared data folder (mostly <i>/usr/share/emovix</i> or <i>/usr/local/share/emovix</i>) under <em>backgrounds</em>. So to add a background one has to copy the file to that folder."
    64115999msgstr ""
    64126000
     
    64526040msgid ""
    64536041"<p><b>eMovix Boot Labels</b>\n"
    6454 "<p>eMovix provides a variety of different boot configurations which can be "
    6455 "selected at boot time via a boot label (comparable to Lilo or Grub). The many "
    6456 "different boot configurations mainly influence the Video output.\n"
    6457 "<p>The <b>default</b>, <b>movix</b>, or <b>MoviX</b> labels start a general "
    6458 "Vesa video driver.\n"
    6459 "<p>The <b>TV</b> labels can be used to direct video to the TV output of the "
    6460 "graphic board. eMovix provides TVout drivers for different brands of graphic "
    6461 "boards.\n"
    6462 "<p>The <b>FB</b> labels refer to configurations that start a Frame Buffer "
    6463 "driver in different screen resolutions.\n"
    6464 "<p>The <b>AA</b> labels make eMovix output the video through the ASCII-Art "
    6465 "library which displays the picture in text mode through the usage of simple "
    6466 "ASCII characters.\n"
    6467 "<p>The <b>hd</b> label makes eMovix boot from the local harddisk instead of "
    6468 "the medium. This can be used to prevent accidental starting of an eMovix "
    6469 "medium.\n"
    6470 "<p>The <b>floppy</b> label makes eMovix boot from the local floppy drive "
    6471 "instead of the medium."
     6042"<p>eMovix provides a variety of different boot configurations which can be selected at boot time via a boot label (comparable to Lilo or Grub). The many different boot configurations mainly influence the Video output.\n"
     6043"<p>The <b>default</b>, <b>movix</b>, or <b>MoviX</b> labels start a general Vesa video driver.\n"
     6044"<p>The <b>TV</b> labels can be used to direct video to the TV output of the graphic board. eMovix provides TVout drivers for different brands of graphic boards.\n"
     6045"<p>The <b>FB</b> labels refer to configurations that start a Frame Buffer driver in different screen resolutions.\n"
     6046"<p>The <b>AA</b> labels make eMovix output the video through the ASCII-Art library which displays the picture in text mode through the usage of simple ASCII characters.\n"
     6047"<p>The <b>hd</b> label makes eMovix boot from the local harddisk instead of the medium. This can be used to prevent accidental starting of an eMovix medium.\n"
     6048"<p>The <b>floppy</b> label makes eMovix boot from the local floppy drive instead of the medium."
    64726049msgstr ""
    64736050
     
    64816058#. +> trunk stable
    64826059#: projects/base_k3bmovixoptionswidget.ui:232
    6483 msgid ""
    6484 "<p>The keyboard layout selected here will be used for eMovix commands such as "
    6485 "controlling the media player."
     6060msgid "<p>The keyboard layout selected here will be used for eMovix commands such as controlling the media player."
    64866061msgstr ""
    64876062
     
    65016076#. +> trunk stable
    65026077#: projects/base_k3bmovixoptionswidget.ui:257
    6503 msgid ""
    6504 "<p>If this option is checked the disk will be ejected after MPlayer has "
    6505 "finished."
     6078msgid "<p>If this option is checked the disk will be ejected after MPlayer has finished."
    65066079msgstr ""
    65076080
     
    65216094#. +> trunk stable
    65226095#: projects/base_k3bmovixoptionswidget.ui:270
    6523 msgid ""
    6524 "<p>If this option is checked the PC will be shut down after MPlayer has "
    6525 "finished playing."
     6096msgid "<p>If this option is checked the PC will be shut down after MPlayer has finished playing."
    65266097msgstr ""
    65276098
     
    65416112#. +> trunk stable
    65426113#: projects/base_k3bmovixoptionswidget.ui:283
    6543 msgid ""
    6544 "<p>If this option is checked the PC will be rebooted after MPlayer has "
    6545 "finished playing."
     6114msgid "<p>If this option is checked the PC will be rebooted after MPlayer has finished playing."
    65466115msgstr ""
    65476116
     
    65886157#. +> trunk stable
    65896158#: projects/k3baudioburndialog.cpp:119
    6590 msgid ""
    6591 "<p>If this option is checked K3b will <em>hide</em> the first track.<p>The "
    6592 "audio CD standard uses pregaps before every track on the CD. By default these "
    6593 "last for 2 seconds and are silent. In DAO mode it is possible to have longer "
    6594 "pregaps that contain some audio. In this case the first pregap will contain "
    6595 "the complete first track.<p>You will need to seek back from the beginning of "
    6596 "the CD to listen to the first track. Try it, it is quite amusing.<p><b>This "
    6597 "feature is only available in DAO mode when writing with cdrdao."
     6159msgid "<p>If this option is checked K3b will <em>hide</em> the first track.<p>The audio CD standard uses pregaps before every track on the CD. By default these last for 2 seconds and are silent. In DAO mode it is possible to have longer pregaps that contain some audio. In this case the first pregap will contain the complete first track.<p>You will need to seek back from the beginning of the CD to listen to the first track. Try it, it is quite amusing.<p><b>This feature is only available in DAO mode when writing with cdrdao."
    65986160msgstr ""
    65996161
    66006162#. +> trunk stable
    66016163#: projects/k3baudioburndialog.cpp:286 projects/k3bmixedburndialog.cpp:288
    6602 msgid ""
    6603 "<p><b>External program <em>normalize</em> is not installed.</b><p>K3b uses <"
    6604 "em>normalize</em> (http://normalize.nongnu.org/) to normalize audio tracks. "
    6605 "In order to use this functionality, please install it first."
     6164msgid "<p><b>External program <em>normalize</em> is not installed.</b><p>K3b uses <em>normalize</em> (http://normalize.nongnu.org/) to normalize audio tracks. In order to use this functionality, please install it first."
    66066165msgstr ""
    66076166
     
    66096168#: projects/k3baudioburndialog.cpp:293 projects/k3baudioburndialog.cpp:312
    66106169#: projects/k3bmixedburndialog.cpp:295 projects/k3bmixedburndialog.cpp:314
    6611 msgid ""
    6612 "<p>K3b is not able to normalize audio tracks when burning on-the-fly. The "
    6613 "external program used for this task only supports normalizing a set of audio "
    6614 "files."
     6170msgid "<p>K3b is not able to normalize audio tracks when burning on-the-fly. The external program used for this task only supports normalizing a set of audio files."
    66156171msgstr ""
    66166172
     
    66276183msgstr ""
    66286184
    6629 #. +> trunk stable
     6185#. +> trunk
     6186#: projects/k3baudiodatasourceeditwidget.cpp:38
     6187#, fuzzy
     6188#| msgid "Shadow:"
     6189msgid "Start Offset:"
     6190msgstr "Rubovi strane"
     6191
     6192#. +> stable
    66306193#: projects/k3baudiodatasourceeditwidget.cpp:38
    66316194msgid "Start Offset"
    66326195msgstr ""
    66336196
    6634 #. +> trunk stable
     6197#. +> trunk
     6198#: projects/k3baudiodatasourceeditwidget.cpp:39
     6199#, fuzzy
     6200msgid "End Offset:"
     6201msgstr "Pomak:"
     6202
     6203#. +> stable
    66356204#: projects/k3baudiodatasourceeditwidget.cpp:39
    66366205msgid "End Offset"
     
    66396208#. +> trunk stable
    66406209#: projects/k3baudiodatasourceeditwidget.cpp:62
    6641 msgid ""
    6642 "Drag the edges of the highlighted area to define the portion of the audio "
    6643 "source you want to include in the Audio CD track. You can also use the input "
    6644 "windows to fine-tune your selection."
     6210msgid "Drag the edges of the highlighted area to define the portion of the audio source you want to include in the Audio CD track. You can also use the input windows to fine-tune your selection."
    66456211msgstr ""
    66466212
     
    67216287#. +> trunk stable
    67226288#: projects/k3baudiotrackaddingdialog.cpp:93
    6723 msgid ""
    6724 "You may manually convert these audio files to wave using another application "
    6725 "supporting the audio format and then add the wave files to the K3b project."
     6289msgid "You may manually convert these audio files to wave using another application supporting the audio format and then add the wave files to the K3b project."
    67266290msgstr ""
    67276291
     
    69566520#. +> trunk stable
    69576521#: projects/k3bbootimageview.cpp:108
    6958 msgid ""
    6959 "<p>The file you selected is not a floppy image (floppy images are of size "
    6960 "1200 KB, 1440 KB, or 2880 KB). You may still use boot images of other sizes "
    6961 "by emulating a harddisk or disabling emulation completely. <p>If you are not "
    6962 "familiar with terms like 'harddisk emulation' you most likely want to use a "
    6963 "floppy image here. Floppy images can be created by directly extracting them "
    6964 "from a real floppy disk:<pre>dd if=/dev/floppy of=/tmp/floppy.img</pre>or by "
    6965 "using one of the many boot floppy generators that can be found on <a "
    6966 "href=\"http://www.google.com/search?q=linux+boot+floppy&ie=UTF-8&oe=UTF-8\">"
    6967 "the Internet</a>."
     6522msgid "<p>The file you selected is not a floppy image (floppy images are of size 1200 KB, 1440 KB, or 2880 KB). You may still use boot images of other sizes by emulating a harddisk or disabling emulation completely. <p>If you are not familiar with terms like 'harddisk emulation' you most likely want to use a floppy image here. Floppy images can be created by directly extracting them from a real floppy disk:<pre>dd if=/dev/floppy of=/tmp/floppy.img</pre>or by using one of the many boot floppy generators that can be found on <a href=\"http://www.google.com/search?q=linux+boot+floppy&ie=UTF-8&oe=UTF-8\">the Internet</a>."
    69686523msgstr ""
    69696524
     
    70436598#. +> trunk stable
    70446599#: projects/k3bdataburndialog.cpp:262
    7045 msgid ""
    7046 "It is not possible to write multisession media in DAO mode. Multisession has "
    7047 "been disabled."
     6600msgid "It is not possible to write multisession media in DAO mode. Multisession has been disabled."
    70486601msgstr ""
    70496602
     
    70836636#: projects/k3bdataimagesettingswidget.cpp:98
    70846637#, fuzzy
    7085 msgctxt ""
    7086 "This is the default volume identifier of a data project created by K3b. The "
    7087 "string should not be longer than 16 characters to avoid warnings regarding "
    7088 "Joiliet extensions which induce this restriction."
     6638msgctxt "This is the default volume identifier of a data project created by K3b. The string should not be longer than 16 characters to avoid warnings regarding Joiliet extensions which induce this restriction."
    70896639msgid "K3b data project"
    70906640msgstr "Quanta projekt"
     
    70926642#. +> trunk stable
    70936643#: projects/k3bdataimagesettingswidget.cpp:152
    7094 msgid ""
    7095 "<p><b>File System Presets</b><p>K3b provides the following file system "
    7096 "Presets which allow for a quick selection of the most frequently used "
    7097 "settings."
     6644msgid "<p><b>File System Presets</b><p>K3b provides the following file system Presets which allow for a quick selection of the most frequently used settings."
    70986645msgstr ""
    70996646
    71006647#. +> trunk stable
    71016648#: projects/k3bdataimagesettingswidget.cpp:156
    7102 msgid ""
    7103 "The file system is optimized for usage on Linux/Unix systems. This mainly "
    7104 "means that it uses the Rock Ridge extensions to provide long filenames, "
    7105 "symbolic links, and POSIX compatible file permissions."
     6649msgid "The file system is optimized for usage on Linux/Unix systems. This mainly means that it uses the Rock Ridge extensions to provide long filenames, symbolic links, and POSIX compatible file permissions."
    71066650msgstr ""
    71076651
    71086652#. +> trunk stable
    71096653#: projects/k3bdataimagesettingswidget.cpp:160
    7110 msgid ""
    7111 "In addition to the settings for Linux/Unix the file system contains a Joliet "
    7112 "tree which allows for long file names on Windows which does not support the "
    7113 "Rock Ridge extensions. Be aware that the file name length is restricted to "
    7114 "103 characters."
     6654msgid "In addition to the settings for Linux/Unix the file system contains a Joliet tree which allows for long file names on Windows which does not support the Rock Ridge extensions. Be aware that the file name length is restricted to 103 characters."
    71156655msgstr ""
    71166656
    71176657#. +> trunk stable
    71186658#: projects/k3bdataimagesettingswidget.cpp:164
    7119 msgid ""
    7120 "The file system has additional UDF entries attached to it. This raises the "
    7121 "maximal file size to 4 GB. Be aware that the UDF support in K3b is limited."
     6659msgid "The file system has additional UDF entries attached to it. This raises the maximal file size to 4 GB. Be aware that the UDF support in K3b is limited."
    71226660msgstr ""
    71236661
    71246662#. +> trunk stable
    71256663#: projects/k3bdataimagesettingswidget.cpp:167
    7126 msgid ""
    7127 "The file system is optimized for compatibility with old systems. That means "
    7128 "file names are restricted to 8.3 characters and no symbolic links or file "
    7129 "permissions are supported."
     6664msgid "The file system is optimized for compatibility with old systems. That means file names are restricted to 8.3 characters and no symbolic links or file permissions are supported."
    71306665msgstr ""
    71316666
     
    71586693#. +> trunk stable
    71596694#: projects/k3bdataimagesettingswidget.cpp:247
    7160 msgid ""
    7161 "<p>Be aware that it is not recommended to disable the Rock Ridge Extensions. "
    7162 "There is no disadvantage in enabling Rock Ridge (except for a very small "
    7163 "space overhead) but a lot of advantages.<p>Without Rock Ridge Extensions "
    7164 "symbolic links are not supported and will always be followed as if the "
    7165 "\"Follow Symbolic Links\" option was enabled."
     6695msgid "<p>Be aware that it is not recommended to disable the Rock Ridge Extensions. There is no disadvantage in enabling Rock Ridge (except for a very small space overhead) but a lot of advantages.<p>Without Rock Ridge Extensions symbolic links are not supported and will always be followed as if the \"Follow Symbolic Links\" option was enabled."
    71666696msgstr ""
    71676697
     
    71736703#. +> trunk stable
    71746704#: projects/k3bdataimagesettingswidget.cpp:259
    7175 msgid ""
    7176 "<p>Be aware that without the Joliet extensions Windows systems will not be "
    7177 "able to display long filenames. You will only see the ISO9660 filenames.<p>If "
    7178 "you do not intend to use the CD/DVD on a Windows system it is safe to disable "
    7179 "Joliet."
     6705msgid "<p>Be aware that without the Joliet extensions Windows systems will not be able to display long filenames. You will only see the ISO9660 filenames.<p>If you do not intend to use the CD/DVD on a Windows system it is safe to disable Joliet."
    71806706msgstr ""
    71816707
     
    71926718#. +> trunk stable
    71936719#: projects/k3bdatamultisessioncombobox.cpp:37
    7194 msgid ""
    7195 "<p><b>Multisession Mode</b><p><b>Auto</b><br>Let K3b decide which mode to use."
    7196 " The decision will be based on the size of the project (does it fill the "
    7197 "whole media) and the state of the inserted media (appendable or not).<p><b>No "
    7198 "Multisession</b><br>Create a single-session CD or DVD and close the disk.<p><"
    7199 "b>Start Multisession</b><br>Start a multisession CD or DVD, not closing the "
    7200 "disk to allow further sessions to be appended.<p><b>Continue Multisession</b>"
    7201 "<br>Continue an appendable data CD (as for example created in <em>Start "
    7202 "Multisession</em> mode) and add another session without closing the disk to "
    7203 "allow further sessions to be appended.<p><b>Finish Multisession</b><br>"
    7204 "Continue an appendable data CD (as for example created in <em>Start "
    7205 "Multisession</em> mode), add another session, and close the disk.<p><em>In "
    7206 "the case of DVD+RW and DVD-RW restricted overwrite media K3b will not "
    7207 "actually create multiple sessions but grow the file system to include the new "
    7208 "data.</em>"
     6720msgid "<p><b>Multisession Mode</b><p><b>Auto</b><br>Let K3b decide which mode to use. The decision will be based on the size of the project (does it fill the whole media) and the state of the inserted media (appendable or not).<p><b>No Multisession</b><br>Create a single-session CD or DVD and close the disk.<p><b>Start Multisession</b><br>Start a multisession CD or DVD, not closing the disk to allow further sessions to be appended.<p><b>Continue Multisession</b><br>Continue an appendable data CD (as for example created in <em>Start Multisession</em> mode) and add another session without closing the disk to allow further sessions to be appended.<p><b>Finish Multisession</b><br>Continue an appendable data CD (as for example created in <em>Start Multisession</em> mode), add another session, and close the disk.<p><em>In the case of DVD+RW and DVD-RW restricted overwrite media K3b will not actually create multiple sessions but grow the file system to include the new data.</em>"
    72096721msgstr ""
    72106722
     
    72316743#. +> trunk stable
    72326744#: projects/k3bdatamultisessionimportdialog.cpp:98
    7233 msgid ""
    7234 "<p>K3b found session containing Joliet information for long filenames but no "
    7235 "Rock Ridge extensions.<p>The filenames in the imported session will be "
    7236 "converted to a restricted character set in the new session. This character "
    7237 "set is based on the ISO9660 settings in the K3b project. K3b is not able to "
    7238 "display these converted filenames yet."
     6745msgid "<p>K3b found session containing Joliet information for long filenames but no Rock Ridge extensions.<p>The filenames in the imported session will be converted to a restricted character set in the new session. This character set is based on the ISO9660 settings in the K3b project. K3b is not able to display these converted filenames yet."
    72396746msgstr ""
    72406747
     
    73826889#. +> trunk stable
    73836890#: projects/k3bdatapropertiesdialog.cpp:165
    7384 msgid ""
    7385 "<p>If this option is checked, the file or folder (and its entire contents) "
    7386 "will be hidden on the ISO9660 and RockRidge filesystem.</p><p>This is useful, "
    7387 "for example, for having different README files for RockRidge and Joliet, "
    7388 "which can be managed by hiding README.joliet on RockRidge and README.rr on "
    7389 "the Joliet filesystem.</p>"
     6891msgid "<p>If this option is checked, the file or folder (and its entire contents) will be hidden on the ISO9660 and RockRidge filesystem.</p><p>This is useful, for example, for having different README files for RockRidge and Joliet, which can be managed by hiding README.joliet on RockRidge and README.rr on the Joliet filesystem.</p>"
    73906892msgstr ""
    73916893
    73926894#. +> trunk stable
    73936895#: projects/k3bdatapropertiesdialog.cpp:172
    7394 msgid ""
    7395 "<p>If this option is checked, the file or folder (and its entire contents) "
    7396 "will be hidden on the Joliet filesystem.</p><p>This is useful, for example, "
    7397 "for having different README files for RockRidge and Joliet, which can be "
    7398 "managed by hiding README.joliet on RockRidge and README.rr on the Joliet "
    7399 "filesystem.</p>"
     6896msgid "<p>If this option is checked, the file or folder (and its entire contents) will be hidden on the Joliet filesystem.</p><p>This is useful, for example, for having different README files for RockRidge and Joliet, which can be managed by hiding README.joliet on RockRidge and README.rr on the Joliet filesystem.</p>"
    74006897msgstr ""
    74016898
    74026899#. +> trunk stable
    74036900#: projects/k3bdatapropertiesdialog.cpp:179
    7404 msgid ""
    7405 "<p>This value modifies the physical sort order of the files in the ISO9660 "
    7406 "filesystem. A higher weighting means that the file will be located closer to "
    7407 "the beginning of the image (and the disk).<p>This option is useful in order "
    7408 "to optimize the data layout on a medium.<p><b>Caution:</b> This does not sort "
    7409 "the order of the file names that appear in the ISO9660 folder. It sorts the "
    7410 "order in which the file data is written to the image."
     6901msgid "<p>This value modifies the physical sort order of the files in the ISO9660 filesystem. A higher weighting means that the file will be located closer to the beginning of the image (and the disk).<p>This option is useful in order to optimize the data layout on a medium.<p><b>Caution:</b> This does not sort the order of the file names that appear in the ISO9660 folder. It sorts the order in which the file data is written to the image."
    74116902msgstr ""
    74126903
     
    75016992msgstr[2] "Otvori datoteku"
    75026993
     6994#. +> trunk
     6995#: projects/k3bdatapropertiesdialog.cpp:305
     6996#, fuzzy
     6997msgid "No Files"
     6998msgstr "INI datoteke"
     6999
    75037000#. +> stable
    75047001#: projects/k3bdatapropertiesdialog.cpp:293
     
    75197016msgstr[2] "%1 mapa"
    75207017
     7018#. +> trunk
     7019#: projects/k3bdatapropertiesdialog.cpp:310
     7020#, fuzzy
     7021#| msgid "Folders"
     7022msgid "No Folders"
     7023msgstr "Mape"
     7024
    75217025#. +> trunk stable
    75227026#: projects/k3bdataurladdingdialog.cpp:95
     
    75277031#. +> trunk stable
    75287032#: projects/k3bdataurladdingdialog.cpp:117
     7033#, kde-format
     7034msgid "Adding files to project '%1'"
     7035msgstr ""
     7036
     7037#. +> trunk
    75297038#: projects/k3bdataurladdingdialog.cpp:123
    7530 #, kde-format
    7531 msgid "Adding files to project '%1'"
    7532 msgstr ""
     7039#, fuzzy, kde-format
     7040msgid "Adding files to project '%1'..."
     7041msgstr "Dodavanje datoteka u SVN repozitorij
"
    75337042
    75347043#. +> trunk stable
    75357044#: projects/k3bdataurladdingdialog.cpp:197
    7536 msgid ""
    7537 "<p>The file you are about to add to the project is an ISO9660 image. As such "
    7538 "it can be burned to a medium directly since it already contains a file system."
    7539 "<br>Are you sure you want to add this file to the project?"
     7045msgid "<p>The file you are about to add to the project is an ISO9660 image. As such it can be burned to a medium directly since it already contains a file system.<br>Are you sure you want to add this file to the project?"
    75407046msgstr ""
    75417047
     
    76277133#: projects/k3bdataurladdingdialog.cpp:462
    76287134#, kde-format
    7629 msgid ""
    7630 "<p>'%1' is a symbolic link to folder '%2'.<p>If you intend to make K3b follow "
    7631 "symbolic links you should consider letting K3b do this now since K3b will not "
    7632 "be able to do so afterwards because symbolic links to folders inside a K3b "
    7633 "project cannot be resolved.<p><b>If you do not intend to enable the option <"
    7634 "em>follow symbolic links</em> you may safely ignore this warning and choose "
    7635 "to add the link to the project.</b>"
     7135msgid "<p>'%1' is a symbolic link to folder '%2'.<p>If you intend to make K3b follow symbolic links you should consider letting K3b do this now since K3b will not be able to do so afterwards because symbolic links to folders inside a K3b project cannot be resolved.<p><b>If you do not intend to enable the option <em>follow symbolic links</em> you may safely ignore this warning and choose to add the link to the project.</b>"
    76367136msgstr ""
    76377137
     
    76927192#. +> trunk stable
    76937193#: projects/k3bdataurladdingdialog.cpp:786
    7694 msgid ""
    7695 "Do you also want to add system files (FIFOs, sockets, device files, and "
    7696 "broken symlinks)?"
     7194msgid "Do you also want to add system files (FIFOs, sockets, device files, and broken symlinks)?"
    76977195msgstr ""
    76987196
     
    77157213#. +> trunk stable
    77167214#: projects/k3bdataurladdingdialog.cpp:824
    7717 msgid ""
    7718 "The following filenames have an invalid encoding. You may fix this with the "
    7719 "convmv tool"
     7215msgid "The following filenames have an invalid encoding. You may fix this with the convmv tool"
    77207216msgstr ""
    77217217
     
    77887284#. +> trunk stable
    77897285#: projects/k3bdataviewimpl.cpp:221
    7790 msgid ""
    7791 "A file with that name already exists. Please insert the name for the new "
    7792 "folder:"
     7286msgid "A file with that name already exists. Please insert the name for the new folder:"
    77937287msgstr ""
    77947288
     
    77977291msgid "Edit Boot Images"
    77987292msgstr ""
    7799 
    7800 #. +> trunk stable
    7801 #: projects/k3bfillstatusdisplay.cpp:180 projects/k3bfillstatusdisplay.cpp:586
    7802 #: projects/k3bfillstatusdisplay.cpp:849
    7803 #, fuzzy
    7804 msgid "min"
    7805 msgstr " min"
    78067293
    78077294#. +> trunk stable
     
    79067393#. +> trunk stable
    79077394#: projects/k3bfillstatusdisplay.cpp:571
    7908 msgid ""
    7909 "<p><b>Why does K3b offer 4.4 GB and 8.0 GB instead of 4.7 and 8.5 like it "
    7910 "says on the media?</b><p>A single layer DVD media has a capacity of "
    7911 "approximately 4.4 GB which equals 4.4*1024<sup>3</sup> bytes. Media producers "
    7912 "just calculate with 1000 instead of 1024 for advertising reasons.<br>This "
    7913 "results in 4.4*1024<sup>3</sup>/1000<sup>3</sup> = 4.7 GB."
     7395msgid "<p><b>Why does K3b offer 4.4 GB and 8.0 GB instead of 4.7 and 8.5 like it says on the media?</b><p>A single layer DVD media has a capacity of approximately 4.4 GB which equals 4.4*1024<sup>3</sup> bytes. Media producers just calculate with 1000 instead of 1024 for advertising reasons.<br>This results in 4.4*1024<sup>3</sup>/1000<sup>3</sup> = 4.7 GB."
    79147396msgstr ""
    79157397
     
    79217403
    79227404#. +> trunk stable
     7405#: projects/k3bfillstatusdisplay.cpp:586
     7406#, fuzzy
     7407msgid "min"
     7408msgstr " min"
     7409
     7410#. +> trunk stable
    79237411#: projects/k3bfillstatusdisplay.cpp:599
    79247412msgid "Custom Size"
     
    79277415#. +> trunk stable
    79287416#: projects/k3bfillstatusdisplay.cpp:600
    7929 msgid ""
    7930 "<p>Please specify the size of the medium. Use suffixes <b>GB</b>,<b>MB</b>, "
    7931 "and <b>min</b> for <em>gigabytes</em>, <em>megabytes</em>, and <em>minutes<"
    7932 "/em> respectively."
     7417msgid "<p>Please specify the size of the medium. Use suffixes <b>GB</b>,<b>MB</b>, and <b>min</b> for <em>gigabytes</em>, <em>megabytes</em>, and <em>minutes</em> respectively."
    79337418msgstr ""
    79347419
     
    79657450#. +> trunk stable
    79667451#: projects/k3bmixedburndialog.cpp:104
    7967 msgid ""
    7968 "<em>Blue book CD</em><br>K3b will create a multisession CD with 2 sessions. "
    7969 "The first session will contain all audio tracks and the second session will "
    7970 "contain a mode 2 form 1 data track.<br>This mode is based on the <em>Blue "
    7971 "book</em> standard (also known as <em>Extended Audio CD</em>, <em>CD-Extra<"
    7972 "/em>, or <em>CD Plus</em>) and has the advantage that a hifi audio CD player "
    7973 "will only recognize the first session and ignore the second session with the "
    7974 "data track.<br>If the CD is intended to be used in a hifi audio CD player "
    7975 "this is the recommended mode.<br>Some older CD-ROMs may have problems reading "
    7976 "a blue book CD since it is a multisession CD."
     7452msgid "<em>Blue book CD</em><br>K3b will create a multisession CD with 2 sessions. The first session will contain all audio tracks and the second session will contain a mode 2 form 1 data track.<br>This mode is based on the <em>Blue book</em> standard (also known as <em>Extended Audio CD</em>, <em>CD-Extra</em>, or <em>CD Plus</em>) and has the advantage that a hifi audio CD player will only recognize the first session and ignore the second session with the data track.<br>If the CD is intended to be used in a hifi audio CD player this is the recommended mode.<br>Some older CD-ROMs may have problems reading a blue book CD since it is a multisession CD."
    79777453msgstr ""
    79787454
     
    79997475#. +> trunk stable
    80007476#: projects/k3bmixedburndialog.cpp:128
    8001 msgid ""
    8002 "<b>Caution:</b> The last two modes should only be used for CDs that are "
    8003 "unlikely to be played on a hifi audio CD player.<br>It could lead to problems "
    8004 "with some older hifi audio CD players that try to play the data track."
     7477msgid "<b>Caution:</b> The last two modes should only be used for CDs that are unlikely to be played on a hifi audio CD player.<br>It could lead to problems with some older hifi audio CD players that try to play the data track."
    80057478msgstr ""
    80067479
     
    80647537msgstr "zadano"
    80657538
    8066 #. +> trunk stable
     7539#. +> trunk
     7540#: projects/k3bmovixprojectmodel.cpp:296
     7541#, fuzzy, kde-format
     7542msgid "%1 (broken)"
     7543msgstr "%1 (trenutno)"
     7544
     7545#. +> stable
    80677546#: projects/k3bmovixprojectmodel.cpp:296
    80687547msgid " (broken)"
     
    83277806#. +> trunk stable
    83287807#: projects/k3bvcdburndialog.cpp:117 projects/k3bvcdtrackdialog.cpp:258
    8329 msgid ""
    8330 "Playback control, PBC, is available for Video CD 2.0 and Super Video CD 1.0 "
    8331 "disc formats."
     7808msgid "Playback control, PBC, is available for Video CD 2.0 and Super Video CD 1.0 disc formats."
    83327809msgstr ""
    83337810
     
    83447821#. +> trunk stable
    83457822#: projects/k3bvcdburndialog.cpp:120
    8346 msgid ""
    8347 "This controls whether to update the scan data information contained in the "
    8348 "MPEG-2 video streams."
     7823msgid "This controls whether to update the scan data information contained in the MPEG-2 video streams."
    83497824msgstr ""
    83507825
    83517826#. +> trunk stable
    83527827#: projects/k3bvcdburndialog.cpp:121
    8353 msgid ""
    8354 "This element allows to set viewing restrictions which may be interpreted by "
    8355 "the playing device."
     7828msgid "This element allows to set viewing restrictions which may be interpreted by the playing device."
    83567829msgstr ""
    83577830
     
    83637836#. +> trunk stable
    83647837#: projects/k3bvcdburndialog.cpp:124
    8365 msgid ""
    8366 "Used to set the number of empty sectors added before the lead-out area begins."
     7838msgid "Used to set the number of empty sectors added before the lead-out area begins."
    83677839msgstr ""
    83687840
     
    83847856#. +> trunk stable
    83857857#: projects/k3bvcdburndialog.cpp:131
    8386 msgid ""
    8387 "<p>This is the most basic <b>Video CD</b> specification dating back to 1993, "
    8388 "which has the following characteristics:<ul><li>One mode2 mixed form ISO-9660 "
    8389 "track containing file pointers to the information areas.</li><li>Up to 98 "
    8390 "multiplex-ed MPEG-1 audio/video streams or CD-DA audio tracks.</li><li>Up to "
    8391 "500 MPEG sequence entry points used as chapter divisions.</li></ul><p>The "
    8392 "Video CD specification requires the multiplex-ed MPEG-1 stream to have a CBR "
    8393 "of less than 174300 bytes (1394400 bits) per second in order to accommodate "
    8394 "single speed CD-ROM drives.<br>The specification allows for the following two "
    8395 "resolutions:<ul><li>352 x 240 @ 29.97 Hz (NTSC SIF).</li><li>352 x 240 @ 23."
    8396 "976 Hz (FILM SIF).</li></ul><p>The CBR MPEG-1, layer II audio stream is fixed "
    8397 "at 224 kbps with 1 stereo or 2 mono channels.<p><b>It is recommended to keep "
    8398 "the video bit-rate under 1151929.1 bps.</b>"
     7858msgid "<p>This is the most basic <b>Video CD</b> specification dating back to 1993, which has the following characteristics:<ul><li>One mode2 mixed form ISO-9660 track containing file pointers to the information areas.</li><li>Up to 98 multiplex-ed MPEG-1 audio/video streams or CD-DA audio tracks.</li><li>Up to 500 MPEG sequence entry points used as chapter divisions.</li></ul><p>The Video CD specification requires the multiplex-ed MPEG-1 stream to have a CBR of less than 174300 bytes (1394400 bits) per second in order to accommodate single speed CD-ROM drives.<br>The specification allows for the following two resolutions:<ul><li>352 x 240 @ 29.97 Hz (NTSC SIF).</li><li>352 x 240 @ 23.976 Hz (FILM SIF).</li></ul><p>The CBR MPEG-1, layer II audio stream is fixed at 224 kbps with 1 stereo or 2 mono channels.<p><b>It is recommended to keep the video bit-rate under 1151929.1 bps.</b>"
    83997859msgstr ""
    84007860
    84017861#. +> trunk stable
    84027862#: projects/k3bvcdburndialog.cpp:142
    8403 msgid ""
    8404 "<p>About two years after the Video CD 1.1 specification came out, an improved "
    8405 "<b>Video CD 2.0</b> standard was published in 1995.<p>This one added the "
    8406 "following items to the features already available in the Video CD 1.1 "
    8407 "specification:<ul><li>Support for MPEG segment play items (<b>\"SPI\"</b>), "
    8408 "consisting of still pictures, motion pictures and/or audio (only) streams was "
    8409 "added.</li><li>Note Segment Items::.</li><li>Support for interactive playback "
    8410 "control (<b>\"PBC\"</b>) was added.</li><li>Support for playing related "
    8411 "access by providing a scan point index file was added. (<b>\"/EXT/SCANDATA."
    8412 "DAT\"</b>)</li><li>Support for closed captions.</li><li>Support for mixing "
    8413 "NTSC and PAL content.</li></ul><p>By adding PAL support to the Video CD 1.1 "
    8414 "specification, the following resolutions became available:<ul><li>352 x 240 @ "
    8415 "29.97 Hz (NTSC SIF).</li><li>352 x 240 @ 23.976 Hz (FILM SIF).</li><li>352 x "
    8416 "288 @ 25 Hz (PAL SIF).</li></ul><p>For segment play items the following audio "
    8417 "encodings became available:<ul><li>Joint stereo, stereo or dual channel audio "
    8418 "streams at 128, 192, 224 or 384 kbit/sec bit-rate.</li><li>Mono audio streams "
    8419 "at 64, 96 or 192 kbit/sec bit-rate.</li></ul><p>Also the possibility to have "
    8420 "audio only streams and still pictures was provided.<p><b>The bit-rate of "
    8421 "multiplex-ed streams should be kept under 174300 bytes/sec (except for single "
    8422 "still picture items) in order to accommodate single speed drives.</b>"
     7863msgid "<p>About two years after the Video CD 1.1 specification came out, an improved <b>Video CD 2.0</b> standard was published in 1995.<p>This one added the following items to the features already available in the Video CD 1.1 specification:<ul><li>Support for MPEG segment play items (<b>\"SPI\"</b>), consisting of still pictures, motion pictures and/or audio (only) streams was added.</li><li>Note Segment Items::.</li><li>Support for interactive playback control (<b>\"PBC\"</b>) was added.</li><li>Support for playing related access by providing a scan point index file was added. (<b>\"/EXT/SCANDATA.DAT\"</b>)</li><li>Support for closed captions.</li><li>Support for mixing NTSC and PAL content.</li></ul><p>By adding PAL support to the Video CD 1.1 specification, the following resolutions became available:<ul><li>352 x 240 @ 29.97 Hz (NTSC SIF).</li><li>352 x 240 @ 23.976 Hz (FILM SIF).</li><li>352 x 288 @ 25 Hz (PAL SIF).</li></ul><p>For segment play items the following audio encodings became available:<ul><li>Joint stereo, stereo or dual channel audio streams at 128, 192, 224 or 384 kbit/sec bit-rate.</li><li>Mono audio streams at 64, 96 or 192 kbit/sec bit-rate.</li></ul><p>Also the possibility to have audio only streams and still pictures was provided.<p><b>The bit-rate of multiplex-ed streams should be kept under 174300 bytes/sec (except for single still picture items) in order to accommodate single speed drives.</b>"
    84237864msgstr ""
    84247865
    84257866#. +> trunk stable
    84267867#: projects/k3bvcdburndialog.cpp:160
    8427 msgid ""
    8428 "<p>With the upcoming of the DVD-V media, a new VCD standard had to be "
    8429 "published in order to be able to keep up with technology, so the Super Video "
    8430 "CD specification was called into life 1999.<p>In the midst of 2000 a full "
    8431 "subset of this <b>Super Video CD</b> specification was published as <b>"
    8432 "IEC-62107</b>.<p>As the most notable change over Video CD 2.0 is a switch "
    8433 "from MPEG-1 CBR to MPEG-2 VBR encoding for the video stream was performed.<p>"
    8434 "The following new features--building upon the Video CD 2.0 "
    8435 "specification--are:<ul><li>Use of MPEG-2 encoding instead of MPEG-1 for the "
    8436 "video stream.</li><li>Allowed VBR encoding of MPEG-1 audio stream.</li><li>"
    8437 "Higher resolutions (see below) for video stream resolution.</li><li>Up to 4 "
    8438 "overlay graphics and text (<b>\"OGT\"</b>) sub-channels for user switchable "
    8439 "subtitle displaying in addition to the already existing closed caption "
    8440 "facility.</li><li>Command lists for controlling the SVCD virtual machine.</li>"
    8441 "</ul><p>For the <b>Super Video CD</b>, only the following two resolutions are "
    8442 "supported for motion video and (low resolution) still pictures:<ul><li>480 x "
    8443 "480 @ 29.97 Hz (NTSC 2/3 D-2).</li><li>480 x 576 @ 25 Hz (PAL 2/3 D-2).</li><"
    8444 "/ul>"
     7868msgid "<p>With the upcoming of the DVD-V media, a new VCD standard had to be published in order to be able to keep up with technology, so the Super Video CD specification was called into life 1999.<p>In the midst of 2000 a full subset of this <b>Super Video CD</b> specification was published as <b>IEC-62107</b>.<p>As the most notable change over Video CD 2.0 is a switch from MPEG-1 CBR to MPEG-2 VBR encoding for the video stream was performed.<p>The following new features--building upon the Video CD 2.0 specification--are:<ul><li>Use of MPEG-2 encoding instead of MPEG-1 for the video stream.</li><li>Allowed VBR encoding of MPEG-1 audio stream.</li><li>Higher resolutions (see below) for video stream resolution.</li><li>Up to 4 overlay graphics and text (<b>\"OGT\"</b>) sub-channels for user switchable subtitle displaying in addition to the already existing closed caption facility.</li><li>Command lists for controlling the SVCD virtual machine.</li></ul><p>For the <b>Super Video CD</b>, only the following two resolutions are supported for motion video and (low resolution) still pictures:<ul><li>480 x 480 @ 29.97 Hz (NTSC 2/3 D-2).</li><li>480 x 576 @ 25 Hz (PAL 2/3 D-2).</li></ul>"
    84457869msgstr ""
    84467870
    84477871#. +> trunk stable
    84487872#: projects/k3bvcdburndialog.cpp:173
    8449 msgid ""
    8450 "<p>This is actually just a minor variation defined in IEC-62107 on the Super "
    8451 "Video CD 1.0 format for compatibility with current products in the market.<p>"
    8452 "It differs from the Super Video CD 1.0 format in the following items:<ul><li>"
    8453 "The system profile tag field in <b>/SVCD/INFO.SVD</b> is set to <b>1</b> "
    8454 "instead of <b>0</b>.</li><li>The system identification field value in <b>"
    8455 "/SVCD/INFO.SVD</b> is set to <b>HQ-VCD</b> instead of <b>SUPERVCD</b>.</li><"
    8456 "li><b>/EXT/SCANDATA.DAT</b> is mandatory instead of being optional.</li><li><"
    8457 "b>/SVCD/SEARCH.DAT</b> is optional instead of being mandatory.</li></ul>"
     7873msgid "<p>This is actually just a minor variation defined in IEC-62107 on the Super Video CD 1.0 format for compatibility with current products in the market.<p>It differs from the Super Video CD 1.0 format in the following items:<ul><li>The system profile tag field in <b>/SVCD/INFO.SVD</b> is set to <b>1</b> instead of <b>0</b>.</li><li>The system identification field value in <b>/SVCD/INFO.SVD</b> is set to <b>HQ-VCD</b> instead of <b>SUPERVCD</b>.</li><li><b>/EXT/SCANDATA.DAT</b> is mandatory instead of being optional.</li><li><b>/SVCD/SEARCH.DAT</b> is optional instead of being mandatory.</li></ul>"
    84587874msgstr ""
    84597875
    84607876#. +> trunk
    84617877#: projects/k3bvcdburndialog.cpp:180
    8462 msgid ""
    8463 "<p>If Autodetect is:</p><ul><li>ON then K3b will set the correct Video CD "
    8464 "type.</li><li>OFF then the correct Video CD type needs to be set by the user."
    8465 "</li></ul><p>If you are not sure about the correct Video CD type, it is best "
    8466 "to turn Autodetect ON.</p><p>If you want to force the Video CD type, you must "
    8467 "turn Autodetect OFF. This is useful for some standalone DVD players without "
    8468 "SVCD support.</p>"
     7878msgid "<p>If Autodetect is:</p><ul><li>ON then K3b will set the correct Video CD type.</li><li>OFF then the correct Video CD type needs to be set by the user.</li></ul><p>If you are not sure about the correct Video CD type, it is best to turn Autodetect ON.</p><p>If you want to force the Video CD type, you must turn Autodetect OFF. This is useful for some standalone DVD players without SVCD support.</p>"
    84697879msgstr ""
    84707880
    84717881#. +> stable
    84727882#: projects/k3bvcdburndialog.cpp:180
    8473 msgid ""
    8474 "<p>If Autodetect is:</p><ul><li>ON then K3b will set the correct VideoCD type."
    8475 "</li><li>OFF then the correct VideoCD type needs to be set by the user.</li><"
    8476 "/ul><p>If you are not sure about the correct VideoCD type, it is best to turn "
    8477 "Autodetect ON.</p><p>If you want to force the VideoCD type, you must turn "
    8478 "Autodetect OFF. This is useful for some standalone DVD players without SVCD "
    8479 "support.</p>"
     7883msgid "<p>If Autodetect is:</p><ul><li>ON then K3b will set the correct VideoCD type.</li><li>OFF then the correct VideoCD type needs to be set by the user.</li></ul><p>If you are not sure about the correct VideoCD type, it is best to turn Autodetect ON.</p><p>If you want to force the VideoCD type, you must turn Autodetect OFF. This is useful for some standalone DVD players without SVCD support.</p>"
    84807884msgstr ""
    84817885
    84827886#. +> trunk stable
    84837887#: projects/k3bvcdburndialog.cpp:186
    8484 msgid ""
    8485 "<ul><li>Rename <b>\"/MPEG2\"</b> folder on SVCDs to (non-compliant) "
    8486 "\"/MPEGAV\".</li><li>Enables the use of the (deprecated) signature <b>"
    8487 "\"ENTRYSVD\"</b> instead of <b>\"ENTRYVCD\"</b> for the file <b>\"/SVCD/ENTRY."
    8488 "SVD\"</b>.</li></ul>"
     7888msgid "<ul><li>Rename <b>\"/MPEG2\"</b> folder on SVCDs to (non-compliant) \"/MPEGAV\".</li><li>Enables the use of the (deprecated) signature <b>\"ENTRYSVD\"</b> instead of <b>\"ENTRYVCD\"</b> for the file <b>\"/SVCD/ENTRY.SVD\"</b>.</li></ul>"
    84897889msgstr ""
    84907890
    84917891#. +> trunk stable
    84927892#: projects/k3bvcdburndialog.cpp:188
    8493 msgid ""
    8494 "<ul><li>Enables the use of the (deprecated) Chinese <b>\"/SVCD/TRACKS.SVD\"<"
    8495 "/b> format which differs from the format defined in the <b>IEC-62107</b> "
    8496 "specification.</li></ul><p><b>The differences are most exposed on SVCDs "
    8497 "containing more than one video track.</b>"
     7893msgid "<ul><li>Enables the use of the (deprecated) Chinese <b>\"/SVCD/TRACKS.SVD\"</b> format which differs from the format defined in the <b>IEC-62107</b> specification.</li></ul><p><b>The differences are most exposed on SVCDs containing more than one video track.</b>"
    84987894msgstr ""
    84997895
    85007896#. +> trunk stable
    85017897#: projects/k3bvcdburndialog.cpp:191
    8502 msgid ""
    8503 "<p>though most devices will have problems with such an out-of-specification "
    8504 "media.<p><b>You may want use this option for images longer than 80 minutes</b>"
     7898msgid "<p>though most devices will have problems with such an out-of-specification media.<p><b>You may want use this option for images longer than 80 minutes</b>"
    85057899msgstr ""
    85067900
    85077901#. +> trunk stable
    85087902#: projects/k3bvcdburndialog.cpp:194
    8509 msgid ""
    8510 "<p>To allow the play of Video-CDs on a CD-i player, the Video-CD standard "
    8511 "requires that a CD-i application program must be present.<p>This program is "
    8512 "designed to:<ul><li>provide full play back control as defined in the PSD of "
    8513 "the standard</li><li>be extremely simple to use and easy-to-learn for the "
    8514 "end-user</li></ul><p>The program runs on CD-i players equipped with the "
    8515 "CDRTOS 1.1(.1) operating system and a Digital Video extension cartridge."
     7903msgid "<p>To allow the play of Video-CDs on a CD-i player, the Video-CD standard requires that a CD-i application program must be present.<p>This program is designed to:<ul><li>provide full play back control as defined in the PSD of the standard</li><li>be extremely simple to use and easy-to-learn for the end-user</li></ul><p>The program runs on CD-i players equipped with the CDRTOS 1.1(.1) operating system and a Digital Video extension cartridge."
    85167904msgstr ""
    85177905
    85187906#. +> trunk
    85197907#: projects/k3bvcdburndialog.cpp:200
    8520 msgid ""
    8521 "<p>Configuration parameters only available for Video CD 2.0<p>The engine "
    8522 "works perfectly well when used as-is.<p>You have the option to configure the "
    8523 "VCD application.<p>You can adapt the color and/or the shape of the cursor and "
    8524 "lots more."
     7908msgid "<p>Configuration parameters only available for Video CD 2.0<p>The engine works perfectly well when used as-is.<p>You have the option to configure the VCD application.<p>You can adapt the color and/or the shape of the cursor and lots more."
    85257909msgstr ""
    85267910
    85277911#. +> stable
    85287912#: projects/k3bvcdburndialog.cpp:200
    8529 msgid ""
    8530 "<p>Configuration parameters only available for VideoCD 2.0<p>The engine works "
    8531 "perfectly well when used as-is.<p>You have the option to configure the VCD "
    8532 "application.<p>You can adapt the color and/or the shape of the cursor and "
    8533 "lots more."
     7913msgid "<p>Configuration parameters only available for VideoCD 2.0<p>The engine works perfectly well when used as-is.<p>You have the option to configure the VCD application.<p>You can adapt the color and/or the shape of the cursor and lots more."
    85347914msgstr ""
    85357915
    85367916#. +> trunk stable
    85377917#: projects/k3bvcdburndialog.cpp:206 projects/k3bvcdtrackdialog.cpp:269
    8538 msgid ""
    8539 "<p>Playback control, PBC, is available for Video CD 2.0 and Super Video CD 1."
    8540 "0 disc formats.<p>PBC allows control of the playback of play items and the "
    8541 "possibility of interaction with the user through the remote control or some "
    8542 "other input device available."
     7918msgid "<p>Playback control, PBC, is available for Video CD 2.0 and Super Video CD 1.0 disc formats.<p>PBC allows control of the playback of play items and the possibility of interaction with the user through the remote control or some other input device available."
    85437919msgstr ""
    85447920
    85457921#. +> trunk stable
    85467922#: projects/k3bvcdburndialog.cpp:209
    8547 msgid ""
    8548 "<p>Here you can specify that the folder <b>SEGMENT</b> should always be "
    8549 "present.<p>Some DVD players need the folder to give a faultless rendition."
     7923msgid "<p>Here you can specify that the folder <b>SEGMENT</b> should always be present.<p>Some DVD players need the folder to give a faultless rendition."
    85507924msgstr ""
    85517925
    85527926#. +> trunk stable
    85537927#: projects/k3bvcdburndialog.cpp:212
    8554 msgid ""
    8555 "<p>An Access Point Sector, APS, is an MPEG video sector on the VCD/SVCD which "
    8556 "is suitable to be jumped to directly.<p>APS are required for entry points and "
    8557 "scantables. APS have to fulfil the requirement to precede every I-frame by a "
    8558 "GOP header which shall be preceded by a sequence header in its turn.<p>The "
    8559 "start codes of these 3 items are required to be contained all in the same "
    8560 "MPEG pack/sector, thus forming a so-called access point sector.<p>This "
    8561 "requirement can be relaxed by enabling the relaxed aps option, i.e. every "
    8562 "sector containing an I-frame will be regarded as an APS.<p><b>Warning:</b> "
    8563 "The sequence header is needed for a playing device to figure out display "
    8564 "parameters, such as display resolution and frame rate, relaxing the aps "
    8565 "requirement may lead to non-working entry points."
     7928msgid "<p>An Access Point Sector, APS, is an MPEG video sector on the VCD/SVCD which is suitable to be jumped to directly.<p>APS are required for entry points and scantables. APS have to fulfil the requirement to precede every I-frame by a GOP header which shall be preceded by a sequence header in its turn.<p>The start codes of these 3 items are required to be contained all in the same MPEG pack/sector, thus forming a so-called access point sector.<p>This requirement can be relaxed by enabling the relaxed aps option, i.e. every sector containing an I-frame will be regarded as an APS.<p><b>Warning:</b> The sequence header is needed for a playing device to figure out display parameters, such as display resolution and frame rate, relaxing the aps requirement may lead to non-working entry points."
    85667929msgstr ""
    85677930
    85687931#. +> trunk stable
    85697932#: projects/k3bvcdburndialog.cpp:218
    8570 msgid ""
    8571 "<p>According to the specification, it is mandatory for Super Video CDs to "
    8572 "encode scan information data into user data blocks in the picture layer of "
    8573 "all intra coded picture.<p>It can be used by playing devices for implementing "
    8574 "fast forward & fast reverse scanning.<p>The already existing scan information "
    8575 "data can be updated by enabling the update scan offsets option."
     7933msgid "<p>According to the specification, it is mandatory for Super Video CDs to encode scan information data into user data blocks in the picture layer of all intra coded picture.<p>It can be used by playing devices for implementing fast forward & fast reverse scanning.<p>The already existing scan information data can be updated by enabling the update scan offsets option."
    85767934msgstr ""
    85777935
    85787936#. +> trunk stable
    85797937#: projects/k3bvcdburndialog.cpp:222
    8580 msgid ""
    8581 "<p>Viewing Restriction may be interpreted by the playing device.<p>The "
    8582 "allowed range goes from 0 to 3.<ul><li>0 = unrestricted, free to view for "
    8583 "all</li><li>3 = restricted, content not suitable for ages under 18</li></ul><"
    8584 "p>Actually, the exact meaning is not defined and is player dependant.<p><b>"
    8585 "Most players ignore that value.<b>"
     7938msgid "<p>Viewing Restriction may be interpreted by the playing device.<p>The allowed range goes from 0 to 3.<ul><li>0 = unrestricted, free to view for all</li><li>3 = restricted, content not suitable for ages under 18</li></ul><p>Actually, the exact meaning is not defined and is player dependant.<p><b>Most players ignore that value.<b>"
    85867939msgstr ""
    85877940
     
    85937946#. +> trunk stable
    85947947#: projects/k3bvcdburndialog.cpp:230
    8595 msgid ""
    8596 "<p>This option allows to set the number of empty sectors added before the "
    8597 "lead-out area begins, i.e. the number of post-gap sectors.<p>The ECMA-130 "
    8598 "specification requires the last data track before the lead-out to carry a "
    8599 "post-gap of at least 150 sectors, which is used as default for this parameter."
    8600 "<p>Some operating systems may encounter I/O errors due to read-ahead issues "
    8601 "when reading the last MPEG track if this parameter is set too low.<p>Allowed "
    8602 "value content: [0..300]. Default: 150."
     7948msgid "<p>This option allows to set the number of empty sectors added before the lead-out area begins, i.e. the number of post-gap sectors.<p>The ECMA-130 specification requires the last data track before the lead-out to carry a post-gap of at least 150 sectors, which is used as default for this parameter.<p>Some operating systems may encounter I/O errors due to read-ahead issues when reading the last MPEG track if this parameter is set too low.<p>Allowed value content: [0..300]. Default: 150."
    86037949msgstr ""
    86047950
    86057951#. +> trunk stable
    86067952#: projects/k3bvcdburndialog.cpp:235
    8607 msgid ""
    8608 "<p>Used to set the track pre-gap for all tracks in sectors globally.<p>The "
    8609 "specification requires the pre-gaps to be at least 150 sectors long.<p>"
    8610 "Allowed value content: [0..300]. Default: 150."
     7953msgid "<p>Used to set the track pre-gap for all tracks in sectors globally.<p>The specification requires the pre-gaps to be at least 150 sectors long.<p>Allowed value content: [0..300]. Default: 150."
    86117954msgstr ""
    86127955
    86137956#. +> trunk stable
    86147957#: projects/k3bvcdburndialog.cpp:239
    8615 msgid ""
    8616 "Margins are used to compensate for inaccurate sector-addressing issues on "
    8617 "CD-ROM media. Interestingly, they have been abandoned for Super Video CDs.<p>"
    8618 "For Video CD 1.0/1.1/2.0 this margin should be at least 15 sectors long.<p>"
    8619 "Allowed value content: [0..150]. Default: 30 for Video CD 1.0/1.1/2.0, "
    8620 "otherwise (i.e. Super Video CD 1.0 and HQ-VCD 1.0) 0."
     7958msgid "Margins are used to compensate for inaccurate sector-addressing issues on CD-ROM media. Interestingly, they have been abandoned for Super Video CDs.<p>For Video CD 1.0/1.1/2.0 this margin should be at least 15 sectors long.<p>Allowed value content: [0..150]. Default: 30 for Video CD 1.0/1.1/2.0, otherwise (i.e. Super Video CD 1.0 and HQ-VCD 1.0) 0."
    86217959msgstr ""
    86227960
    86237961#. +> trunk stable
    86247962#: projects/k3bvcdburndialog.cpp:243
    8625 msgid ""
    8626 "<p>Margins are used to compensate for inaccurate sector-addressing issues on "
    8627 "CD-ROM media. Interestingly, they have been abandoned for Super Video CDs.<p>"
    8628 "For Video CD 1.0/1.1/2.0 this margin should be at least 15 sectors long.<p>"
    8629 "Allowed value content: [0..150]. Default: 45 for Video CD 1.0/1.1/2.0, "
    8630 "otherwise 0."
     7963msgid "<p>Margins are used to compensate for inaccurate sector-addressing issues on CD-ROM media. Interestingly, they have been abandoned for Super Video CDs.<p>For Video CD 1.0/1.1/2.0 this margin should be at least 15 sectors long.<p>Allowed value content: [0..150]. Default: 45 for Video CD 1.0/1.1/2.0, otherwise 0."
    86317964msgstr ""
    86327965
     
    90208353#. +> trunk stable
    90218354#: projects/k3bvcdtrackdialog.cpp:265
    9022 msgid ""
    9023 "<p>Target to be jumped to on time-out of <wait>.<p>If omitted (and <wait> is "
    9024 "not set to an infinite time) one of the targets is selected at random."
     8355msgid "<p>Target to be jumped to on time-out of <wait>.<p>If omitted (and <wait> is not set to an infinite time) one of the targets is selected at random."
    90258356msgstr ""
    90268357
    90278358#. +> trunk stable
    90288359#: projects/k3bvcdtrackdialog.cpp:267
    9029 msgid ""
    9030 "<p>When reactivity is set to delayed, it is recommended that the length of "
    9031 "the referenced 'play track' is not more than 5 seconds.<p>The recommended "
    9032 "setting for a play item consisting of one still picture and no audio is to "
    9033 "loop once and have a delayed reactivity."
     8360msgid "<p>When reactivity is set to delayed, it is recommended that the length of the referenced 'play track' is not more than 5 seconds.<p>The recommended setting for a play item consisting of one still picture and no audio is to loop once and have a delayed reactivity."
    90348361msgstr ""
    90358362
    90368363#. +> trunk stable
    90378364#: projects/k3bvcdtrackdialog.cpp:271
    9038 msgid ""
    9039 "These are actually pseudo keys, representing the numeric keys 0, 1, ..., 9."
     8365msgid "These are actually pseudo keys, representing the numeric keys 0, 1, ..., 9."
    90408366msgstr ""
    90418367
     
    90478373#. +> trunk stable
    90488374#: projects/k3bvcdtrackdialog.cpp:273
    9049 msgid ""
    9050 "<p>Times to repeat the playback of 'play track'.<p>The reactivity attribute "
    9051 "controls whether the playback of 'play track' is finished, thus delayed, "
    9052 "before executing user triggered action or an immediate jump is performed.<p>"
    9053 "After the specified number of repetitions have completed, the <wait> time "
    9054 "begins to count down, unless set to an infinite wait time.<p>If this element "
    9055 "is omitted, a default of `1' is used, i.e. the 'play track' will be displayed "
    9056 "once."
     8375msgid "<p>Times to repeat the playback of 'play track'.<p>The reactivity attribute controls whether the playback of 'play track' is finished, thus delayed, before executing user triggered action or an immediate jump is performed.<p>After the specified number of repetitions have completed, the <wait> time begins to count down, unless set to an infinite wait time.<p>If this element is omitted, a default of `1' is used, i.e. the 'play track' will be displayed once."
    90578376msgstr ""
    90588377
    90598378#. +> trunk stable
    90608379#: projects/k3bvcdtrackdialog.cpp:277
    9061 msgid ""
    9062 "Time in seconds to wait after playback of 'play track' before triggering the "
    9063 "<timeout> action (unless the user triggers some action before time ran up)."
     8380msgid "Time in seconds to wait after playback of 'play track' before triggering the <timeout> action (unless the user triggers some action before time ran up)."
    90648381msgstr ""
    90658382
     
    92678584#. +> trunk
    92688585#: projects/k3bvcdview.cpp:101
    9269 msgid ""
    9270 "Could not find VcdImager executable. To create Video CDs you have to install "
    9271 "VcdImager >= 0.7.12. You can find this on your distribution’s software "
    9272 "repository or download it from http://www.vcdimager.org"
     8586msgid "Could not find VcdImager executable. To create Video CDs you have to install VcdImager >= 0.7.12. You can find this on your distribution’s software repository or download it from http://www.vcdimager.org"
    92738587msgstr ""
    92748588
    92758589#. +> stable
    92768590#: projects/k3bvcdview.cpp:85
    9277 msgid ""
    9278 "Could not find VcdImager executable. To create VideoCD's you must install "
    9279 "VcdImager >= 0.7.12. You can find this on your distribution disks or download "
    9280 "it from http://www.vcdimager.org"
     8591msgid "Could not find VcdImager executable. To create VideoCD's you must install VcdImager >= 0.7.12. You can find this on your distribution disks or download it from http://www.vcdimager.org"
    92818592msgstr ""
    92828593
     
    92888599#. +> trunk stable
    92898600#: projects/k3bvideodvdview.cpp:58
    9290 msgid ""
    9291 "Be aware that you need to provide the complete Video DVD filestructure. K3b "
    9292 "does not support video transcoding and preparation of video object files yet. "
    9293 "That means you need to already have the VTS_X_YY.VOB and VTS_X_YY.IFO files."
     8601msgid "Be aware that you need to provide the complete Video DVD filestructure. K3b does not support video transcoding and preparation of video object files yet. That means you need to already have the VTS_X_YY.VOB and VTS_X_YY.IFO files."
    92948602msgstr ""
    92958603
     
    93818689#: rip/base_k3baudiorippingoptionwidget.ui:95
    93828690msgid ""
    9383 "<p>If this option is checked, the entries in the playlist will be relative to "
    9384 "its location.\n"
     8691"<p>If this option is checked, the entries in the playlist will be relative to its location.\n"
    93858692"<p>Example: If your playlist is located in <em>/home/myself/music</em> and\n"
    9386 "your audio files are in <em>/home/myself/music/cool</em>; then the entries in "
    9387 "the\n"
     8693"your audio files are in <em>/home/myself/music/cool</em>; then the entries in the\n"
    93888694"playlist will look something like: <em>cool/track1.ogg</em>."
    93898695msgstr ""
     
    94278733#. +> trunk stable
    94288734#: rip/base_k3baudiorippingoptionwidget.ui:148
    9429 msgid ""
    9430 "<p>If this option is checked K3b will create a CDRWIN cue file which allows "
    9431 "to easily write a copy of the audio CD on other systems."
     8735msgid "<p>If this option is checked K3b will create a CDRWIN cue file which allows to easily write a copy of the audio CD on other systems."
    94328736msgstr ""
    94338737
     
    95848888#: rip/k3baudiocdview.cpp:186
    95858889#, kde-format
    9586 msgid ""
    9587 "Found Cd-Text (%1 - %2). Do you want to use it instead of CDDB (%3 - %4)?"
     8890msgid "Found Cd-Text (%1 - %2). Do you want to use it instead of CDDB (%3 - %4)?"
    95888891msgstr ""
    95898892
     
    99779280#. +> trunk stable
    99789281#: rip/k3baudiorippingdialog.cpp:210
    9979 msgid ""
    9980 "<p>This specifies the maximum number of retries to read a sector of audio "
    9981 "data from the cd. After that K3b will either skip the sector if the <em>"
    9982 "Ignore Read Errors</em> option is enabled or stop the process."
     9282msgid "<p>This specifies the maximum number of retries to read a sector of audio data from the cd. After that K3b will either skip the sector if the <em>Ignore Read Errors</em> option is enabled or stop the process."
    99839283msgstr ""
    99849284
     
    99909290#. +> trunk stable
    99919291#: rip/k3baudiorippingdialog.cpp:215
    9992 msgid ""
    9993 "<p>If this option is checked K3b will not rip the audio data in the pregaps. "
    9994 "Most audio tracks contain an empty pregap which does not belong to the track "
    9995 "itself.</p><p>Although the default behavior of nearly all ripping software is "
    9996 "to include the pregaps for most CDs, it makes more sense to ignore them. In "
    9997 "any case, when creating a K3b audio project, the pregaps will be regenerated."
    9998 "</p>"
     9292msgid "<p>If this option is checked K3b will not rip the audio data in the pregaps. Most audio tracks contain an empty pregap which does not belong to the track itself.</p><p>Although the default behavior of nearly all ripping software is to include the pregaps for most CDs, it makes more sense to ignore them. In any case, when creating a K3b audio project, the pregaps will be regenerated.</p>"
    99999293msgstr ""
    100009294
     
    100429336#. +> trunk stable
    100439337#: rip/k3bcddbpatternwidget.cpp:53
    10044 msgctxt ""
    10045 "Please do NOT modify/translate the quotes, they are part of the pattern!"
     9338msgctxt "Please do NOT modify/translate the quotes, they are part of the pattern!"
    100469339msgid "%A - %T/%n - !a='%A'{%a - }%t"
    100479340msgstr ""
     
    100749367#. +> trunk stable
    100759368#: rip/k3bcddbpatternwidget.cpp:127
    10076 msgid ""
    10077 "<p><b>Pattern special strings:</b><p>The following strings will be replaced "
    10078 "with their respective meaning in every track name.<br><em>Hint:</em> %A "
    10079 "differs from %a only on soundtracks or compilations.<p><table border=\"0\"><"
    10080 "tr><td></td><td><em>Meaning</em></td><td><em>Alternatives</em></td></tr><tr><"
    10081 "td>%a</td><td>artist of the track</td><td>%{a} or %{artist}</td></tr><tr><td>%"
    10082 "t</td><td>title of the track</td><td>%{t} or %{title}</td></tr><tr><td>%n</td>"
    10083 "<td>track number</td><td>%{n} or %{number}</td></tr><tr><td>%y</td><td>year "
    10084 "of the CD</td><td>%{y} or %{year}</td></tr><tr><td>%c</td><td>extended track "
    10085 "information</td><td>%{c} or %{comment}</td></tr><tr><td>%g</td><td>genre of "
    10086 "the CD</td><td>%{g} or %{genre}</td></tr><tr><td>%A</td><td>album artist</td>"
    10087 "<td>%{A} or %{albumartist}</td></tr><tr><td>%T</td><td>album title</td><td>%"
    10088 "{T} or %{albumtitle}</td></tr><tr><td>%C</td><td>extended CD information</td>"
    10089 "<td>%{C} or %{albumcomment}</td></tr><tr><td>%d</td><td>current date</td><td>%"
    10090 "{d} or %{date}</td></tr><tr><td>%e</td><td>file extension (if left out, it is "
    10091 "added automatically)</td><td>%{e} or %{ext}</td></tr></table>"
     9369msgid "<p><b>Pattern special strings:</b><p>The following strings will be replaced with their respective meaning in every track name.<br><em>Hint:</em> %A differs from %a only on soundtracks or compilations.<p><table border=\"0\"><tr><td></td><td><em>Meaning</em></td><td><em>Alternatives</em></td></tr><tr><td>%a</td><td>artist of the track</td><td>%{a} or %{artist}</td></tr><tr><td>%t</td><td>title of the track</td><td>%{t} or %{title}</td></tr><tr><td>%n</td><td>track number</td><td>%{n} or %{number}</td></tr><tr><td>%y</td><td>year of the CD</td><td>%{y} or %{year}</td></tr><tr><td>%c</td><td>extended track information</td><td>%{c} or %{comment}</td></tr><tr><td>%g</td><td>genre of the CD</td><td>%{g} or %{genre}</td></tr><tr><td>%A</td><td>album artist</td><td>%{A} or %{albumartist}</td></tr><tr><td>%T</td><td>album title</td><td>%{T} or %{albumtitle}</td></tr><tr><td>%C</td><td>extended CD information</td><td>%{C} or %{albumcomment}</td></tr><tr><td>%d</td><td>current date</td><td>%{d} or %{date}</td></tr><tr><td>%e</td><td>file extension (if left out, it is added automatically)</td><td>%{e} or %{ext}</td></tr></table>"
    100929370msgstr ""
    100939371
     
    100959373#: rip/k3bcddbpatternwidget.cpp:153
    100969374#, c-format
    10097 msgctxt ""
    10098 "Please do NOT modify/translate the quotes, they are part of the pattern!"
    10099 msgid ""
    10100 "<p><b>Conditional inclusion:</b><p>These patterns make it possible to "
    10101 "selectively include texts, depending on the value of CDDB entries. You can "
    10102 "choose only to include or exclude texts if one of the entries is empty, or if "
    10103 "it has a specific value. Examples:<ul><li>@T{TEXT} includes TEXT if the album "
    10104 "title is specified<li>!T{TEXT} includes TEXT if the album title is not "
    10105 "specified<li>@C='Soundtrack'{TEXT} includes TEXT if the CD's extended "
    10106 "information is named Soundtrack<li>!C='Soundtrack'{TEXT} includes TEXT if the "
    10107 "CD's extended information is anything else but Soundtrack<li>It is also "
    10108 "possible to include special strings in texts and conditions, e.g. !a='%A'{%a} "
    10109 "only includes the title's artist information if it does not differ from the "
    10110 "album artist.</ul><p>Conditional includes make use of the same characters as "
    10111 "the special strings, which means that the X in @X{...} can be one character "
    10112 "out of [atnycgATCd]."
     9375msgctxt "Please do NOT modify/translate the quotes, they are part of the pattern!"
     9376msgid "<p><b>Conditional inclusion:</b><p>These patterns make it possible to selectively include texts, depending on the value of CDDB entries. You can choose only to include or exclude texts if one of the entries is empty, or if it has a specific value. Examples:<ul><li>@T{TEXT} includes TEXT if the album title is specified<li>!T{TEXT} includes TEXT if the album title is not specified<li>@C='Soundtrack'{TEXT} includes TEXT if the CD's extended information is named Soundtrack<li>!C='Soundtrack'{TEXT} includes TEXT if the CD's extended information is anything else but Soundtrack<li>It is also possible to include special strings in texts and conditions, e.g. !a='%A'{%a} only includes the title's artist information if it does not differ from the album artist.</ul><p>Conditional includes make use of the same characters as the special strings, which means that the X in @X{...} can be one character out of [atnycgATCd]."
    101139377msgstr ""
    101149378
     
    101989462#. +> trunk
    101999463#: rip/k3bvideocdrip.cpp:103
    10200 msgid ""
    10201 "You can find this on your distribution’s software repository or download it "
    10202 "from http://www.vcdimager.org"
     9464msgid "You can find this on your distribution’s software repository or download it from http://www.vcdimager.org"
    102039465msgstr ""
    102049466
     
    102119473#. +> trunk stable
    102129474#: rip/k3bvideocdrip.cpp:112
    10213 msgid ""
    10214 "You can find this on your distribution disks or download it from http://www."
    10215 "vcdimager.org"
     9475msgid "You can find this on your distribution disks or download it from http://www.vcdimager.org"
    102169476msgstr ""
    102179477
     
    103649624#. +> trunk stable
    103659625#: rip/k3bvideocdrippingdialog.cpp:134
    10366 msgid ""
    10367 "<p>Ignore extended PSD (located in the ISO-9660 filesystem under `/EXT/PSD_X."
    10368 "VCD') and use the <em>standard</em> PSD.</p>"
     9626msgid "<p>Ignore extended PSD (located in the ISO-9660 filesystem under `/EXT/PSD_X.VCD') and use the <em>standard</em> PSD.</p>"
    103699627msgstr ""
    103709628
     
    103769634#. +> trunk stable
    103779635#: rip/k3bvideocdrippingdialog.cpp:137
    10378 msgid ""
    10379 "<p>This option only makes sense if you are reading from a BIN CD disk image. "
    10380 "This indicates to `vcdxrip' to assume a 2336-byte sector mode for image file."
    10381 "</p><b>Note: This option is slated to disappear.</b>"
     9636msgid "<p>This option only makes sense if you are reading from a BIN CD disk image. This indicates to `vcdxrip' to assume a 2336-byte sector mode for image file.</p><b>Note: This option is slated to disappear.</b>"
    103829637msgstr ""
    103839638
     
    103899644#. +> trunk stable
    103909645#: rip/k3bvideocdrippingdialog.cpp:141
    10391 msgid ""
    10392 "<p>This option creates an XML description file with all video CD information."
    10393 "</p><p>This file will always contain all of the information.</p><p>Example: "
    10394 "If you only extract sequences, the description file will also hold the "
    10395 "information for files and segments.</p><p>The filename is the same as the "
    10396 "video CD name, with a .xml extension. The default is VIDEOCD.xml.</p>"
     9646msgid "<p>This option creates an XML description file with all video CD information.</p><p>This file will always contain all of the information.</p><p>Example: If you only extract sequences, the description file will also hold the information for files and segments.</p><p>The filename is the same as the video CD name, with a .xml extension. The default is VIDEOCD.xml.</p>"
    103979647msgstr ""
    103989648
     
    104759725#. +> trunk stable
    104769726#: rip/videodvd/base_k3bvideodvdrippingwidget.ui:21
    10477 msgid ""
    10478 "Please select the audio streams you want to include in every ripped title"
     9727msgid "Please select the audio streams you want to include in every ripped title"
    104799728msgstr ""
    104809729
     
    105269775#. +> trunk
    105279776#: rip/videodvd/base_k3bvideodvdrippingwidget.ui:239
    10528 msgid ""
    10529 "<p>No Audio Quality settings available for <em>AC3 pass-through</em>. The "
    10530 "audio stream from the Video DVD is used without any changes.</p>"
     9777msgid "<p>No Audio Quality settings available for <em>AC3 pass-through</em>. The audio stream from the Video DVD is used without any changes.</p>"
    105319778msgstr ""
    105329779
     
    105349781#. +> stable
    105359782#: rip/videodvd/base_k3bvideodvdrippingwidget.ui:257
    10536 msgid ""
    10537 "<p>No Audio Quality settings available for <em>AC3 pass-through</em>. The "
    10538 "audio stream from the Video DVD is used without any changes."
     9783msgid "<p>No Audio Quality settings available for <em>AC3 pass-through</em>. The audio stream from the Video DVD is used without any changes."
    105399784msgstr ""
    105409785
     
    105859830#: rip/videodvd/base_k3bvideodvdrippingwidget.ui:468
    105869831msgid ""
    10587 "<p>If this option is checked K3b encodes the video titles in two passes. The "
    10588 "first pass is used to gather information about the video in order to improve "
    10589 "the distribution of bits in the second pass. The resulting video will have a "
    10590 "higher quality using a variable bitrate.\n"
    10591 "<p>If this option is not checked K3b will create video files with a constant "
    10592 "bitrate and a lower quality.\n"
     9832"<p>If this option is checked K3b encodes the video titles in two passes. The first pass is used to gather information about the video in order to improve the distribution of bits in the second pass. The resulting video will have a higher quality using a variable bitrate.\n"
     9833"<p>If this option is not checked K3b will create video files with a constant bitrate and a lower quality.\n"
    105939834"<p>2-pass encoding results in a doubled encoding time."
    105949835msgstr ""
     
    106179858#: rip/videodvd/base_k3bvideodvdrippingwidget.ui:489
    106189859msgid ""
    10619 "<p>Most Video DVDs are encoded in a letterboxed format. <em>Letterboxed</em> "
    10620 "refers to black bars used at the top and bottom (and sometimes at the sides) "
    10621 "of the video to force it into one of the aspect ratios supported by the Video "
    10622 "DVD standard.\n"
    10623 "<p>If this option is checked K3b will automatically detect and remove these "
    10624 "black bars from the resulting video.\n"
    10625 "<p>Although this method is very reliable there may be problems if the source "
    10626 "material is exceptionally short or dark."
     9860"<p>Most Video DVDs are encoded in a letterboxed format. <em>Letterboxed</em> refers to black bars used at the top and bottom (and sometimes at the sides) of the video to force it into one of the aspect ratios supported by the Video DVD standard.\n"
     9861"<p>If this option is checked K3b will automatically detect and remove these black bars from the resulting video.\n"
     9862"<p>Although this method is very reliable there may be problems if the source material is exceptionally short or dark."
    106279863msgstr ""
    106289864
     
    106439879#: rip/videodvd/base_k3bvideodvdrippingwidget.ui:506
    106449880msgid ""
    10645 "<p>Video DVD audio streams normally are encoded with a sampling rate of 48000 "
    10646 "Hz. Audio CDs on the other hand are encoded with a sampling rate of 44100 Hz."
    10647 "\n"
    10648 "<p>If this option is checked K3b will change the sampling rate of the audio "
    10649 "stream to 44100 Hz."
     9881"<p>Video DVD audio streams normally are encoded with a sampling rate of 48000 Hz. Audio CDs on the other hand are encoded with a sampling rate of 44100 Hz.\n"
     9882"<p>If this option is checked K3b will change the sampling rate of the audio stream to 44100 Hz."
    106509883msgstr ""
    106519884
     
    107439976#. +> trunk stable
    107449977#: rip/videodvd/k3bvideodvdrippingdialog.cpp:498
    10745 msgid ""
    10746 "<p>When using the <em>AC3 pass-through</em> audio codec all selected audio "
    10747 "streams need to be in AC3 format. Please select another audio codec or choose "
    10748 "AC3 audio streams for all ripped titles."
     9978msgid "<p>When using the <em>AC3 pass-through</em> audio codec all selected audio streams need to be in AC3 format. Please select another audio codec or choose AC3 audio streams for all ripped titles."
    107499979msgstr ""
    107509980
     
    1081710047#. +> trunk stable
    1081810048#: rip/videodvd/k3bvideodvdrippingview.cpp:88
    10819 msgid ""
    10820 "Shows plain Video DVD vob files from the DVD (including decryption) for "
    10821 "further processing with another application"
     10049msgid "Shows plain Video DVD vob files from the DVD (including decryption) for further processing with another application"
    1082210050msgstr ""
    1082310051
     
    1083510063#: rip/videodvd/k3bvideodvdrippingview.cpp:244
    1083610064#, kde-format
    10837 msgid ""
    10838 "K3b was unable to unmount device '%1' containing medium '%2'. Video DVD "
    10839 "ripping will not work if the device is mounted. Please unmount manually."
     10065msgid "K3b was unable to unmount device '%1' containing medium '%2'. Video DVD ripping will not work if the device is mounted. Please unmount manually."
    1084010066msgstr ""
    1084110067
     
    1084710073#. +> trunk stable
    1084810074#: rip/videodvd/k3bvideodvdrippingview.cpp:259
    10849 msgid ""
    10850 "<p>Unable to read Video DVD contents: Found encrypted Video DVD.<p>Install <i>"
    10851 "libdvdcss</i> to get Video DVD decryption support."
    10852 msgstr ""
    10853 
    10854 #. +> trunk stable
     10075msgid "<p>Unable to read Video DVD contents: Found encrypted Video DVD.<p>Install <i>libdvdcss</i> to get Video DVD decryption support."
     10076msgstr ""
     10077
     10078#. +> trunk
    1085510079#: rip/videodvd/k3bvideodvdrippingview.cpp:270
     10080#, fuzzy, kde-format
     10081msgid "%1 (Video DVD)"
     10082msgstr "Video DVD"
     10083
     10084#. +> stable
     10085#: rip/videodvd/k3bvideodvdrippingview.cpp:218
    1085610086#, fuzzy
    1085710087msgid "Video DVD"
     
    1087410104#. +> trunk stable
    1087510105#: rip/videodvd/k3bvideodvdrippingview.cpp:293
    10876 msgid ""
    10877 "<p>K3b uses transcode to rip Video DVDs. Your installation of transcode lacks "
    10878 "support for any of the codecs supported by K3b.<p>Please make sure it is "
    10879 "installed properly."
     10106msgid "<p>K3b uses transcode to rip Video DVDs. Your installation of transcode lacks support for any of the codecs supported by K3b.<p>Please make sure it is installed properly."
    1088010107msgstr ""
    1088110108
     
    1089210119#. +> trunk stable
    1089310120#: rip/videodvd/k3bvideodvdrippingview.cpp:350
    10894 msgid ""
    10895 "<p>Rips single titles from a video DVD into a compressed format such as XviD. "
    10896 "Menu structures are completely ignored.<p>If you intend to copy the plain "
    10897 "Video DVD vob files from the DVD (including decryption) for further "
    10898 "processing with another application, please use \"Show files\" button.<p>If "
    10899 "you intend to make a copy of the entire Video DVD including all menus and "
    10900 "extras it is recommended to use the K3b Copy tool."
     10121msgid "<p>Rips single titles from a video DVD into a compressed format such as XviD. Menu structures are completely ignored.<p>If you intend to copy the plain Video DVD vob files from the DVD (including decryption) for further processing with another application, please use \"Show files\" button.<p>If you intend to make a copy of the entire Video DVD including all menus and extras it is recommended to use the K3b Copy tool."
    1090110122msgstr ""
    1090210123
     
    1092510146#. +> trunk stable
    1092610147#: rip/videodvd/k3bvideodvdrippingwidget.cpp:286
    10927 msgid ""
    10928 "<p><b>Pattern special strings:</b><p>The following strings will be replaced "
    10929 "with their respective meaning in every track name.<br><p><table border=\"0\">"
    10930 "<tr><td></td><td><em>Meaning</em></td><td><em>Alternatives</em></td></tr><tr>"
    10931 "<td>%t</td><td>title number</td><td>%{t} or %{title_number}</td></tr><tr><td>%"
    10932 "i</td><td>volume id (mostly the name of the Video DVD)</td><td>%{i} or %"
    10933 "{volume_id}</td></tr><tr><td>%b</td><td>beautified volume id</td><td>%{b} or %"
    10934 "{beautified_volume_id}</td></tr><tr><td>%l</td><td>two chars language code<"
    10935 "/td><td>%{l} or %{lang_code}</td></tr><tr><td>%n</td><td>language name</td><"
    10936 "td>%{n} or %{lang_name}</td></tr><tr><td>%a</td><td>audio format (on the "
    10937 "Video DVD)</td><td>%{a} or %{audio_format}</td></tr><tr><td>%c</td><td>number "
    10938 "of audio channels (on the Video DVD)</td><td>%{c} or %{channels}</td></tr><tr>"
    10939 "<td>%v</td><td>size of the original video</td><td>%{v} or %{orig_video_size}<"
    10940 "/td></tr><tr><td>%s</td><td>size of the resulting video (<em>Caution: "
    10941 "auto-clipping values are not taken into account.</em>)</td><td>%{s} or %"
    10942 "{video_size}</td></tr><tr><td>%r</td><td>aspect ratio of the original video<"
    10943 "/td><td>%{r} or %{aspect_ratio}</td></tr><tr><td>%d</td><td>current date</td>"
    10944 "<td>%{d} or %{date}</td></tr></table><p><em>Hint: K3b also accepts slight "
    10945 "variations of the long special strings. One can, for example, leave out the "
    10946 "underscores.</em>"
     10148msgid "<p><b>Pattern special strings:</b><p>The following strings will be replaced with their respective meaning in every track name.<br><p><table border=\"0\"><tr><td></td><td><em>Meaning</em></td><td><em>Alternatives</em></td></tr><tr><td>%t</td><td>title number</td><td>%{t} or %{title_number}</td></tr><tr><td>%i</td><td>volume id (mostly the name of the Video DVD)</td><td>%{i} or %{volume_id}</td></tr><tr><td>%b</td><td>beautified volume id</td><td>%{b} or %{beautified_volume_id}</td></tr><tr><td>%l</td><td>two chars language code</td><td>%{l} or %{lang_code}</td></tr><tr><td>%n</td><td>language name</td><td>%{n} or %{lang_name}</td></tr><tr><td>%a</td><td>audio format (on the Video DVD)</td><td>%{a} or %{audio_format}</td></tr><tr><td>%c</td><td>number of audio channels (on the Video DVD)</td><td>%{c} or %{channels}</td></tr><tr><td>%v</td><td>size of the original video</td><td>%{v} or %{orig_video_size}</td></tr><tr><td>%s</td><td>size of the resulting video (<em>Caution: auto-clipping values are not taken into account.</em>)</td><td>%{s} or %{video_size}</td></tr><tr><td>%r</td><td>aspect ratio of the original video</td><td>%{r} or %{aspect_ratio}</td></tr><tr><td>%d</td><td>current date</td><td>%{d} or %{date}</td></tr></table><p><em>Hint: K3b also accepts slight variations of the long special strings. One can, for example, leave out the underscores.</em>"
    1094710149msgstr ""
    1094810150
     
    1095410156#. +> trunk stable
    1095510157#: rip/videodvd/k3bvideodvdrippingwidget.cpp:343
    10956 msgid ""
    10957 "<p>Please choose the width and height of the resulting video. If one value is "
    10958 "set to <em>Auto</em> K3b will choose this value depending on the aspect ratio "
    10959 "of the video picture.<br>Be aware that setting both the width and the height "
    10960 "to fixed values will result in no aspect ratio correction being performed."
    10961 msgstr ""
    10962 
    10963 #. +> trunk stable
     10158msgid "<p>Please choose the width and height of the resulting video. If one value is set to <em>Auto</em> K3b will choose this value depending on the aspect ratio of the video picture.<br>Be aware that setting both the width and the height to fixed values will result in no aspect ratio correction being performed."
     10159msgstr ""
     10160
     10161#. +> trunk
    1096410162#: rip/videodvd/k3bvideodvdrippingwidget.cpp:358
     10163#, fuzzy
     10164msgid "Width:"
     10165msgstr "Å irina:"
     10166
     10167#. +> stable
     10168#: rip/videodvd/k3bvideodvdrippingwidget.cpp:365
    1096510169#, fuzzy
    1096610170msgid "Width"
    1096710171msgstr "Å irina"
    1096810172
    10969 #. +> trunk stable
     10173#. +> trunk
    1097010174#: rip/videodvd/k3bvideodvdrippingwidget.cpp:360
     10175#, fuzzy
     10176msgid "Height:"
     10177msgstr "Visina:"
     10178
     10179#. +> stable
     10180#: rip/videodvd/k3bvideodvdrippingwidget.cpp:367
    1097110181#, fuzzy
    1097210182msgid "Height"
     
    1110710317#. +> stable
    1110810318#: projects/k3baudioview.cpp:136
    11109 msgid ""
    11110 "No audio decoder plugins found. You will not be able to add any files to the "
    11111 "audio project."
     10319msgid "No audio decoder plugins found. You will not be able to add any files to the audio project."
    1111210320msgstr ""
    1111310321
     
    1113210340#: tips:16
    1113310341msgid ""
    11134 "<p>...that K3b has two types of settings. On the one hand K3b has settings "
    11135 "like most\n"
    11136 "KDE applications have accessible through the configuration dialog via the "
    11137 "settings menu;\n"
    11138 "on the other hand every K3b action dialog has three buttons to load and save "
    11139 "defaults\n"
    11140 "for that action.  This way one may, for example, set the defaults for CD "
    11141 "Copy: these defaults\n"
    11142 "will then be loaded every time the CD Copy dialog is opened. The button <em>"
    11143 "K3b defaults</em>\n"
    11144 "will restore the <em>factory settings</em> in case you do not know if the "
    11145 "settings you chose\n"
     10342"<p>...that K3b has two types of settings. On the one hand K3b has settings like most\n"
     10343"KDE applications have accessible through the configuration dialog via the settings menu;\n"
     10344"on the other hand every K3b action dialog has three buttons to load and save defaults\n"
     10345"for that action.  This way one may, for example, set the defaults for CD Copy: these defaults\n"
     10346"will then be loaded every time the CD Copy dialog is opened. The button <em>K3b defaults</em>\n"
     10347"will restore the <em>factory settings</em> in case you do not know if the settings you chose\n"
    1114610348"are appropriate.</p>\n"
    1114710349msgstr ""
     
    1115110353#: tips:28
    1115210354msgid ""
    11153 "<p>...that you do not need to bother changing the settings marked as <em>"
    11154 "advanced</em> if you \n"
    11155 "do not know what they mean. K3b's defaults are suitable for most daily use.<"
    11156 "/p>\n"
     10355"<p>...that you do not need to bother changing the settings marked as <em>advanced</em> if you \n"
     10356"do not know what they mean. K3b's defaults are suitable for most daily use.</p>\n"
    1115710357msgstr ""
    1115810358
     
    1116110361#: tips:35
    1116210362msgid ""
    11163 "<p>Just left-click one of your devices in the device and file tree and see "
    11164 "what happens. K3b opens a specific\n"
    11165 "window based on the media's contents. For an audio CD for example you will be "
    11166 "given a list of the tracks with\n"
    11167 "the possibility to rip these tracks to any format supported by K3b (like mp3 "
    11168 "or Ogg-Vorbis).</p>\n"
     10363"<p>Just left-click one of your devices in the device and file tree and see what happens. K3b opens a specific\n"
     10364"window based on the media's contents. For an audio CD for example you will be given a list of the tracks with\n"
     10365"the possibility to rip these tracks to any format supported by K3b (like mp3 or Ogg-Vorbis).</p>\n"
    1116910366msgstr ""
    1117010367
     
    1117310370#: tips:43
    1117410371msgid ""
    11175 "<p>...that K3b lets you choose media instead of devices for burning. So if "
    11176 "you want to burn to a certain\n"
    11177 "medium simply insert it and wait for K3b to detect it. It will then appear as "
    11178 "your burning medium.</p>\n"
    11179 msgstr ""
     10372"<p>...that K3b lets you choose media instead of devices for burning. So if you want to burn to a certain\n"
     10373"medium simply insert it and wait for K3b to detect it. It will then appear as your burning medium.</p>\n"
     10374msgstr ""
  • kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/kaffeine.po

    r1014 r1036  
    66"Project-Id-Version: \n"
    77"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    8 "POT-Creation-Date: 2011-05-09 09:11+0200\n"
     8"POT-Creation-Date: 2011-05-25 09:37+0200\n"
    99"PO-Revision-Date: 2010-01-24 16:34+0100\n"
    1010"Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
     
    3131
    3232#. +> trunk
     33#: backend-mplayer/mplayermediawidget.cpp:220
     34#, fuzzy
     35msgid "Cannot start mplayer process."
     36msgstr "Nije moguće pokrenuti proces %1."
     37
     38#. +> trunk
    3339#: configurationdialog.cpp:37
    3440#, fuzzy
     
    12111217
    12121218#. +> trunk
    1213 #: mediawidget.cpp:105 mediawidget.cpp:395
     1219#: mediawidget.cpp:105 mediawidget.cpp:393
    12141220#, fuzzy
    12151221msgctxt "'Playback' menu"
     
    12181224
    12191225#. +> trunk
    1220 #: mediawidget.cpp:111 mediawidget.cpp:399
     1226#: mediawidget.cpp:111 mediawidget.cpp:397
    12211227#, fuzzy
    12221228msgctxt "'Playback' menu"
     
    13381344
    13391345#. +> trunk
    1340 #: mediawidget.cpp:265 mediawidget.cpp:272 mediawidget.cpp:954
    1341 #: mediawidget.cpp:962
     1346#: mediawidget.cpp:265 mediawidget.cpp:272 mediawidget.cpp:950
     1347#: mediawidget.cpp:958
    13421348#, kde-format, no-c-format
    13431349msgctxt "submenu of 'Skip'"
     
    13461352
    13471353#. +> trunk
    1348 #: mediawidget.cpp:279 mediawidget.cpp:286 mediawidget.cpp:956
    1349 #: mediawidget.cpp:964
     1354#: mediawidget.cpp:279 mediawidget.cpp:286 mediawidget.cpp:952
     1355#: mediawidget.cpp:960
    13501356#, kde-format, no-c-format
    13511357msgctxt "submenu of 'Skip'"
     
    13601366#. +> trunk
    13611367#: mediawidget.cpp:304
     1368#, fuzzy
    13621369msgctxt "dvd navigation"
    1363 msgid "Toggle Menu"
    1364 msgstr ""
     1370msgid "DVD Menu"
     1371msgstr "KDE izbornik"
    13651372
    13661373#. +> trunk
     
    13881395
    13891396#. +> trunk
    1390 #: mediawidget.cpp:378
     1397#: mediawidget.cpp:376
    13911398msgctxt "file filter"
    13921399msgid "Supported Media Files"
     
    13941401
    13951402#. +> trunk
    1396 #: mediawidget.cpp:379
     1403#: mediawidget.cpp:377
    13971404msgctxt "file filter"
    13981405msgid "All Files"
     
    14001407
    14011408#. +> trunk
    1402 #: mediawidget.cpp:411
     1409#: mediawidget.cpp:409
    14031410#, fuzzy
    14041411msgctxt "'Playback' menu"
     
    14071414
    14081415#. +> trunk
    1409 #: mediawidget.cpp:415
     1416#: mediawidget.cpp:413
    14101417#, fuzzy
    14111418msgctxt "'Playback' menu"
     
    14141421
    14151422#. +> trunk
    1416 #: mediawidget.cpp:673
     1423#: mediawidget.cpp:670
    14171424msgctxt "osd"
    14181425msgid "Stopped"
     
    14201427
    14211428#. +> trunk
    1422 #: mediawidget.cpp:731
     1429#: mediawidget.cpp:727
    14231430msgctxt "osd"
    14241431msgid "Mute On"
     
    14261433
    14271434#. +> trunk
    1428 #: mediawidget.cpp:734
     1435#: mediawidget.cpp:730
    14291436msgctxt "osd"
    14301437msgid "Mute Off"
     
    14321439
    14331440#. +> trunk
    1434 #: mediawidget.cpp:741
     1441#: mediawidget.cpp:737
    14351442#, kde-format
    14361443msgctxt "osd"
     
    14391446
    14401447#. +> trunk
    1441 #: mediawidget.cpp:776
     1448#: mediawidget.cpp:772
    14421449msgctxt "osd message"
    14431450msgid "Deinterlacing On"
     
    14451452
    14461453#. +> trunk
    1447 #: mediawidget.cpp:778
     1454#: mediawidget.cpp:774
    14481455msgctxt "osd message"
    14491456msgid "Deinterlacing Off"
     
    14511458
    14521459#. +> trunk
    1453 #: mediawidget.cpp:1177
     1460#: mediawidget.cpp:1187
    14541461msgctxt "osd"
    14551462msgid "Playing"
     
    14571464
    14581465#. +> trunk
    1459 #: mediawidget.cpp:1196
     1466#: mediawidget.cpp:1206
    14601467msgctxt "osd"
    14611468msgid "Paused"
     
    14631470
    14641471#. +> trunk
    1465 #: mediawidget.cpp:1444
     1472#: mediawidget.cpp:1393
    14661473#, fuzzy
    14671474msgctxt "@title:window"
     
    14701477
    14711478#. +> trunk
    1472 #: mediawidget.cpp:1449
     1479#: mediawidget.cpp:1398
    14731480msgid "Enter a position:"
    14741481msgstr ""
  • kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/kplayer.po

    r862 r1036  
    66"Project-Id-Version: \n"
    77"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    8 "POT-Creation-Date: 2010-11-16 11:11+0100\n"
     8"POT-Creation-Date: 2011-05-25 09:37+0200\n"
    99"PO-Revision-Date: 2010-01-24 16:36+0100\n"
    1010"Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
     
    13581358#. +> trunk
    13591359#: kplayernode.cpp:1703
     1360#, fuzzy
    13601361msgid "Searches"
    1361 msgstr ""
     1362msgstr "Pretrage"
    13621363
    13631364#. +> trunk
     
    19921993
    19931994#. +> trunk
    1994 #: kplayerpart.cpp:127 main.cpp:39
     1995#: kplayerpart.cpp:127
    19951996msgid "(C) 2002-2008, kiriuja"
    19961997msgstr ""
    19971998
    19981999#. +> trunk
    1999 #: kplayerpart.cpp:129 main.cpp:40
     2000#: kplayerpart.cpp:129
    20002001msgid "kiriuja"
    20012002msgstr ""
     
    68106811
    68116812#. +> trunk
     6813#: main.cpp:39
     6814#, fuzzy
     6815msgid "(C) 2002-2008, Kirill Bulygin"
     6816msgstr "© 2008–2009 Gilles Caulier"
     6817
     6818#. +> trunk
     6819#: main.cpp:40
     6820msgid "Kirill Bulygin"
     6821msgstr ""
     6822
     6823#. +> trunk
    68126824#: main.cpp:90
    68136825msgid "Play the files immediately (default)"
  • kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/libk3b.po

    r982 r1036  
    66"Project-Id-Version: \n"
    77"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    8 "POT-Creation-Date: 2011-04-27 10:53+0200\n"
     8"POT-Creation-Date: 2011-05-25 09:37+0200\n"
    99"PO-Revision-Date: 2010-01-24 16:35+0100\n"
    1010"Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
     
    359359#. +> trunk stable
    360360#: jobs/k3bcdcopyjob.cpp:584 jobs/k3bdvdcopyjob.cpp:319
    361 #, kde-format
     361#, fuzzy, kde-format
    362362msgid "Do you want to overwrite %1?"
    363 msgstr ""
     363msgstr "Åœelite li prebrisati %1?"
    364364
    365365#. +> trunk stable
     
    482482msgstr ""
    483483
    484 #. +> trunk stable
     484#. +> trunk
    485485#: jobs/k3bcdcopyjob.cpp:1102 jobs/k3bverificationjob.cpp:269
     486#: projects/k3bcdrecordwriter.cpp:750 projects/mixedcd/k3bmixedjob.cpp:564
     487#, fuzzy
     488msgid "Please reload the medium and press 'OK'"
     489msgstr "Unesite ispravnu adresu elektronske poÅ¡te"
     490
     491#. +> stable
     492#: jobs/k3bcdcopyjob.cpp:1101 jobs/k3bverificationjob.cpp:269
    486493#: projects/k3bcdrecordwriter.cpp:750 projects/mixedcd/k3bmixedjob.cpp:564
    487494msgid "Please reload the medium and press 'ok'"
     
    18091816msgstr ""
    18101817
    1811 #. +> trunk stable
     1818#. +> trunk
     1819#: projects/audiocd/k3baudiojob.cpp:501
     1820msgid "I/O Error. Most likely no space left on harddisk."
     1821msgstr ""
     1822
     1823#. +> stable
    18121824#: projects/audiocd/k3baudiojob.cpp:501
    18131825msgid "IO Error. Most likely no space left on harddisk."
    18141826msgstr ""
    18151827
    1816 #. +> trunk stable
     1828#. +> trunk
     1829#: projects/audiocd/k3baudiojob.cpp:550 projects/mixedcd/k3bmixedjob.cpp:638
     1830#: projects/mixedcd/k3bmixedjob.cpp:679
     1831#, fuzzy
     1832msgid "I/O Error"
     1833msgstr "Ulazno-izlazna pogreÅ¡ka"
     1834
     1835#. +> stable
    18171836#: projects/audiocd/k3baudiojob.cpp:550 projects/mixedcd/k3bmixedjob.cpp:638
    18181837#: projects/mixedcd/k3bmixedjob.cpp:679
     
    22492268msgstr ""
    22502269
    2251 #. +> trunk stable
     2270#. +> trunk
    22522271#: projects/datacd/k3bmkisofshandler.cpp:122
     2272msgid "The boot image contains multiple partitions."
     2273msgstr ""
     2274
     2275#. +> stable
     2276#: projects/datacd/k3bmkisofshandler.cpp:117
    22532277msgid "The boot image contains multiple partitions.."
    22542278msgstr ""
     
    26652689#. +> trunk stable
    26662690#: projects/k3bcdrecordwriter.cpp:723 projects/k3bgrowisofshandler.cpp:140
    2667 #: projects/k3bgrowisofshandler.cpp:147 projects/k3bgrowisofshandler.cpp:148
     2691#: projects/k3bgrowisofshandler.cpp:147
    26682692msgid "Closing Session"
    26692693msgstr ""
     
    29222946
    29232947#. +> trunk stable
    2924 #: projects/k3bgrowisofshandler.cpp:143 projects/k3bgrowisofshandler.cpp:144
     2948#: projects/k3bgrowisofshandler.cpp:143
    29252949msgid "Updating RMA"
    29262950msgstr ""
     2951
     2952#. +> trunk
     2953#: projects/k3bgrowisofshandler.cpp:144
     2954#, fuzzy
     2955msgid "Updating RMA..."
     2956msgstr "AÅŸuriram ikonicu 
"
     2957
     2958#. +> trunk
     2959#: projects/k3bgrowisofshandler.cpp:148
     2960#, fuzzy
     2961msgid "Closing Session..."
     2962msgstr "Zatvori sesiju"
    29272963
    29282964#. +> trunk stable
     
    33603396msgstr ""
    33613397
    3362 #. +> trunk stable
     3398#. +> trunk
     3399#: projects/videocd/k3bvcdjob.cpp:184
     3400#, fuzzy
     3401msgid "Could not write correct XML file."
     3402msgstr "Nije moguće pisati u datoteku %1."
     3403
     3404#. +> stable
    33633405#: projects/videocd/k3bvcdjob.cpp:184
    33643406msgid "Could not write correct XML-file."
     
    37503792#. +> trunk stable
    37513793#: tools/k3bmedium.cpp:359
     3794#, fuzzy
    37523795msgid "No medium present"
    3753 msgstr ""
     3796msgstr "Medij nije prisutan"
    37543797
    37553798#. +> trunk stable
  • kde-croatia/kde4/summit/hr/summit/messages/kdebase/desktop_kdebase_kate.po

    r1032 r1036  
    66"Project-Id-Version: desktop_kdesdk 0\n"
    77"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    8 "POT-Creation-Date: 2011-05-23 09:07+0200\n"
     8"POT-Creation-Date: 2011-05-25 09:38+0200\n"
    99"PO-Revision-Date: 2009-10-27 17:52+0100\n"
    1010"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     
    296296
    297297#. +> trunk
    298 #: kate/plugins/search/katesearch.desktop:18
     298#: kate/plugins/search/katesearch.desktop:19
    299299#, fuzzy
    300300msgctxt "Comment"
     
    349349
    350350#. +> trunk
    351 #: kate/plugins/tabbarextension/katetabbarextension.desktop:23
     351#: kate/plugins/tabbarextension/katetabbarextension.desktop:24
    352352msgctxt "Comment"
    353353msgid "Adds a tab bar with multiple rows to Kate's main window"
     
    414414
    415415#. +> trunk
    416 #: ktexteditor/kcm_ktexteditor.desktop:29
     416#: ktexteditor/kcm_ktexteditor.desktop:30
    417417#, fuzzy
    418418msgctxt "Comment"
     
    449449
    450450#. +> trunk
    451 #: kwrite/kwrite.desktop:29
     451#: kwrite/kwrite.desktop:30
    452452#, fuzzy
    453453msgctxt "Name"
     
    472472
    473473#. +> trunk
    474 #: part/plugins/autobookmarker/ktexteditor_autobookmarker.desktop:40
     474#: part/plugins/autobookmarker/ktexteditor_autobookmarker.desktop:41
    475475#, fuzzy
    476476msgctxt "Comment"
     
    486486
    487487#. +> trunk
    488 #: part/plugins/autobrace/ktexteditor_autobrace.desktop:43
     488#: part/plugins/autobrace/ktexteditor_autobrace.desktop:44
    489489#, fuzzy
    490490msgctxt "Comment"
     
    507507
    508508#. +> trunk
    509 #: part/plugins/exporter/ktexteditor_exporter.desktop:45
     509#: part/plugins/exporter/ktexteditor_exporter.desktop:46
    510510#, fuzzy
    511511msgctxt "Comment"
     
    521521
    522522#. +> trunk
    523 #: part/plugins/hlselection/ktexteditor_hlselection.desktop:43
     523#: part/plugins/hlselection/ktexteditor_hlselection.desktop:44
    524524#, fuzzy
    525525msgctxt "Comment"
     
    535535
    536536#. +> trunk
    537 #: part/plugins/insertfile/ktexteditor_insertfile.desktop:45
     537#: part/plugins/insertfile/ktexteditor_insertfile.desktop:46
    538538#, fuzzy
    539539msgctxt "Comment"
     
    549549
    550550#. +> trunk
    551 #: part/plugins/kdatatool/ktexteditor_kdatatool.desktop:45
     551#: part/plugins/kdatatool/ktexteditor_kdatatool.desktop:46
    552552#, fuzzy
    553553msgctxt "Comment"
     
    563563
    564564#. +> trunk
    565 #: part/plugins/kte_iconinserter/ktexteditor_iconinserter.desktop:25
     565#: part/plugins/kte_iconinserter/ktexteditor_iconinserter.desktop:26
    566566#, fuzzy
    567567msgctxt "Name"
     
    570570
    571571#. +> trunk
    572 #: part/plugins/kte_iconinserter/ktexteditor_iconinserter.desktop:48
     572#: part/plugins/kte_iconinserter/ktexteditor_iconinserter.desktop:50
    573573#, fuzzy
    574574msgctxt "GenericName"
     
    584584
    585585#. +> trunk
    586 #: part/plugins/kte_insanehtml_le/data/ktexteditor_insanehtml_le.desktop:37
     586#: part/plugins/kte_insanehtml_le/data/ktexteditor_insanehtml_le.desktop:38
    587587#, fuzzy
    588588msgctxt "Comment"
     
    598598
    599599#. +> trunk
    600 #: part/plugins/pythonencoding/ktexteditor_python-encoding.desktop:29
     600#: part/plugins/pythonencoding/ktexteditor_python-encoding.desktop:30
    601601#, fuzzy
    602602msgctxt "Comment"
     
    612612
    613613#. +> trunk
    614 #: part/plugins/timedate/ktexteditor_timedate.desktop:46
     614#: part/plugins/timedate/ktexteditor_timedate.desktop:47
    615615#, fuzzy
    616616msgctxt "Comment"
     
    632632
    633633#. +> trunk
    634 #: playground/kte_acomment/ktexteditor_acomment.desktop:20
     634#: playground/kte_acomment/ktexteditor_acomment.desktop:21
    635635msgctxt "Name"
    636636msgid "Artistic Comment"
     
    638638
    639639#. +> trunk
    640 #: playground/kte_acomment/ktexteditor_acomment.desktop:42
     640#: playground/kte_acomment/ktexteditor_acomment.desktop:44
    641641msgctxt "GenericName"
    642642msgid "Format comments in an \"artistic\" way"
  • kde-croatia/kde4/summit/hr/summit/messages/kdebase/katepart4.po

    r1027 r1036  
    1010"Project-Id-Version: katepart4 0\n"
    1111"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    12 "POT-Creation-Date: 2011-05-20 07:32+0200\n"
     12"POT-Creation-Date: 2011-05-25 09:38+0200\n"
    1313"PO-Revision-Date: 2010-06-06 14:00+0200\n"
    1414"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     
    66436643
    66446644#. +> trunk stable
    6645 #: vimode/katevimodebase.cpp:684 vimode/katevinormalmode.cpp:1057
     6645#: vimode/katevimodebase.cpp:684 vimode/katevinormalmode.cpp:1059
    66466646#, kde-format
    66476647msgid "Nothing in register %1"
     
    66496649
    66506650#. +> trunk stable
    6651 #: vimode/katevinormalmode.cpp:1329
     6651#: vimode/katevinormalmode.cpp:1331
    66526652#, kde-format
    66536653msgid "'%1' %2,  Hex %3,  Octal %4"
     
    66556655
    66566656#. +> trunk stable
    6657 #: vimode/katevinormalmode.cpp:1983
     6657#: vimode/katevinormalmode.cpp:1985
    66586658#, kde-format
    66596659msgid "Mark not set: %1"
  • kde-croatia/kde4/summit/hr/summit/messages/kdebase/konqueror.po

    r1017 r1036  
    99"Project-Id-Version: konqueror 0\n"
    1010"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    11 "POT-Creation-Date: 2011-05-13 05:50+0200\n"
     11"POT-Creation-Date: 2011-05-25 09:38+0200\n"
    1212"PO-Revision-Date: 2011-02-15 16:19+0100\n"
    1313"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     
    26402640
    26412641#. +> trunk stable
    2642 #: src/konqview.cpp:1199
     2642#: src/konqview.cpp:1203
    26432643msgid "The page you are trying to view is the result of posted form data. If you resend the data, any action the form carried out (such as search or online purchase) will be repeated. "
    26442644msgstr "Stranica koju ÅŸelite otvoriti rezultat je podataka objavljenih u obliku obrasca. Ako ponovno poÅ¡aljete podatke svaka će akcija koja proizlazi iz obrasca biti ponovljena (npr. pretraÅŸivanje ili kupovina putem Interneta)."
    26452645
    26462646#. +> trunk
    2647 #: src/konqview.cpp:1201
     2647#: src/konqview.cpp:1205
    26482648#, fuzzy
    26492649msgctxt "@title:window"
     
    26572657
    26582658#. +> trunk stable
    2659 #: src/konqview.cpp:1201
     2659#: src/konqview.cpp:1205
    26602660msgid "Resend"
    26612661msgstr "Ponovno pošalji"
  • kde-croatia/kde4/summit/hr/summit/messages/kdebase/nepomukstorage.po

    r1017 r1036  
    88"Project-Id-Version: nepomuk\n"
    99"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    10 "POT-Creation-Date: 2011-05-13 05:50+0200\n"
     10"POT-Creation-Date: 2011-05-25 09:38+0200\n"
    1111"PO-Revision-Date: 2010-05-30 18:06+0200\n"
    1212"Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
     
    4949
    5050#. +> trunk stable
    51 #: ontologyloader.cpp:135
     51#: ontologyloader.cpp:134
    5252#, kde-format
    5353msgid "Parsing of file %1 failed (%2)"
  • kde-croatia/kde4/summit/hr/summit/messages/kdeedu/blinken.po

    r750 r1036  
    66"Project-Id-Version: blinken\n"
    77"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    8 "POT-Creation-Date: 2011-01-11 10:25+0100\n"
     8"POT-Creation-Date: 2011-05-25 09:38+0200\n"
    99"PO-Revision-Date: 2010-03-12 10:41+0100\n"
    1010"Last-Translator: Ivo Ugrina <ivo@iugrina.com>\n"
     
    210210
    211211#. +> stable
    212 #: highscoredialog.cpp:152 highscoredialog.cpp:153
     212#: highscoredialog.cpp:156 highscoredialog.cpp:157
    213213#, kde-format
    214214msgctxt "@title:group level high scores"
     
    236236
    237237#. +> stable
    238 #: highscoredialog.cpp:154
     238#: highscoredialog.cpp:158
    239239msgctxt "@title:group all other level high scores"
    240240msgid "Level ?"
  • kde-croatia/kde4/summit/hr/summit/messages/kdeedu/kalgebra.po

    r1022 r1036  
    77"Project-Id-Version: \n"
    88"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    9 "POT-Creation-Date: 2011-05-17 08:57+0200\n"
     9"POT-Creation-Date: 2011-05-25 09:38+0200\n"
    1010"PO-Revision-Date: 2010-02-25 21:28+0100\n"
    1111"Last-Translator: Ivo Ugrina <ivo@iugrina.com>\n"
     
    4040
    4141#. +> trunk stable
    42 #: analitza/analyzer.cpp:495
     42#: analitza/analyzer.cpp:498
    4343msgctxt "Error message, no proper condition found."
    4444msgid "Could not find a proper choice for a condition statement."
     
    5252
    5353#. +> trunk stable
    54 #: analitza/analyzer.cpp:824
     54#: analitza/analyzer.cpp:827
    5555msgid "Type not supported for bounding."
    5656msgstr ""
    5757
    5858#. +> trunk stable
    59 #: analitza/analyzer.cpp:849
     59#: analitza/analyzer.cpp:852
    6060msgid "The downlimit is greater than the uplimit"
    6161msgstr ""
    6262
    6363#. +> trunk stable
    64 #: analitza/analyzer.cpp:851
     64#: analitza/analyzer.cpp:854
    6565msgid "Incorrect uplimit or downlimit."
    6666msgstr ""
     
    7272
    7373#. +> trunk stable
    74 #: analitza/analyzer.cpp:1813
     74#: analitza/analyzer.cpp:1812
    7575msgctxt "By a cycle i mean a variable that depends on itself"
    7676msgid "Defined a variable cycle"
     
    7878
    7979#. +> trunk stable
    80 #: analitza/analyzer.cpp:1855
     80#: analitza/analyzer.cpp:1854
    8181msgid "The result is not a number"
    8282msgstr "Rezultat nije broj"
     
    171171
    172172#. +> trunk stable
    173 #: analitza/expression.cpp:372
     173#: analitza/expression.cpp:373
    174174#, kde-format
    175175msgid "Error while parsing: %1"
     
    177177
    178178#. +> trunk stable
    179 #: analitza/expression.cpp:403
     179#: analitza/expression.cpp:404
    180180#, kde-format
    181181msgctxt "An error message"
     
    184184
    185185#. +> trunk stable
    186 #: analitza/expression.cpp:409
     186#: analitza/expression.cpp:410
    187187#, kde-format
    188188msgid "Cannot codify the %1 value."
     
    190190
    191191#. +> trunk stable
    192 #: analitza/expression.cpp:415
     192#: analitza/expression.cpp:416
    193193#, kde-format
    194194msgid "The %1 operator cannot have child contexts."
     
    196196
    197197#. +> trunk stable
    198 #: analitza/expression.cpp:419
     198#: analitza/expression.cpp:420
    199199#, kde-format
    200200msgid "The element '%1' is not an operator."
     
    202202
    203203#. +> trunk stable
    204 #: analitza/expression.cpp:432
     204#: analitza/expression.cpp:433
    205205#, fuzzy
    206206msgid "Do not want empty vectors"
     
    208208
    209209#. +> trunk stable
    210 #: analitza/expression.cpp:450
     210#: analitza/expression.cpp:451
    211211#, kde-format
    212212msgctxt "Error message due to an unrecognized input"
     
    215215
    216216#. +> trunk
    217 #: analitza/expressiontypechecker.cpp:401
     217#: analitza/expressiontypechecker.cpp:391
    218218msgid "The domain should be either a vector or a list."
    219219msgstr ""
    220220
    221221#. +> trunk stable
    222 #: analitza/expressiontypechecker.cpp:501
     222#: analitza/expressiontypechecker.cpp:492
    223223#, fuzzy, kde-format
    224224#| msgid "Wrong parameter count, had 1 parameter for '%2'"
     
    231231
    232232#. +> trunk stable
    233 #: analitza/expressiontypechecker.cpp:533
     233#: analitza/expressiontypechecker.cpp:531
    234234#, fuzzy, kde-format
    235235msgid "Could not call '%1'"
     
    237237
    238238#. +> trunk stable
    239 #: analitza/expressiontypechecker.cpp:541
     239#: analitza/expressiontypechecker.cpp:539
    240240#, fuzzy, kde-format
    241241msgid "Could not solve '%1'"
     
    243243
    244244#. +> trunk stable
    245 #: analitza/expressiontypechecker.cpp:589
     245#: analitza/expressiontypechecker.cpp:587
    246246msgid "Could not determine the type for piecewise"
    247247msgstr ""
    248248
    249249#. +> trunk
    250 #: analitza/expressiontypechecker.cpp:768
     250#: analitza/expressiontypechecker.cpp:764
    251251#, fuzzy
    252252msgid "Unexpected type"
     
    254254
    255255#. +> trunk stable
    256 #: analitza/expressiontypechecker.cpp:791
     256#: analitza/expressiontypechecker.cpp:787
    257257#, fuzzy, kde-format
    258258#| msgid "Cannot convert %1 to %2"
     
    379379
    380380#. +> trunk stable
    381 #: analitzagui/function.cpp:66 exp.g:415
     381#: analitzagui/function.cpp:66 exp.g:420
    382382#, fuzzy
    383383msgid ", "
     
    879879
    880880#. +> trunk stable
    881 #: analitzagui/operatorsmodel.cpp:531
     881#: analitzagui/operatorsmodel.cpp:533
    882882#, kde-format
    883883msgctxt "n-ary function prototype"
     
    886886
    887887#. +> trunk stable
    888 #: analitzagui/operatorsmodel.cpp:542
     888#: analitzagui/operatorsmodel.cpp:544
    889889#, kde-format
    890890msgctxt "Function name in function prototype"
     
    893893
    894894#. +> trunk stable
    895 #: analitzagui/operatorsmodel.cpp:543
     895#: analitzagui/operatorsmodel.cpp:545
    896896#, kde-format
    897897msgctxt "Uncorrect function name in function prototype"
     
    900900
    901901#. +> trunk stable
    902 #: analitzagui/operatorsmodel.cpp:546
     902#: analitzagui/operatorsmodel.cpp:548
    903903#, kde-format
    904904msgctxt "Parameter in function prototype"
     
    907907
    908908#. +> trunk stable
    909 #: analitzagui/operatorsmodel.cpp:549 analitzagui/operatorsmodel.cpp:559
     909#: analitzagui/operatorsmodel.cpp:551 analitzagui/operatorsmodel.cpp:561
    910910#, kde-format
    911911msgctxt "Current parameter in function prototype"
     
    914914
    915915#. +> trunk stable
    916 #: analitzagui/operatorsmodel.cpp:552
     916#: analitzagui/operatorsmodel.cpp:554
    917917msgctxt "Function parameter separator"
    918918msgid ", "
     
    920920
    921921#. +> trunk stable
    922 #: analitzagui/operatorsmodel.cpp:556
     922#: analitzagui/operatorsmodel.cpp:558
    923923msgctxt "Current parameter is the bounding"
    924924msgid " : bounds"
     
    932932
    933933#. +> trunk stable
    934 #: exp.g:415
     934#: exp.g:420
    935935#, kde-format
    936936msgctxt "error message"
     
    939939
    940940#. +> trunk stable
    941 #: exp.g:417
     941#: exp.g:422
    942942msgid "Missing right parenthesis"
    943943msgstr "Nedostaje desna zagrada"
    944944
    945945#. +> trunk stable
    946 #: exp.g:419
     946#: exp.g:424
    947947msgid "Unbalanced right parenthesis"
    948948msgstr ""
    949949
    950950#. +> trunk stable
    951 #: exp.g:421
     951#: exp.g:426
    952952#, kde-format
    953953msgid "Unexpected token %1"
  • kde-croatia/kde4/summit/hr/summit/messages/kdeedu/kalzium.po

    r1021 r1036  
    66"Project-Id-Version: kalzium 0\n"
    77"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    8 "POT-Creation-Date: 2011-05-16 08:59+0200\n"
     8"POT-Creation-Date: 2011-05-25 09:38+0200\n"
    99"PO-Revision-Date: 2010-08-24 23:53+0200\n"
    1010"Last-Translator: Oliver Mucafir <oliver.untwist@gmail.com>\n"
     
    8686
    8787#. +> trunk stable
    88 #: data/knowledge.xml:4 src/kalziumgradienttype.cpp:448
     88#: data/knowledge.xml:4 src/kalziumgradienttype.cpp:454
    8989msgid "State of matter"
    9090msgstr "Agregatno stanje"
     
    399399#. +> trunk stable
    400400#: data/knowledge.xml:131 src/elementdataviewer.cpp:228
    401 #: src/kalziumgradienttype.cpp:284
     401#: src/kalziumgradienttype.cpp:290
    402402msgid "Atomic Mass"
    403403msgstr "Atomska masa"
     
    564564#: data/knowledge.xml:275 src/detailinfodlg.cpp:235
    565565#: src/elementdataviewer.cpp:261 src/exportdialog.cpp:130
    566 #: src/kalziumgradienttype.cpp:169 src/plotsetupwidget.ui:146
     566#: src/kalziumgradienttype.cpp:175 src/plotsetupwidget.ui:146
    567567#: src/plotsetupwidget.ui:298 src/settings_gradients.ui:60
    568568msgid "Covalent Radius"
     
    51145114#. +> trunk stable
    51155115#: src/detailinfodlg.cpp:207 src/elementdataviewer.cpp:240
    5116 #: src/exportdialog.cpp:132 src/kalziumgradienttype.cpp:393
     5116#: src/exportdialog.cpp:132 src/kalziumgradienttype.cpp:399
    51175117#: src/plotsetupwidget.ui:131 src/plotsetupwidget.ui:283
    51185118#: src/settings_gradients.ui:88
     
    51255125#. +> trunk stable
    51265126#: src/detailinfodlg.cpp:214 src/elementdataviewer.cpp:247
    5127 #: src/exportdialog.cpp:133 src/kalziumgradienttype.cpp:337
     5127#: src/exportdialog.cpp:133 src/kalziumgradienttype.cpp:343
    51285128#: src/plotsetupwidget.ui:136 src/plotsetupwidget.ui:288
    51295129#: src/settings_gradients.ui:81
     
    65076507
    65086508#. +> trunk stable
    6509 #: src/kalziumgradienttype.cpp:226
     6509#: src/kalziumgradienttype.cpp:232
    65106510msgid "van Der Waals"
    65116511msgstr "Van Der Waals"
    65126512
    65136513#. +> trunk stable
    6514 #: src/kalziumgradienttype.cpp:296
     6514#: src/kalziumgradienttype.cpp:302
    65156515msgid "u"
    65166516msgstr "u"
     
    65246524
    65256525#. +> trunk stable
    6526 #: src/kalziumgradienttype.cpp:504
     6526#: src/kalziumgradienttype.cpp:510
    65276527msgid "Electronegativity (Pauling)"
    65286528msgstr "Elektronegativnost (Pauling)"
    65296529
    65306530#. +> trunk stable
    6531 #: src/kalziumgradienttype.cpp:559
     6531#: src/kalziumgradienttype.cpp:565
    65326532msgid "Discovery date"
    65336533msgstr "Datum otkrića"
     
    65406540#. i18n: ectx: property (text), widget (QCheckBox, kcfg_LogarithmicElectronaffinityGradient)
    65416541#. +> trunk stable
    6542 #: src/kalziumgradienttype.cpp:616 src/settings_gradients.ui:109
     6542#: src/kalziumgradienttype.cpp:622 src/settings_gradients.ui:109
    65436543msgid "Electronaffinity"
    65446544msgstr "Elektronski afinitet"
    65456545
    65466546#. +> trunk stable
    6547 #: src/kalziumgradienttype.cpp:673
     6547#: src/kalziumgradienttype.cpp:678
    65486548msgid "First Ionization"
    65496549msgstr "Prva ionizacija"
  • kde-croatia/kde4/summit/hr/summit/messages/kdeedu/marble_qt.po

    r1031 r1036  
    77"Project-Id-Version: \n"
    88"Report-Msgid-Bugs-To: \n"
    9 "POT-Creation-Date: 2011-05-22 08:38+0200\n"
     9"POT-Creation-Date: 2011-05-25 09:39+0200\n"
    1010"PO-Revision-Date: 2010-09-14 15:36+0200\n"
    1111"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     
    397397
    398398#. +> trunk stable
    399 #: src/lib/geodata/parser/GeoDataParser.cpp:98
     399#: src/lib/geodata/parser/GeoDataParser.cpp:99
    400400msgid "The file is not a valid GPX 1.0 / 1.1 file"
    401401msgstr ""
    402402
    403403#. +> trunk stable
    404 #: src/lib/geodata/parser/GeoDataParser.cpp:101
     404#: src/lib/geodata/parser/GeoDataParser.cpp:102
    405405msgid "The file is not a valid KML 2.0 / 2.1 / 2.2 file"
    406406msgstr ""
    407407
    408408#. +> trunk stable
    409 #: src/lib/geodata/parser/GeoParser.cpp:129
     409#: src/lib/geodata/parser/GeoParser.cpp:130
    410410#, fuzzy, qt-format
    411411msgid "Error parsing file at line: %1 and column %2 . "
     
    413413
    414414#. +> trunk stable
    415 #: src/lib/geodata/parser/GeoParser.cpp:131
     415#: src/lib/geodata/parser/GeoParser.cpp:132
    416416#, fuzzy
    417417msgid "This is an Invalid File"
     
    419419
    420420#. +> trunk stable
    421 #: src/lib/geodata/parser/GeoParser.cpp:190
     421#: src/lib/geodata/parser/GeoParser.cpp:191
    422422msgid "File format unrecognized"
    423423msgstr ""
    424424
    425425#. +> trunk stable
    426 #: src/lib/geodata/parser/GeoSceneParser.cpp:64
     426#: src/lib/geodata/parser/GeoSceneParser.cpp:65
    427427msgid "The file is not a valid DGML 2.0 file"
    428428msgstr ""
     
    11321132
    11331133#. +> trunk stable
    1134 #: src/lib/MarbleWidget.cpp:1159
     1134#: src/lib/MarbleWidget.cpp:1170
    11351135#: src/plugins/render/mapscale/MapScaleFloatItem.cpp:48
    11361136#: src/plugins/render/mapscale/MapScaleFloatItem.cpp:244
     
    11401140
    11411141#. +> trunk stable
    1142 #: src/lib/MarbleWidget.cpp:1163
     1142#: src/lib/MarbleWidget.cpp:1174
    11431143#: src/plugins/render/mapscale/MapScaleFloatItem.cpp:253
    11441144#, fuzzy
  • kde-croatia/kde4/summit/hr/summit/messages/kdegraphics/gwenview.po

    r1032 r1036  
    99"Project-Id-Version: \n"
    1010"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    11 "POT-Creation-Date: 2011-05-23 09:09+0200\n"
     11"POT-Creation-Date: 2011-05-25 09:39+0200\n"
    1212"PO-Revision-Date: 2011-03-12 12:13+0100\n"
    1313"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     
    126126
    127127#. +> trunk
    128 #: app/fileoperations.cpp:72
     128#: app/fileoperations.cpp:57
    129129#, fuzzy
    130130#| msgid "Copy To"
     
    139139
    140140#. +> trunk stable
    141 #: app/fileoperations.cpp:73
     141#: app/fileoperations.cpp:58
    142142msgctxt "@action:button"
    143143msgid "Copy"
     
    145145
    146146#. +> trunk
    147 #: app/fileoperations.cpp:76
     147#: app/fileoperations.cpp:61
    148148#, fuzzy
    149149#| msgid "Move To"
     
    158158
    159159#. +> trunk stable
    160 #: app/fileoperations.cpp:77
     160#: app/fileoperations.cpp:62
    161161msgctxt "@action:button"
    162162msgid "Move"
     
    164164
    165165#. +> trunk
    166 #: app/fileoperations.cpp:80
     166#: app/fileoperations.cpp:65
    167167#, fuzzy
    168168#| msgid "Link To"
     
    177177
    178178#. +> trunk stable
    179 #: app/fileoperations.cpp:81
     179#: app/fileoperations.cpp:66
    180180msgctxt "@action:button"
    181181msgid "Link"
    182182msgstr "PoveÅŸi"
    183183
    184 #. +> trunk
    185 #: app/fileoperations.cpp:170
    186 #, fuzzy
    187 #| msgid "Create Folder"
    188 msgctxt "@title:window"
    189 msgid "Create Folder"
    190 msgstr "Stvori mapu"
     184#. +> trunk stable
     185#: app/fileoperations.cpp:159
     186msgid "Move Here"
     187msgstr "Ovdje premjesti"
     188
     189#. +> trunk stable
     190#: app/fileoperations.cpp:162
     191msgid "Copy Here"
     192msgstr "Ovdje kopiraj"
     193
     194#. +> trunk stable
     195#: app/fileoperations.cpp:165
     196msgid "Link Here"
     197msgstr "Ovdje poveÅŸi"
     198
     199#. +> trunk stable
     200#: app/fileoperations.cpp:169
     201msgid "Cancel"
     202msgstr "Prekini"
    191203
    192204#. +> stable
     
    195207msgstr "Stvori mapu"
    196208
    197 #. +> trunk stable
     209#. +> stable
    198210#: app/fileoperations.cpp:171
    199211msgid "Enter the name of the folder to create:"
    200212msgstr "Unesite naziv mape koju treba stvoriti:"
    201213
    202 #. +> trunk stable
    203 #: app/fileoperations.cpp:201
    204 msgid "Move Here"
    205 msgstr "Ovdje premjesti"
    206 
    207 #. +> trunk stable
    208 #: app/fileoperations.cpp:204
    209 msgid "Copy Here"
    210 msgstr "Ovdje kopiraj"
    211 
    212 #. +> trunk stable
    213 #: app/fileoperations.cpp:207
    214 msgid "Link Here"
    215 msgstr "Ovdje poveÅŸi"
    216 
    217 #. +> trunk stable
    218 #: app/fileoperations.cpp:211
    219 msgid "Cancel"
    220 msgstr "Prekini"
    221 
    222214#. +> trunk
    223 #: app/fileoperations.cpp:227
     215#: app/fileoperations.cpp:188
    224216#, fuzzy
    225217#| msgid "Rename"
     
    234226
    235227#. +> trunk stable
    236 #: app/fileoperations.cpp:228
     228#: app/fileoperations.cpp:189
    237229#, kde-format
    238230msgid "Rename <filename>%1</filename> to:"
    239231msgstr "Preimenuj <filename>%1</filename> u:"
    240232
    241 #. +> trunk stable
    242 #: app/fileopscontextmanageritem.cpp:86
     233#. +> stable
     234#: app/fileopscontextmanageritem.cpp:82
    243235msgctxt "@action:inmenu"
    244236msgid "Paste One Folder"
    245237msgstr "Zalijepi jednu mapu"
    246238
    247 #. +> trunk stable
    248 #: app/fileopscontextmanageritem.cpp:87
     239#. +> stable
     240#: app/fileopscontextmanageritem.cpp:83
    249241msgctxt "@action:inmenu"
    250242msgid "Paste One File"
    251243msgstr "Zalijepi jednu datoteku"
    252244
    253 #. +> trunk stable
    254 #: app/fileopscontextmanageritem.cpp:90
     245#. +> stable
     246#: app/fileopscontextmanageritem.cpp:86
    255247#, kde-format
    256248msgctxt "@action:inmenu"
     
    261253msgstr[2] "Zalijepi %1 stavki"
    262254
    263 #. +> trunk stable
    264 #: app/fileopscontextmanageritem.cpp:92
     255#. +> stable
     256#: app/fileopscontextmanageritem.cpp:88
    265257msgctxt "@action:inmenu"
    266258msgid "Paste Clipboard Contents..."
    267259msgstr "Zalijepi sadrÅŸaj odlagaliÅ¡ta 
"
    268260
    269 #. +> trunk stable
    270 #: app/fileopscontextmanageritem.cpp:96
     261#. +> stable
     262#: app/fileopscontextmanageritem.cpp:92
    271263msgctxt "@action:inmenu"
    272264msgid "Paste"
     
    274266
    275267#. +> trunk stable
    276 #: app/fileopscontextmanageritem.cpp:208
     268#: app/fileopscontextmanageritem.cpp:165
    277269msgid "File Operations"
    278270msgstr "Postupci nad datotekom"
    279271
    280272#. +> trunk stable
    281 #: app/fileopscontextmanageritem.cpp:219 app/mainwindow.cpp:311
     273#: app/fileopscontextmanageritem.cpp:176 app/mainwindow.cpp:311
    282274#: app/thumbnailviewpanel.cpp:147
    283275msgctxt "@title actions category"
     
    286278
    287279#. +> trunk stable
    288 #: app/fileopscontextmanageritem.cpp:220
     280#: app/fileopscontextmanageritem.cpp:177
    289281#: app/semanticinfocontextmanageritem.cpp:161
    290282msgctxt "@title actions category"
     
    293285
    294286#. +> trunk stable
    295 #: app/fileopscontextmanageritem.cpp:235
     287#: app/fileopscontextmanageritem.cpp:192
    296288msgctxt "Verb"
    297289msgid "Copy To..."
     
    299291
    300292#. +> trunk stable
    301 #: app/fileopscontextmanageritem.cpp:239
     293#: app/fileopscontextmanageritem.cpp:196
    302294msgctxt "Verb"
    303295msgid "Move To..."
     
    305297
    306298#. +> trunk stable
    307 #: app/fileopscontextmanageritem.cpp:243
     299#: app/fileopscontextmanageritem.cpp:200
    308300msgctxt "Verb: create link to the file where user wants"
    309301msgid "Link To..."
     
    311303
    312304#. +> trunk stable
    313 #: app/fileopscontextmanageritem.cpp:247
     305#: app/fileopscontextmanageritem.cpp:204
    314306msgctxt "Verb"
    315307msgid "Rename..."
     
    317309
    318310#. +> trunk stable
    319 #: app/fileopscontextmanageritem.cpp:251
     311#: app/fileopscontextmanageritem.cpp:208
    320312msgctxt "Verb"
    321313msgid "Trash"
     
    323315
    324316#. +> trunk stable
    325 #: app/fileopscontextmanageritem.cpp:256
     317#: app/fileopscontextmanageritem.cpp:213
    326318msgid "Delete"
    327319msgstr "Izbriši"
    328320
    329321#. +> trunk
    330 #: app/fileopscontextmanageritem.cpp:261
     322#: app/fileopscontextmanageritem.cpp:218
    331323#, fuzzy
    332324msgid "Restore"
     
    334326
    335327#. +> trunk stable
    336 #: app/fileopscontextmanageritem.cpp:264
     328#: app/fileopscontextmanageritem.cpp:221
    337329msgid "Properties"
    338330msgstr "Svojstva"
    339331
    340332#. +> trunk stable
    341 #: app/fileopscontextmanageritem.cpp:268
     333#: app/fileopscontextmanageritem.cpp:225
    342334msgid "Create Folder..."
    343335msgstr "Stvori mapu 
"
    344336
    345337#. +> trunk stable
    346 #: app/fileopscontextmanageritem.cpp:272
     338#: app/fileopscontextmanageritem.cpp:229
    347339msgid "Open With"
    348340msgstr "Otvori s"
    349341
    350342#. +> trunk stable
    351 #: app/fileopscontextmanageritem.cpp:461
     343#: app/fileopscontextmanageritem.cpp:419
    352344msgid "Other Application..."
    353345msgstr "Druga aplikacija 
"
     
    753745
    754746#. +> trunk stable
    755 #: app/infocontextmanageritem.cpp:164
     747#: app/infocontextmanageritem.cpp:165
    756748#, kde-format
    757749msgctxt "@item:intext %1 is a key, we append a colon to it. A value is displayed after"
     
    760752
    761753#. +> trunk stable
    762 #: app/infocontextmanageritem.cpp:236
     754#: app/infocontextmanageritem.cpp:237
    763755msgctxt "@action show more image meta info"
    764756msgid "More..."
     
    766758
    767759#. +> trunk stable
    768 #: app/infocontextmanageritem.cpp:247
     760#: app/infocontextmanageritem.cpp:248
    769761msgctxt "@title:group"
    770762msgid "Meta Information"
     
    772764
    773765#. +> trunk stable
    774 #: app/infocontextmanageritem.cpp:336
     766#: app/infocontextmanageritem.cpp:337
    775767#, kde-format
    776768msgctxt "@label"
     
    782774
    783775#. +> trunk stable
    784 #: app/infocontextmanageritem.cpp:338
     776#: app/infocontextmanageritem.cpp:339
    785777#, kde-format
    786778msgctxt "@label"
     
    792784
    793785#. +> trunk stable
    794 #: app/infocontextmanageritem.cpp:341
     786#: app/infocontextmanageritem.cpp:342
    795787#, kde-format
    796788msgid "%1 folder"
     
    801793
    802794#. +> trunk stable
    803 #: app/infocontextmanageritem.cpp:341
     795#: app/infocontextmanageritem.cpp:342
    804796#, kde-format
    805797msgid "%1 file"
     
    810802
    811803#. +> trunk stable
    812 #: app/infocontextmanageritem.cpp:341
     804#: app/infocontextmanageritem.cpp:342
    813805#, kde-format
    814806msgctxt "@label. The two parameters are strings like '2 folders' and '1 file'."
     
    21122104msgstr "P&rikaz"
    21132105
     2106#, fuzzy
     2107#~| msgid "Create Folder"
     2108#~ msgctxt "@title:window"
     2109#~ msgid "Create Folder"
     2110#~ msgstr "Stvori mapu"
     2111
    21142112#~ msgid "Enter the new size of the image:"
    21152113#~ msgstr "Unesite novu veličinu slike:"
  • kde-croatia/kde4/summit/hr/summit/messages/kdelibs/kdecalendarsystems.po

    r1014 r1036  
    1212"Project-Id-Version: kdelibs4\n"
    1313"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    14 "POT-Creation-Date: 2011-05-09 09:14+0200\n"
     14"POT-Creation-Date: 2011-05-25 09:40+0200\n"
    1515"PO-Revision-Date: 2011-05-05 10:21+0200\n"
    1616"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
     
    3030
    3131#. +> trunk stable
    32 #: kcalendarsystem.cpp:83 kcalendarsystem.cpp:174
     32#: kcalendarsystem.cpp:83 kcalendarsystem.cpp:175
    3333msgctxt "@item Calendar system"
    3434msgid "Invalid Calendar Type"
     
    3636
    3737#. +> trunk stable
    38 #: kcalendarsystem.cpp:149
     38#: kcalendarsystem.cpp:150
    3939msgctxt "@item Calendar system"
    4040msgid "Gregorian"
     
    4242
    4343#. +> trunk stable
    44 #: kcalendarsystem.cpp:151
     44#: kcalendarsystem.cpp:152
    4545msgctxt "@item Calendar system"
    4646msgid "Coptic"
     
    4848
    4949#. +> trunk stable
    50 #: kcalendarsystem.cpp:153
     50#: kcalendarsystem.cpp:154
    5151msgctxt "@item Calendar system"
    5252msgid "Ethiopian"
     
    5454
    5555#. +> trunk stable
    56 #: kcalendarsystem.cpp:155
     56#: kcalendarsystem.cpp:156
    5757msgctxt "@item Calendar system"
    5858msgid "Gregorian (Proleptic)"
     
    6060
    6161#. +> trunk stable
    62 #: kcalendarsystem.cpp:157
     62#: kcalendarsystem.cpp:158
    6363msgctxt "@item Calendar system"
    6464msgid "Hebrew"
     
    6666
    6767#. +> trunk stable
    68 #: kcalendarsystem.cpp:159
     68#: kcalendarsystem.cpp:160
    6969msgctxt "@item Calendar system"
    7070msgid "Islamic / Hijri (Civil)"
     
    7272
    7373#. +> trunk stable
    74 #: kcalendarsystem.cpp:161
     74#: kcalendarsystem.cpp:162
    7575msgctxt "@item Calendar system"
    7676msgid "Indian National"
     
    7878
    7979#. +> trunk stable
    80 #: kcalendarsystem.cpp:163
     80#: kcalendarsystem.cpp:164
    8181msgctxt "@item Calendar system"
    8282msgid "Jalali"
     
    8484
    8585#. +> trunk stable
    86 #: kcalendarsystem.cpp:165
     86#: kcalendarsystem.cpp:166
    8787msgctxt "@item Calendar system"
    8888msgid "Japanese"
     
    9090
    9191#. +> trunk stable
    92 #: kcalendarsystem.cpp:167
     92#: kcalendarsystem.cpp:168
    9393msgctxt "@item Calendar system"
    9494msgid "Julian"
     
    9696
    9797#. +> trunk stable
    98 #: kcalendarsystem.cpp:169
     98#: kcalendarsystem.cpp:170
    9999msgctxt "@item Calendar system"
    100100msgid "Taiwanese"
     
    102102
    103103#. +> trunk stable
    104 #: kcalendarsystem.cpp:171
     104#: kcalendarsystem.cpp:172
    105105msgctxt "@item Calendar system"
    106106msgid "Thai"
     
    108108
    109109#. +> trunk stable
    110 #: kcalendarsystem.cpp:1990
     110#: kcalendarsystem.cpp:2026
    111111msgctxt "Negative symbol as used for year numbers, e.g. -5 = 5 BC"
    112112msgid "-"
     
    114114
    115115#. +> trunk stable
    116 #: kcalendarsystem.cpp:2027
     116#: kcalendarsystem.cpp:2063
    117117msgid "Today"
    118118msgstr "Danas"
    119119
    120120#. +> trunk stable
    121 #: kcalendarsystem.cpp:2029
     121#: kcalendarsystem.cpp:2065
    122122msgid "Yesterday"
    123123msgstr "Jučer"
     
    12821282
    12831283#. +> trunk stable
    1284 #: kcalendarsystemethiopian.cpp:56
     1284#: kcalendarsystemethiopian.cpp:54
    12851285msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, LongFormat"
    12861286msgid "Amata Mehrat"
     
    12881288
    12891289#. +> trunk stable
    1290 #: kcalendarsystemethiopian.cpp:57
     1290#: kcalendarsystemethiopian.cpp:55
    12911291msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, ShortFormat"
    12921292msgid "AM"
     
    12941294
    12951295#. +> trunk stable
    1296 #: kcalendarsystemethiopian.cpp:58
     1296#: kcalendarsystemethiopian.cpp:56
    12971297#, c-format
    12981298msgctxt "(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM"
     
    13011301
    13021302#. +> trunk
    1303 #: kcalendarsystemethiopian.cpp:70
     1303#: kcalendarsystemethiopian.cpp:68
    13041304#, fuzzy
    13051305msgctxt "Ethiopian month 1 - KLocale::NarrowName"
     
    13081308
    13091309#. +> trunk
    1310 #: kcalendarsystemethiopian.cpp:72
     1310#: kcalendarsystemethiopian.cpp:70
    13111311#, fuzzy
    13121312msgctxt "Ethiopian month 2 - KLocale::NarrowName"
     
    13151315
    13161316#. +> trunk
    1317 #: kcalendarsystemethiopian.cpp:74
     1317#: kcalendarsystemethiopian.cpp:72
    13181318#, fuzzy
    13191319msgctxt "Ethiopian month 3 - KLocale::NarrowName"
     
    13221322
    13231323#. +> trunk
    1324 #: kcalendarsystemethiopian.cpp:76
     1324#: kcalendarsystemethiopian.cpp:74
    13251325#, fuzzy
    13261326msgctxt "Ethiopian month 4 - KLocale::NarrowName"
     
    13291329
    13301330#. +> trunk
    1331 #: kcalendarsystemethiopian.cpp:78
     1331#: kcalendarsystemethiopian.cpp:76
    13321332#, fuzzy
    13331333msgctxt "Ethiopian month 5 - KLocale::NarrowName"
     
    13361336
    13371337#. +> trunk
    1338 #: kcalendarsystemethiopian.cpp:80
     1338#: kcalendarsystemethiopian.cpp:78
    13391339#, fuzzy
    13401340msgctxt "Ethiopian month 6 - KLocale::NarrowName"
     
    13431343
    13441344#. +> trunk
    1345 #: kcalendarsystemethiopian.cpp:82
     1345#: kcalendarsystemethiopian.cpp:80
    13461346#, fuzzy
    13471347msgctxt "Ethiopian month 7 - KLocale::NarrowName"
     
    13501350
    13511351#. +> trunk
    1352 #: kcalendarsystemethiopian.cpp:84
     1352#: kcalendarsystemethiopian.cpp:82
    13531353#, fuzzy
    13541354msgctxt "Ethiopian month 8 - KLocale::NarrowName"
     
    13571357
    13581358#. +> trunk
    1359 #: kcalendarsystemethiopian.cpp:86
     1359#: kcalendarsystemethiopian.cpp:84
    13601360#, fuzzy
    13611361msgctxt "Ethiopian month 9 - KLocale::NarrowName"
     
    13641364
    13651365#. +> trunk
    1366 #: kcalendarsystemethiopian.cpp:88
     1366#: kcalendarsystemethiopian.cpp:86
    13671367#, fuzzy
    13681368msgctxt "Ethiopian month 10 - KLocale::NarrowName"
     
    13711371
    13721372#. +> trunk
    1373 #: kcalendarsystemethiopian.cpp:90
     1373#: kcalendarsystemethiopian.cpp:88
    13741374#, fuzzy
    13751375msgctxt "Ethiopian month 11 - KLocale::NarrowName"
     
    13781378
    13791379#. +> trunk
    1380 #: kcalendarsystemethiopian.cpp:92
     1380#: kcalendarsystemethiopian.cpp:90
    13811381#, fuzzy
    13821382msgctxt "Ethiopian month 12 - KLocale::NarrowName"
     
    13851385
    13861386#. +> trunk
    1387 #: kcalendarsystemethiopian.cpp:94
     1387#: kcalendarsystemethiopian.cpp:92
    13881388#, fuzzy
    13891389#| msgid "PM"
     
    13931393
    13941394#. +> trunk
    1395 #: kcalendarsystemethiopian.cpp:103
     1395#: kcalendarsystemethiopian.cpp:101
    13961396#, fuzzy
    13971397#| msgctxt "Coptic month 6 - ShortNamePossessive"
     
    14081408
    14091409#. +> trunk
    1410 #: kcalendarsystemethiopian.cpp:105
     1410#: kcalendarsystemethiopian.cpp:103
    14111411#, fuzzy
    14121412#| msgctxt "Ethiopian month 2 - ShortNamePossessive"
     
    14231423
    14241424#. +> trunk
    1425 #: kcalendarsystemethiopian.cpp:107
     1425#: kcalendarsystemethiopian.cpp:105
    14261426#, fuzzy
    14271427#| msgctxt "Ethiopian month 3 - ShortNamePossessive"
     
    14381438
    14391439#. +> trunk
    1440 #: kcalendarsystemethiopian.cpp:109
     1440#: kcalendarsystemethiopian.cpp:107
    14411441#, fuzzy
    14421442#| msgctxt "Ethiopian month 4 - ShortNamePossessive"
     
    14531453
    14541454#. +> trunk
    1455 #: kcalendarsystemethiopian.cpp:111
     1455#: kcalendarsystemethiopian.cpp:109
    14561456#, fuzzy
    14571457#| msgctxt "Ethiopian month 5 - ShortNamePossessive"
     
    14681468
    14691469#. +> trunk
    1470 #: kcalendarsystemethiopian.cpp:113
     1470#: kcalendarsystemethiopian.cpp:111
    14711471#, fuzzy
    14721472#| msgctxt "Ethiopian month 6 - ShortNamePossessive"
     
    14831483
    14841484#. +> trunk
    1485 #: kcalendarsystemethiopian.cpp:115
     1485#: kcalendarsystemethiopian.cpp:113
    14861486#, fuzzy
    14871487#| msgctxt "Ethiopian month 7 - ShortNamePossessive"
     
    14981498
    14991499#. +> trunk
    1500 #: kcalendarsystemethiopian.cpp:117
     1500#: kcalendarsystemethiopian.cpp:115
    15011501#, fuzzy
    15021502#| msgctxt "Ethiopian month 8 - ShortNamePossessive"
     
    15131513
    15141514#. +> trunk
    1515 #: kcalendarsystemethiopian.cpp:119
     1515#: kcalendarsystemethiopian.cpp:117
    15161516#, fuzzy
    15171517#| msgctxt "Ethiopian month 9 - ShortNamePossessive"
     
    15281528
    15291529#. +> trunk
    1530 #: kcalendarsystemethiopian.cpp:121
     1530#: kcalendarsystemethiopian.cpp:119
    15311531#, fuzzy
    15321532#| msgctxt "Ethiopian month 10 - ShortNamePossessive"
     
    15431543
    15441544#. +> trunk
    1545 #: kcalendarsystemethiopian.cpp:123
     1545#: kcalendarsystemethiopian.cpp:121
    15461546#, fuzzy
    15471547#| msgctxt "Ethiopian month 11 - ShortNamePossessive"
     
    15581558
    15591559#. +> trunk
    1560 #: kcalendarsystemethiopian.cpp:125
     1560#: kcalendarsystemethiopian.cpp:123
    15611561#, fuzzy
    15621562#| msgctxt "Ethiopian month 12 - ShortNamePossessive"
     
    15731573
    15741574#. +> trunk
    1575 #: kcalendarsystemethiopian.cpp:127
     1575#: kcalendarsystemethiopian.cpp:125
    15761576#, fuzzy
    15771577#| msgctxt "Ethiopian month 13 - ShortNamePossessive"
     
    15881588
    15891589#. +> trunk
    1590 #: kcalendarsystemethiopian.cpp:136
     1590#: kcalendarsystemethiopian.cpp:134
    15911591#, fuzzy
    15921592#| msgctxt "Coptic month 6 - ShortName"
     
    16031603
    16041604#. +> trunk
    1605 #: kcalendarsystemethiopian.cpp:138
     1605#: kcalendarsystemethiopian.cpp:136
    16061606#, fuzzy
    16071607#| msgctxt "Ethiopian month 2 - ShortName"
     
    16181618
    16191619#. +> trunk
    1620 #: kcalendarsystemethiopian.cpp:140
     1620#: kcalendarsystemethiopian.cpp:138
    16211621#, fuzzy
    16221622#| msgctxt "Ethiopian month 3 - ShortName"
     
    16331633
    16341634#. +> trunk
    1635 #: kcalendarsystemethiopian.cpp:142
     1635#: kcalendarsystemethiopian.cpp:140
    16361636#, fuzzy
    16371637#| msgctxt "Ethiopian month 4 - ShortName"
     
    16481648
    16491649#. +> trunk
    1650 #: kcalendarsystemethiopian.cpp:144
     1650#: kcalendarsystemethiopian.cpp:142
    16511651#, fuzzy
    16521652#| msgctxt "Ethiopian month 5 - ShortName"
     
    16631663
    16641664#. +> trunk
    1665 #: kcalendarsystemethiopian.cpp:146
     1665#: kcalendarsystemethiopian.cpp:144
    16661666#, fuzzy
    16671667#| msgctxt "Ethiopian month 6 - ShortName"
     
    16781678
    16791679#. +> trunk
    1680 #: kcalendarsystemethiopian.cpp:148
     1680#: kcalendarsystemethiopian.cpp:146
    16811681#, fuzzy
    16821682#| msgctxt "Ethiopian month 7 - ShortName"
     
    16931693
    16941694#. +> trunk
    1695 #: kcalendarsystemethiopian.cpp:150
     1695#: kcalendarsystemethiopian.cpp:148
    16961696#, fuzzy
    16971697#| msgctxt "Ethiopian month 8 - ShortName"
     
    17081708
    17091709#. +> trunk
    1710 #: kcalendarsystemethiopian.cpp:152
     1710#: kcalendarsystemethiopian.cpp:150
    17111711#, fuzzy
    17121712#| msgctxt "Ethiopian month 9 - ShortName"
     
    17231723
    17241724#. +> trunk
    1725 #: kcalendarsystemethiopian.cpp:154
     1725#: kcalendarsystemethiopian.cpp:152
    17261726#, fuzzy
    17271727#| msgctxt "Ethiopian month 10 - ShortName"
     
    17381738
    17391739#. +> trunk
    1740 #: kcalendarsystemethiopian.cpp:156
     1740#: kcalendarsystemethiopian.cpp:154
    17411741#, fuzzy
    17421742msgctxt "Ethiopian month 11 - KLocale::ShortName"
     
    17511751
    17521752#. +> trunk
    1753 #: kcalendarsystemethiopian.cpp:158
     1753#: kcalendarsystemethiopian.cpp:156
    17541754#, fuzzy
    17551755#| msgctxt "Ethiopian month 12 - ShortName"
     
    17661766
    17671767#. +> trunk
    1768 #: kcalendarsystemethiopian.cpp:160
     1768#: kcalendarsystemethiopian.cpp:158
    17691769#, fuzzy
    17701770#| msgctxt "Ethiopian month 13 - ShortName"
     
    17811781
    17821782#. +> trunk
    1783 #: kcalendarsystemethiopian.cpp:169
     1783#: kcalendarsystemethiopian.cpp:167
    17841784#, fuzzy
    17851785#| msgctxt "Ethiopian month 1 - LongNamePossessive"
     
    17961796
    17971797#. +> trunk
    1798 #: kcalendarsystemethiopian.cpp:171
     1798#: kcalendarsystemethiopian.cpp:169
    17991799#, fuzzy
    18001800#| msgctxt "Ethiopian month 2 - LongNamePossessive"
     
    18111811
    18121812#. +> trunk
    1813 #: kcalendarsystemethiopian.cpp:173
     1813#: kcalendarsystemethiopian.cpp:171
    18141814#, fuzzy
    18151815#| msgctxt "Ethiopian month 3 - LongNamePossessive"
     
    18261826
    18271827#. +> trunk
    1828 #: kcalendarsystemethiopian.cpp:175
     1828#: kcalendarsystemethiopian.cpp:173
    18291829#, fuzzy
    18301830#| msgctxt "Ethiopian month 4 - LongNamePossessive"
     
    18411841
    18421842#. +> trunk
    1843 #: kcalendarsystemethiopian.cpp:177
     1843#: kcalendarsystemethiopian.cpp:175
    18441844#, fuzzy
    18451845#| msgctxt "Ethiopian month 5 - ShortNamePossessive"
     
    18561856
    18571857#. +> trunk
    1858 #: kcalendarsystemethiopian.cpp:179
     1858#: kcalendarsystemethiopian.cpp:177
    18591859#, fuzzy
    18601860#| msgctxt "Ethiopian month 6 - LongNamePossessive"
     
    18711871
    18721872#. +> trunk
    1873 #: kcalendarsystemethiopian.cpp:181
     1873#: kcalendarsystemethiopian.cpp:179
    18741874#, fuzzy
    18751875#| msgctxt "Ethiopian month 7 - LongNamePossessive"
     
    18861886
    18871887#. +> trunk
    1888 #: kcalendarsystemethiopian.cpp:183
     1888#: kcalendarsystemethiopian.cpp:181
    18891889#, fuzzy
    18901890#| msgctxt "Ethiopian month 8 - LongNamePossessive"
     
    19011901
    19021902#. +> trunk
    1903 #: kcalendarsystemethiopian.cpp:185
     1903#: kcalendarsystemethiopian.cpp:183
    19041904#, fuzzy
    19051905#| msgctxt "Ethiopian month 9 - LongNamePossessive"
     
    19161916
    19171917#. +> trunk
    1918 #: kcalendarsystemethiopian.cpp:187
     1918#: kcalendarsystemethiopian.cpp:185
    19191919#, fuzzy
    19201920#| msgctxt "Ethiopian month 10 - LongNamePossessive"
     
    19311931
    19321932#. +> trunk
    1933 #: kcalendarsystemethiopian.cpp:189
     1933#: kcalendarsystemethiopian.cpp:187
    19341934#, fuzzy
    19351935#| msgctxt "Ethiopian month 11 - LongNamePossessive"
     
    19461946
    19471947#. +> trunk
    1948 #: kcalendarsystemethiopian.cpp:191
     1948#: kcalendarsystemethiopian.cpp:189
    19491949#, fuzzy
    19501950#| msgctxt "Ethiopian month 12 - LongNamePossessive"
     
    19611961
    19621962#. +> trunk
    1963 #: kcalendarsystemethiopian.cpp:193
     1963#: kcalendarsystemethiopian.cpp:191
    19641964#, fuzzy
    19651965#| msgctxt "Ethiopian month 13 - LongNamePossessive"
     
    19761976
    19771977#. +> trunk
    1978 #: kcalendarsystemethiopian.cpp:202
     1978#: kcalendarsystemethiopian.cpp:200
    19791979#, fuzzy
    19801980#| msgctxt "Ethiopian month 1 - LongName"
     
    19911991
    19921992#. +> trunk
    1993 #: kcalendarsystemethiopian.cpp:204
     1993#: kcalendarsystemethiopian.cpp:202
    19941994#, fuzzy
    19951995#| msgctxt "Ethiopian month 2 - LongName"
     
    20062006
    20072007#. +> trunk
    2008 #: kcalendarsystemethiopian.cpp:206
     2008#: kcalendarsystemethiopian.cpp:204
    20092009#, fuzzy
    20102010#| msgctxt "Ethiopian month 3 - LongName"
     
    20212021
    20222022#. +> trunk
    2023 #: kcalendarsystemethiopian.cpp:208
     2023#: kcalendarsystemethiopian.cpp:206
    20242024#, fuzzy
    20252025#| msgctxt "Ethiopian month 4 - LongName"
     
    20362036
    20372037#. +> trunk
    2038 #: kcalendarsystemethiopian.cpp:210
     2038#: kcalendarsystemethiopian.cpp:208
    20392039#, fuzzy
    20402040#| msgctxt "Ethiopian month 5 - ShortName"
     
    20512051
    20522052#. +> trunk
    2053 #: kcalendarsystemethiopian.cpp:212
     2053#: kcalendarsystemethiopian.cpp:210
    20542054#, fuzzy
    20552055#| msgctxt "Ethiopian month 6 - LongName"
     
    20662066
    20672067#. +> trunk
    2068 #: kcalendarsystemethiopian.cpp:214
     2068#: kcalendarsystemethiopian.cpp:212
    20692069#, fuzzy
    20702070#| msgctxt "Ethiopian month 7 - LongName"
     
    20812081
    20822082#. +> trunk
    2083 #: kcalendarsystemethiopian.cpp:216
     2083#: kcalendarsystemethiopian.cpp:214
    20842084#, fuzzy
    20852085#| msgctxt "Ethiopian month 8 - LongName"
     
    20962096
    20972097#. +> trunk
    2098 #: kcalendarsystemethiopian.cpp:218
     2098#: kcalendarsystemethiopian.cpp:216
    20992099#, fuzzy
    21002100#| msgctxt "Ethiopian month 9 - LongName"
     
    21112111
    21122112#. +> trunk
    2113 #: kcalendarsystemethiopian.cpp:220
     2113#: kcalendarsystemethiopian.cpp:218
    21142114#, fuzzy
    21152115#| msgctxt "Ethiopian month 10 - LongName"
     
    21262126
    21272127#. +> trunk
    2128 #: kcalendarsystemethiopian.cpp:222
     2128#: kcalendarsystemethiopian.cpp:220
    21292129#, fuzzy
    21302130#| msgctxt "Ethiopian month 11 - LongName"
     
    21412141
    21422142#. +> trunk
    2143 #: kcalendarsystemethiopian.cpp:224
     2143#: kcalendarsystemethiopian.cpp:222
    21442144#, fuzzy
    21452145#| msgctxt "Ethiopian month 12 - LongName"
     
    21562156
    21572157#. +> trunk
    2158 #: kcalendarsystemethiopian.cpp:226
     2158#: kcalendarsystemethiopian.cpp:224
    21592159#, fuzzy
    21602160#| msgctxt "Ethiopian month 13 - LongName"
     
    21712171
    21722172#. +> trunk
    2173 #: kcalendarsystemethiopian.cpp:238
     2173#: kcalendarsystemethiopian.cpp:236
    21742174#, fuzzy
    21752175msgctxt "Ethiopian weekday 1 - KLocale::NarrowName "
     
    21782178
    21792179#. +> trunk
    2180 #: kcalendarsystemethiopian.cpp:240
     2180#: kcalendarsystemethiopian.cpp:238
    21812181#, fuzzy
    21822182msgctxt "Ethiopian weekday 2 - KLocale::NarrowName "
     
    21852185
    21862186#. +> trunk
    2187 #: kcalendarsystemethiopian.cpp:242
     2187#: kcalendarsystemethiopian.cpp:240
    21882188#, fuzzy
    21892189msgctxt "Ethiopian weekday 3 - KLocale::NarrowName "
     
    21922192
    21932193#. +> trunk
    2194 #: kcalendarsystemethiopian.cpp:244
     2194#: kcalendarsystemethiopian.cpp:242
    21952195#, fuzzy
    21962196msgctxt "Ethiopian weekday 4 - KLocale::NarrowName "
     
    21992199
    22002200#. +> trunk
    2201 #: kcalendarsystemethiopian.cpp:246
     2201#: kcalendarsystemethiopian.cpp:244
    22022202#, fuzzy
    22032203msgctxt "Ethiopian weekday 5 - KLocale::NarrowName "
     
    22062206
    22072207#. +> trunk
    2208 #: kcalendarsystemethiopian.cpp:248
     2208#: kcalendarsystemethiopian.cpp:246
    22092209#, fuzzy
    22102210msgctxt "Ethiopian weekday 6 - KLocale::NarrowName "
     
    22132213
    22142214#. +> trunk
    2215 #: kcalendarsystemethiopian.cpp:250
     2215#: kcalendarsystemethiopian.cpp:248
    22162216#, fuzzy
    22172217msgctxt "Ethiopian weekday 7 - KLocale::NarrowName "
     
    22202220
    22212221#. +> trunk
    2222 #: kcalendarsystemethiopian.cpp:259
     2222#: kcalendarsystemethiopian.cpp:257
    22232223#, fuzzy
    22242224#| msgctxt "Ethiopian weekday 1 - ShortDayName"
     
    22352235
    22362236#. +> trunk
    2237 #: kcalendarsystemethiopian.cpp:261
     2237#: kcalendarsystemethiopian.cpp:259
    22382238#, fuzzy
    22392239#| msgctxt "Ethiopian weekday 2 - ShortDayName"
     
    22502250
    22512251#. +> trunk
    2252 #: kcalendarsystemethiopian.cpp:263
     2252#: kcalendarsystemethiopian.cpp:261
    22532253#, fuzzy
    22542254#| msgctxt "Ethiopian weekday 3 - ShortDayName"
     
    22652265
    22662266#. +> trunk
    2267 #: kcalendarsystemethiopian.cpp:265
     2267#: kcalendarsystemethiopian.cpp:263
    22682268#, fuzzy
    22692269msgctxt "Ethiopian weekday 4 - KLocale::ShortName"
     
    22782278
    22792279#. +> trunk
    2280 #: kcalendarsystemethiopian.cpp:267
     2280#: kcalendarsystemethiopian.cpp:265
    22812281#, fuzzy
    22822282#| msgid "Arb"
     
    22922292
    22932293#. +> trunk
    2294 #: kcalendarsystemethiopian.cpp:269
     2294#: kcalendarsystemethiopian.cpp:267
    22952295#, fuzzy
    22962296#| msgctxt "Ethiopian weekday 6 - ShortDayName"
     
    23072307
    23082308#. +> trunk
    2309 #: kcalendarsystemethiopian.cpp:271
     2309#: kcalendarsystemethiopian.cpp:269
    23102310#, fuzzy
    23112311#| msgctxt "Ethiopian weekday 7 - ShortDayName"
     
    23222322
    23232323#. +> trunk
    2324 #: kcalendarsystemethiopian.cpp:278
     2324#: kcalendarsystemethiopian.cpp:276
    23252325#, fuzzy
    23262326#| msgctxt "Ethiopian weekday 1 - LongDayName"
     
    23372337
    23382338#. +> trunk
    2339 #: kcalendarsystemethiopian.cpp:280
     2339#: kcalendarsystemethiopian.cpp:278
    23402340#, fuzzy
    23412341#| msgctxt "Ethiopian weekday 2 - LongDayName"
     
    23522352
    23532353#. +> trunk
    2354 #: kcalendarsystemethiopian.cpp:282
     2354#: kcalendarsystemethiopian.cpp:280
    23552355#, fuzzy
    23562356#| msgctxt "Ethiopian weekday 3 - ShortDayName"
     
    23672367
    23682368#. +> trunk
    2369 #: kcalendarsystemethiopian.cpp:284
     2369#: kcalendarsystemethiopian.cpp:282
    23702370#, fuzzy
    23712371#| msgctxt "Ethiopian weekday 4 - LongDayName"
     
    23822382
    23832383#. +> trunk
    2384 #: kcalendarsystemethiopian.cpp:286
     2384#: kcalendarsystemethiopian.cpp:284
    23852385#, fuzzy
    23862386#| msgid "Arb"
     
    23962396
    23972397#. +> trunk
    2398 #: kcalendarsystemethiopian.cpp:288
     2398#: kcalendarsystemethiopian.cpp:286
    23992399#, fuzzy
    24002400#| msgctxt "Ethiopian weekday 6 - LongDayName"
     
    24112411
    24122412#. +> trunk
    2413 #: kcalendarsystemethiopian.cpp:290
     2413#: kcalendarsystemethiopian.cpp:288
    24142414#, fuzzy
    24152415#| msgctxt "Ethiopian weekday 7 - LongDayName"
     
    24262426
    24272427#. +> trunk stable
    2428 #: kcalendarsystemgregorian.cpp:90 kcalendarsystemgregorianproleptic.cpp:60
     2428#: kcalendarsystemgregorian.cpp:60 kcalendarsystemqdate.cpp:90
    24292429msgctxt "Calendar Era: Gregorian Common Era, years < 0, LongFormat"
    24302430msgid "Before Common Era"
     
    24322432
    24332433#. +> trunk stable
    2434 #: kcalendarsystemgregorian.cpp:91 kcalendarsystemgregorianproleptic.cpp:61
     2434#: kcalendarsystemgregorian.cpp:61 kcalendarsystemqdate.cpp:91
    24352435msgctxt "Calendar Era: Gregorian Common Era, years < 0, ShortFormat"
    24362436msgid "BCE"
     
    24382438
    24392439#. +> trunk stable
    2440 #: kcalendarsystemgregorian.cpp:93 kcalendarsystemgregorianproleptic.cpp:63
     2440#: kcalendarsystemgregorian.cpp:63 kcalendarsystemqdate.cpp:93
    24412441msgctxt "Calendar Era: Gregorian Christian Era, years < 0, LongFormat"
    24422442msgid "Before Christ"
     
    24442444
    24452445#. +> trunk stable
    2446 #: kcalendarsystemgregorian.cpp:94 kcalendarsystemgregorianproleptic.cpp:64
     2446#: kcalendarsystemgregorian.cpp:64 kcalendarsystemqdate.cpp:94
    24472447msgctxt "Calendar Era: Gregorian Christian Era, years < 0, ShortFormat"
    24482448msgid "BC"
     
    24502450
    24512451#. +> trunk stable
    2452 #: kcalendarsystemgregorian.cpp:96 kcalendarsystemgregorianproleptic.cpp:66
     2452#: kcalendarsystemgregorian.cpp:66 kcalendarsystemqdate.cpp:96
    24532453#, c-format
    24542454msgctxt "(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC"
     
    24572457
    24582458#. +> trunk stable
    2459 #: kcalendarsystemgregorian.cpp:100 kcalendarsystemgregorianproleptic.cpp:70
     2459#: kcalendarsystemgregorian.cpp:70 kcalendarsystemqdate.cpp:100
    24602460msgctxt "Calendar Era: Gregorian Common Era, years > 0, LongFormat"
    24612461msgid "Common Era"
     
    24632463
    24642464#. +> trunk stable
    2465 #: kcalendarsystemgregorian.cpp:101 kcalendarsystemgregorianproleptic.cpp:71
     2465#: kcalendarsystemgregorian.cpp:71 kcalendarsystemqdate.cpp:101
    24662466msgctxt "Calendar Era: Gregorian Common Era, years > 0, ShortFormat"
    24672467msgid "CE"
     
    24692469
    24702470#. +> trunk stable
    2471 #: kcalendarsystemgregorian.cpp:103 kcalendarsystemgregorianproleptic.cpp:73
    2472 #: kcalendarsystemjapanese.cpp:63
     2471#: kcalendarsystemgregorian.cpp:73 kcalendarsystemjapanese.cpp:63
     2472#: kcalendarsystemqdate.cpp:103
    24732473msgctxt "Calendar Era: Gregorian Christian Era, years > 0, LongFormat"
    24742474msgid "Anno Domini"
     
    24762476
    24772477#. +> trunk stable
    2478 #: kcalendarsystemgregorian.cpp:104 kcalendarsystemgregorianproleptic.cpp:74
    2479 #: kcalendarsystemjapanese.cpp:64
     2478#: kcalendarsystemgregorian.cpp:74 kcalendarsystemjapanese.cpp:64
     2479#: kcalendarsystemqdate.cpp:104
    24802480msgctxt "Calendar Era: Gregorian Christian Era, years > 0, ShortFormat"
    24812481msgid "AD"
     
    24832483
    24842484#. +> trunk stable
    2485 #: kcalendarsystemgregorian.cpp:106 kcalendarsystemgregorianproleptic.cpp:76
    2486 #: kcalendarsystemjapanese.cpp:65
     2485#: kcalendarsystemgregorian.cpp:76 kcalendarsystemjapanese.cpp:65
     2486#: kcalendarsystemqdate.cpp:106
    24872487#, c-format
    24882488msgctxt "(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD"
     
    24912491
    24922492#. +> trunk
    2493 #: kcalendarsystemgregorian.cpp:175 kcalendarsystemgregorianproleptic.cpp:171
     2493#: kcalendarsystemgregorian.cpp:171 kcalendarsystemqdate.cpp:175
    24942494#, fuzzy
    24952495msgctxt "Gregorian month 1 - KLocale::NarrowName"
     
    24982498
    24992499#. +> trunk
    2500 #: kcalendarsystemgregorian.cpp:177 kcalendarsystemgregorianproleptic.cpp:173
     2500#: kcalendarsystemgregorian.cpp:173 kcalendarsystemqdate.cpp:177
    25012501#, fuzzy
    25022502msgctxt "Gregorian month 2 - KLocale::NarrowName"
     
    25052505
    25062506#. +> trunk
    2507 #: kcalendarsystemgregorian.cpp:179 kcalendarsystemgregorianproleptic.cpp:175
     2507#: kcalendarsystemgregorian.cpp:175 kcalendarsystemqdate.cpp:179
    25082508#, fuzzy
    25092509msgctxt "Gregorian month 3 - KLocale::NarrowName"
     
    25122512
    25132513#. +> trunk
    2514 #: kcalendarsystemgregorian.cpp:181 kcalendarsystemgregorianproleptic.cpp:177
     2514#: kcalendarsystemgregorian.cpp:177 kcalendarsystemqdate.cpp:181
    25152515#, fuzzy
    25162516msgctxt "Gregorian month 4 - KLocale::NarrowName"
     
    25192519
    25202520#. +> trunk
    2521 #: kcalendarsystemgregorian.cpp:183 kcalendarsystemgregorianproleptic.cpp:179
     2521#: kcalendarsystemgregorian.cpp:179 kcalendarsystemqdate.cpp:183
    25222522#, fuzzy
    25232523msgctxt "Gregorian month 5 - KLocale::NarrowName"
     
    25262526
    25272527#. +> trunk
    2528 #: kcalendarsystemgregorian.cpp:185 kcalendarsystemgregorianproleptic.cpp:181
     2528#: kcalendarsystemgregorian.cpp:181 kcalendarsystemqdate.cpp:185
    25292529#, fuzzy
    25302530msgctxt "Gregorian month 6 - KLocale::NarrowName"
     
    25332533
    25342534#. +> trunk
    2535 #: kcalendarsystemgregorian.cpp:187 kcalendarsystemgregorianproleptic.cpp:183
     2535#: kcalendarsystemgregorian.cpp:183 kcalendarsystemqdate.cpp:187
    25362536#, fuzzy
    25372537msgctxt "Gregorian month 7 - KLocale::NarrowName"
     
    25402540
    25412541#. +> trunk
    2542 #: kcalendarsystemgregorian.cpp:189 kcalendarsystemgregorianproleptic.cpp:185
     2542#: kcalendarsystemgregorian.cpp:185 kcalendarsystemqdate.cpp:189
    25432543#, fuzzy
    25442544msgctxt "Gregorian month 8 - KLocale::NarrowName"
     
    25472547
    25482548#. +> trunk
    2549 #: kcalendarsystemgregorian.cpp:191 kcalendarsystemgregorianproleptic.cpp:187
     2549#: kcalendarsystemgregorian.cpp:187 kcalendarsystemqdate.cpp:191
    25502550#, fuzzy
    25512551msgctxt "Gregorian month 9 - KLocale::NarrowName"
     
    25542554
    25552555#. +> trunk
    2556 #: kcalendarsystemgregorian.cpp:193 kcalendarsystemgregorianproleptic.cpp:189
     2556#: kcalendarsystemgregorian.cpp:189 kcalendarsystemqdate.cpp:193
    25572557#, fuzzy
    25582558msgctxt "Gregorian month 10 - KLocale::NarrowName"
     
    25612561
    25622562#. +> trunk
    2563 #: kcalendarsystemgregorian.cpp:195 kcalendarsystemgregorianproleptic.cpp:191
     2563#: kcalendarsystemgregorian.cpp:191 kcalendarsystemqdate.cpp:195
    25642564#, fuzzy
    25652565msgctxt "Gregorian month 11 - KLocale::NarrowName"
     
    25682568
    25692569#. +> trunk
    2570 #: kcalendarsystemgregorian.cpp:197 kcalendarsystemgregorianproleptic.cpp:193
     2570#: kcalendarsystemgregorian.cpp:193 kcalendarsystemqdate.cpp:197
    25712571#, fuzzy
    25722572msgctxt "Gregorian month 12 - KLocale::NarrowName"
     
    25752575
    25762576#. +> trunk
    2577 #: kcalendarsystemgregorian.cpp:206 kcalendarsystemgregorianproleptic.cpp:202
     2577#: kcalendarsystemgregorian.cpp:202 kcalendarsystemqdate.cpp:206
    25782578#, fuzzy
    25792579#| msgctxt "of January"
     
    25912591
    25922592#. +> trunk
    2593 #: kcalendarsystemgregorian.cpp:208 kcalendarsystemgregorianproleptic.cpp:204
     2593#: kcalendarsystemgregorian.cpp:204 kcalendarsystemqdate.cpp:208
    25942594#, fuzzy
    25952595#| msgctxt "of February"
     
    26072607
    26082608#. +> trunk
    2609 #: kcalendarsystemgregorian.cpp:210 kcalendarsystemgregorianproleptic.cpp:206
     2609#: kcalendarsystemgregorian.cpp:206 kcalendarsystemqdate.cpp:210
    26102610#, fuzzy
    26112611#| msgctxt "of March"
     
    26232623
    26242624#. +> trunk
    2625 #: kcalendarsystemgregorian.cpp:212 kcalendarsystemgregorianproleptic.cpp:208
     2625#: kcalendarsystemgregorian.cpp:208 kcalendarsystemqdate.cpp:212
    26262626#, fuzzy
    26272627#| msgctxt "of April"
     
    26392639
    26402640#. +> trunk
    2641 #: kcalendarsystemgregorian.cpp:214 kcalendarsystemgregorianproleptic.cpp:210
     2641#: kcalendarsystemgregorian.cpp:210 kcalendarsystemqdate.cpp:214
    26422642#, fuzzy
    26432643#| msgctxt "of May short"
     
    26482648
    26492649#. +> trunk
    2650 #: kcalendarsystemgregorian.cpp:216 kcalendarsystemgregorianproleptic.cpp:212
     2650#: kcalendarsystemgregorian.cpp:212 kcalendarsystemqdate.cpp:216
    26512651#, fuzzy
    26522652#| msgctxt "of June"
     
    26642664
    26652665#. +> trunk
    2666 #: kcalendarsystemgregorian.cpp:218 kcalendarsystemgregorianproleptic.cpp:214
     2666#: kcalendarsystemgregorian.cpp:214 kcalendarsystemqdate.cpp:218
    26672667#, fuzzy
    26682668#| msgctxt "of July"
     
    26802680
    26812681#. +> trunk
    2682 #: kcalendarsystemgregorian.cpp:220 kcalendarsystemgregorianproleptic.cpp:216
     2682#: kcalendarsystemgregorian.cpp:216 kcalendarsystemqdate.cpp:220
    26832683#, fuzzy
    26842684#| msgctxt "of August"
     
    26962696
    26972697#. +> trunk
    2698 #: kcalendarsystemgregorian.cpp:222 kcalendarsystemgregorianproleptic.cpp:218
     2698#: kcalendarsystemgregorian.cpp:218 kcalendarsystemqdate.cpp:222
    26992699#, fuzzy
    27002700#| msgctxt "of September"
     
    27122712
    27132713#. +> trunk
    2714 #: kcalendarsystemgregorian.cpp:224 kcalendarsystemgregorianproleptic.cpp:220
     2714#: kcalendarsystemgregorian.cpp:220 kcalendarsystemqdate.cpp:224
    27152715#, fuzzy
    27162716#| msgctxt "of October"
     
    27282728
    27292729#. +> trunk
    2730 #: kcalendarsystemgregorian.cpp:226 kcalendarsystemgregorianproleptic.cpp:222
     2730#: kcalendarsystemgregorian.cpp:222 kcalendarsystemqdate.cpp:226
    27312731#, fuzzy
    27322732#| msgctxt "of November"
     
    27442744
    27452745#. +> trunk
    2746 #: kcalendarsystemgregorian.cpp:228 kcalendarsystemgregorianproleptic.cpp:224
     2746#: kcalendarsystemgregorian.cpp:224 kcalendarsystemqdate.cpp:228
    27472747#, fuzzy
    27482748#| msgctxt "of December"
     
    27602760
    27612761#. +> trunk
    2762 #: kcalendarsystemgregorian.cpp:237 kcalendarsystemgregorianproleptic.cpp:233
     2762#: kcalendarsystemgregorian.cpp:233 kcalendarsystemqdate.cpp:237
    27632763#, fuzzy
    27642764msgctxt "Gregorian month 1 - KLocale::ShortName"
     
    27742774
    27752775#. +> trunk
    2776 #: kcalendarsystemgregorian.cpp:239 kcalendarsystemgregorianproleptic.cpp:235
     2776#: kcalendarsystemgregorian.cpp:235 kcalendarsystemqdate.cpp:239
    27772777#, fuzzy
    27782778msgctxt "Gregorian month 2 - KLocale::ShortName"
     
    27882788
    27892789#. +> trunk
    2790 #: kcalendarsystemgregorian.cpp:241 kcalendarsystemgregorianproleptic.cpp:237
     2790#: kcalendarsystemgregorian.cpp:237 kcalendarsystemqdate.cpp:241
    27912791#, fuzzy
    27922792msgctxt "Gregorian month 3 - KLocale::ShortName"
     
    28022802
    28032803#. +> trunk
    2804 #: kcalendarsystemgregorian.cpp:243 kcalendarsystemgregorianproleptic.cpp:239
     2804#: kcalendarsystemgregorian.cpp:239 kcalendarsystemqdate.cpp:243
    28052805#, fuzzy
    28062806msgctxt "Gregorian month 4 - KLocale::ShortName"
     
    28162816
    28172817#. +> trunk
    2818 #: kcalendarsystemgregorian.cpp:245 kcalendarsystemgregorianproleptic.cpp:241
     2818#: kcalendarsystemgregorian.cpp:241 kcalendarsystemqdate.cpp:245
    28192819#, fuzzy
    28202820msgctxt "Gregorian month 5 - KLocale::ShortName"
     
    28232823
    28242824#. +> trunk
    2825 #: kcalendarsystemgregorian.cpp:247 kcalendarsystemgregorianproleptic.cpp:243
     2825#: kcalendarsystemgregorian.cpp:243 kcalendarsystemqdate.cpp:247
    28262826#, fuzzy
    28272827msgctxt "Gregorian month 6 - KLocale::ShortName"
     
    28372837
    28382838#. +> trunk
    2839 #: kcalendarsystemgregorian.cpp:249 kcalendarsystemgregorianproleptic.cpp:245
     2839#: kcalendarsystemgregorian.cpp:245 kcalendarsystemqdate.cpp:249
    28402840#, fuzzy
    28412841msgctxt "Gregorian month 7 - KLocale::ShortName"
     
    28512851
    28522852#. +> trunk
    2853 #: kcalendarsystemgregorian.cpp:251 kcalendarsystemgregorianproleptic.cpp:247
     2853#: kcalendarsystemgregorian.cpp:247 kcalendarsystemqdate.cpp:251
    28542854#, fuzzy
    28552855msgctxt "Gregorian month 8 - KLocale::ShortName"
     
    28652865
    28662866#. +> trunk
    2867 #: kcalendarsystemgregorian.cpp:253 kcalendarsystemgregorianproleptic.cpp:249
     2867#: kcalendarsystemgregorian.cpp:249 kcalendarsystemqdate.cpp:253
    28682868#, fuzzy
    28692869msgctxt "Gregorian month 9 - KLocale::ShortName"
     
    28792879
    28802880#. +> trunk
    2881 #: kcalendarsystemgregorian.cpp:255 kcalendarsystemgregorianproleptic.cpp:251
     2881#: kcalendarsystemgregorian.cpp:251 kcalendarsystemqdate.cpp:255
    28822882#, fuzzy
    28832883msgctxt "Gregorian month 10 - KLocale::ShortName"
     
    28932893
    28942894#. +> trunk
    2895 #: kcalendarsystemgregorian.cpp:257 kcalendarsystemgregorianproleptic.cpp:253
     2895#: kcalendarsystemgregorian.cpp:253 kcalendarsystemqdate.cpp:257
    28962896#, fuzzy
    28972897msgctxt "Gregorian month 11 - KLocale::ShortName"
     
    29072907
    29082908#. +> trunk
    2909 #: kcalendarsystemgregorian.cpp:259 kcalendarsystemgregorianproleptic.cpp:255
     2909#: kcalendarsystemgregorian.cpp:255 kcalendarsystemqdate.cpp:259
    29102910#, fuzzy
    29112911msgctxt "Gregorian month 12 - KLocale::ShortName"
     
    29212921
    29222922#. +> trunk
    2923 #: kcalendarsystemgregorian.cpp:268 kcalendarsystemgregorianproleptic.cpp:264
     2923#: kcalendarsystemgregorian.cpp:264 kcalendarsystemqdate.cpp:268
    29242924#, fuzzy
    29252925#| msgid "of January"
     
    29352935
    29362936#. +> trunk
    2937 #: kcalendarsystemgregorian.cpp:270 kcalendarsystemgregorianproleptic.cpp:266
     2937#: kcalendarsystemgregorian.cpp:266 kcalendarsystemqdate.cpp:270
    29382938#, fuzzy
    29392939#| msgid "of February"
     
    29492949
    29502950#. +> trunk
    2951 #: kcalendarsystemgregorian.cpp:272 kcalendarsystemgregorianproleptic.cpp:268
     2951#: kcalendarsystemgregorian.cpp:268 kcalendarsystemqdate.cpp:272
    29522952#, fuzzy
    29532953#| msgid "of March"
     
    29632963
    29642964#. +> trunk
    2965 #: kcalendarsystemgregorian.cpp:274 kcalendarsystemgregorianproleptic.cpp:270
     2965#: kcalendarsystemgregorian.cpp:270 kcalendarsystemqdate.cpp:274
    29662966#, fuzzy
    29672967#| msgid "of April"
     
    29772977
    29782978#. +> trunk
    2979 #: kcalendarsystemgregorian.cpp:276 kcalendarsystemgregorianproleptic.cpp:272
     2979#: kcalendarsystemgregorian.cpp:272 kcalendarsystemqdate.cpp:276
    29802980#, fuzzy
    29812981#| msgctxt "of May short"
     
    30003000
    30013001#. +> trunk
    3002 #: kcalendarsystemgregorian.cpp:278 kcalendarsystemgregorianproleptic.cpp:274
     3002#: kcalendarsystemgregorian.cpp:274 kcalendarsystemqdate.cpp:278
    30033003#, fuzzy
    30043004#| msgid "of June"
     
    30143014
    30153015#. +> trunk
    3016 #: kcalendarsystemgregorian.cpp:280 kcalendarsystemgregorianproleptic.cpp:276
     3016#: kcalendarsystemgregorian.cpp:276 kcalendarsystemqdate.cpp:280
    30173017#, fuzzy
    30183018#| msgid "of July"
     
    30283028
    30293029#. +> trunk
    3030 #: kcalendarsystemgregorian.cpp:282 kcalendarsystemgregorianproleptic.cpp:278
     3030#: kcalendarsystemgregorian.cpp:278 kcalendarsystemqdate.cpp:282
    30313031#, fuzzy
    30323032#| msgid "of August"
     
    30423042
    30433043#. +> trunk
    3044 #: kcalendarsystemgregorian.cpp:284 kcalendarsystemgregorianproleptic.cpp:280
     3044#: kcalendarsystemgregorian.cpp:280 kcalendarsystemqdate.cpp:284
    30453045#, fuzzy
    30463046#| msgid "of September"
     
    30563056
    30573057#. +> trunk
    3058 #: kcalendarsystemgregorian.cpp:286 kcalendarsystemgregorianproleptic.cpp:282
     3058#: kcalendarsystemgregorian.cpp:282 kcalendarsystemqdate.cpp:286
    30593059#, fuzzy
    30603060#| msgid "of October"
     
    30703070
    30713071#. +> trunk
    3072 #: kcalendarsystemgregorian.cpp:288 kcalendarsystemgregorianproleptic.cpp:284
     3072#: kcalendarsystemgregorian.cpp:284 kcalendarsystemqdate.cpp:288
    30733073#, fuzzy
    30743074#| msgid "of November"
     
    30843084
    30853085#. +> trunk
    3086 #: kcalendarsystemgregorian.cpp:290 kcalendarsystemgregorianproleptic.cpp:286
     3086#: kcalendarsystemgregorian.cpp:286 kcalendarsystemqdate.cpp:290
    30873087#, fuzzy
    30883088#| msgid "of December"
     
    30983098
    30993099#. +> trunk
    3100 #: kcalendarsystemgregorian.cpp:299 kcalendarsystemgregorianproleptic.cpp:295
     3100#: kcalendarsystemgregorian.cpp:295 kcalendarsystemqdate.cpp:299
    31013101#, fuzzy
    31023102#| msgid "January"
     
    31123112
    31133113#. +> trunk
    3114 #: kcalendarsystemgregorian.cpp:301 kcalendarsystemgregorianproleptic.cpp:297
     3114#: kcalendarsystemgregorian.cpp:297 kcalendarsystemqdate.cpp:301
    31153115#, fuzzy
    31163116#| msgid "February"
     
    31263126
    31273127#. +> trunk
    3128 #: kcalendarsystemgregorian.cpp:303 kcalendarsystemgregorianproleptic.cpp:299
     3128#: kcalendarsystemgregorian.cpp:299 kcalendarsystemqdate.cpp:303
    31293129#, fuzzy
    31303130msgctxt "Gregorian month 3 - KLocale::LongName"
     
    31403140
    31413141#. +> trunk
    3142 #: kcalendarsystemgregorian.cpp:305 kcalendarsystemgregorianproleptic.cpp:301
     3142#: kcalendarsystemgregorian.cpp:301 kcalendarsystemqdate.cpp:305
    31433143#, fuzzy
    31443144#| msgid "April"
     
    31543154
    31553155#. +> trunk
    3156 #: kcalendarsystemgregorian.cpp:307 kcalendarsystemgregorianproleptic.cpp:303
     3156#: kcalendarsystemgregorian.cpp:303 kcalendarsystemqdate.cpp:307
    31573157#, fuzzy
    31583158msgctxt "Gregorian month 5 - KLocale::LongName"
     
    31753175
    31763176#. +> trunk
    3177 #: kcalendarsystemgregorian.cpp:309 kcalendarsystemgregorianproleptic.cpp:305
     3177#: kcalendarsystemgregorian.cpp:305 kcalendarsystemqdate.cpp:309
    31783178#, fuzzy
    31793179#| msgid "June"
     
    31893189
    31903190#. +> trunk
    3191 #: kcalendarsystemgregorian.cpp:311 kcalendarsystemgregorianproleptic.cpp:307
     3191#: kcalendarsystemgregorian.cpp:307 kcalendarsystemqdate.cpp:311
    31923192#, fuzzy
    31933193#| msgid "July"
     
    32033203
    32043204#. +> trunk
    3205 #: kcalendarsystemgregorian.cpp:313 kcalendarsystemgregorianproleptic.cpp:309
     3205#: kcalendarsystemgregorian.cpp:309 kcalendarsystemqdate.cpp:313
    32063206#, fuzzy
    32073207msgctxt "Gregorian month 8 - KLocale::LongName"
     
    32173217
    32183218#. +> trunk
    3219 #: kcalendarsystemgregorian.cpp:315 kcalendarsystemgregorianproleptic.cpp:311
     3219#: kcalendarsystemgregorian.cpp:311 kcalendarsystemqdate.cpp:315
    32203220#, fuzzy
    32213221#| msgid "September"
     
    32313231
    32323232#. +> trunk
    3233 #: kcalendarsystemgregorian.cpp:317 kcalendarsystemgregorianproleptic.cpp:313
     3233#: kcalendarsystemgregorian.cpp:313 kcalendarsystemqdate.cpp:317
    32343234#, fuzzy
    32353235#| msgid "October"
     
    32453245
    32463246#. +> trunk
    3247 #: kcalendarsystemgregorian.cpp:319 kcalendarsystemgregorianproleptic.cpp:315
     3247#: kcalendarsystemgregorian.cpp:315 kcalendarsystemqdate.cpp:319
    32483248#, fuzzy
    32493249#| msgid "November"
     
    32593259
    32603260#. +> trunk
    3261 #: kcalendarsystemgregorian.cpp:321 kcalendarsystemgregorianproleptic.cpp:317
     3261#: kcalendarsystemgregorian.cpp:317 kcalendarsystemqdate.cpp:321
    32623262#, fuzzy
    32633263#| msgid "December"
     
    32733273
    32743274#. +> trunk
    3275 #: kcalendarsystemgregorian.cpp:332 kcalendarsystemgregorianproleptic.cpp:328
    3276 #: kcalendarsystemhebrew.cpp:820
     3275#: kcalendarsystemgregorian.cpp:328 kcalendarsystemhebrew.cpp:820
     3276#: kcalendarsystemqdate.cpp:332
    32773277#, fuzzy
    32783278msgctxt "Gregorian weekday 1 - KLocale::NarrowName "
     
    32813281
    32823282#. +> trunk
    3283 #: kcalendarsystemgregorian.cpp:334 kcalendarsystemgregorianproleptic.cpp:330
    3284 #: kcalendarsystemhebrew.cpp:822
     3283#: kcalendarsystemgregorian.cpp:330 kcalendarsystemhebrew.cpp:822
     3284#: kcalendarsystemqdate.cpp:334
    32853285#, fuzzy
    32863286msgctxt "Gregorian weekday 2 - KLocale::NarrowName "
     
    32893289
    32903290#. +> trunk
    3291 #: kcalendarsystemgregorian.cpp:336 kcalendarsystemgregorianproleptic.cpp:332
    3292 #: kcalendarsystemhebrew.cpp:824
     3291#: kcalendarsystemgregorian.cpp:332 kcalendarsystemhebrew.cpp:824
     3292#: kcalendarsystemqdate.cpp:336
    32933293#, fuzzy
    32943294msgctxt "Gregorian weekday 3 - KLocale::NarrowName "
     
    32973297
    32983298#. +> trunk
    3299 #: kcalendarsystemgregorian.cpp:338 kcalendarsystemgregorianproleptic.cpp:334
    3300 #: kcalendarsystemhebrew.cpp:826
     3299#: kcalendarsystemgregorian.cpp:334 kcalendarsystemhebrew.cpp:826
     3300#: kcalendarsystemqdate.cpp:338
    33013301#, fuzzy
    33023302msgctxt "Gregorian weekday 4 - KLocale::NarrowName "
     
    33053305
    33063306#. +> trunk
    3307 #: kcalendarsystemgregorian.cpp:340 kcalendarsystemgregorianproleptic.cpp:336
    3308 #: kcalendarsystemhebrew.cpp:828
     3307#: kcalendarsystemgregorian.cpp:336 kcalendarsystemhebrew.cpp:828
     3308#: kcalendarsystemqdate.cpp:340
    33093309#, fuzzy
    33103310msgctxt "Gregorian weekday 5 - KLocale::NarrowName "
     
    33133313
    33143314#. +> trunk
    3315 #: kcalendarsystemgregorian.cpp:342 kcalendarsystemgregorianproleptic.cpp:338
    3316 #: kcalendarsystemhebrew.cpp:830
     3315#: kcalendarsystemgregorian.cpp:338 kcalendarsystemhebrew.cpp:830
     3316#: kcalendarsystemqdate.cpp:342
    33173317#, fuzzy
    33183318msgctxt "Gregorian weekday 6 - KLocale::NarrowName "
     
    33213321
    33223322#. +> trunk
    3323 #: kcalendarsystemgregorian.cpp:344 kcalendarsystemgregorianproleptic.cpp:340
    3324 #: kcalendarsystemhebrew.cpp:832
     3323#: kcalendarsystemgregorian.cpp:340 kcalendarsystemhebrew.cpp:832
     3324#: kcalendarsystemqdate.cpp:344
    33253325#, fuzzy
    33263326msgctxt "Gregorian weekday 7 - KLocale::NarrowName "
     
    33293329
    33303330#. +> trunk
    3331 #: kcalendarsystemgregorian.cpp:353 kcalendarsystemgregorianproleptic.cpp:349
    3332 #: kcalendarsystemhebrew.cpp:841
     3331#: kcalendarsystemgregorian.cpp:349 kcalendarsystemhebrew.cpp:841
     3332#: kcalendarsystemqdate.cpp:353
    33333333#, fuzzy
    33343334msgctxt "Gregorian weekday 1 - KLocale::ShortName"
     
    33443344
    33453345#. +> trunk
    3346 #: kcalendarsystemgregorian.cpp:355 kcalendarsystemgregorianproleptic.cpp:351
    3347 #: kcalendarsystemhebrew.cpp:843
     3346#: kcalendarsystemgregorian.cpp:351 kcalendarsystemhebrew.cpp:843
     3347#: kcalendarsystemqdate.cpp:355
    33483348#, fuzzy
    33493349msgctxt "Gregorian weekday 2 - KLocale::ShortName"
     
    33593359
    33603360#. +> trunk
    3361 #: kcalendarsystemgregorian.cpp:357 kcalendarsystemgregorianproleptic.cpp:353
    3362 #: kcalendarsystemhebrew.cpp:845
     3361#: kcalendarsystemgregorian.cpp:353 kcalendarsystemhebrew.cpp:845
     3362#: kcalendarsystemqdate.cpp:357
    33633363#, fuzzy
    33643364msgctxt "Gregorian weekday 3 - KLocale::ShortName"
     
    33743374
    33753375#. +> trunk
    3376 #: kcalendarsystemgregorian.cpp:359 kcalendarsystemgregorianproleptic.cpp:355
    3377 #: kcalendarsystemhebrew.cpp:847
     3376#: kcalendarsystemgregorian.cpp:355 kcalendarsystemhebrew.cpp:847
     3377#: kcalendarsystemqdate.cpp:359
    33783378#, fuzzy
    33793379msgctxt "Gregorian weekday 4 - KLocale::ShortName"
     
    33893389
    33903390#. +> trunk
    3391 #: kcalendarsystemgregorian.cpp:361 kcalendarsystemgregorianproleptic.cpp:357
    3392 #: kcalendarsystemhebrew.cpp:849
     3391#: kcalendarsystemgregorian.cpp:357 kcalendarsystemhebrew.cpp:849
     3392#: kcalendarsystemqdate.cpp:361
    33933393#, fuzzy
    33943394msgctxt "Gregorian weekday 5 - KLocale::ShortName"
     
    34043404
    34053405#. +> trunk
    3406 #: kcalendarsystemgregorian.cpp:363 kcalendarsystemgregorianproleptic.cpp:359
    3407 #: kcalendarsystemhebrew.cpp:851
     3406#: kcalendarsystemgregorian.cpp:359 kcalendarsystemhebrew.cpp:851
     3407#: kcalendarsystemqdate.cpp:363
    34083408#, fuzzy
    34093409msgctxt "Gregorian weekday 6 - KLocale::ShortName"
     
    34193419
    34203420#. +> trunk
    3421 #: kcalendarsystemgregorian.cpp:365 kcalendarsystemgregorianproleptic.cpp:361
    3422 #: kcalendarsystemhebrew.cpp:853
     3421#: kcalendarsystemgregorian.cpp:361 kcalendarsystemhebrew.cpp:853
     3422#: kcalendarsystemqdate.cpp:365
    34233423#, fuzzy
    34243424msgctxt "Gregorian weekday 7 - KLocale::ShortName"
     
    34343434
    34353435#. +> trunk
    3436 #: kcalendarsystemgregorian.cpp:372 kcalendarsystemgregorianproleptic.cpp:368
    3437 #: kcalendarsystemhebrew.cpp:860
     3436#: kcalendarsystemgregorian.cpp:368 kcalendarsystemhebrew.cpp:860
     3437#: kcalendarsystemqdate.cpp:372
    34383438#, fuzzy
    34393439#| msgid "Monday"
     
    34493449
    34503450#. +> trunk
    3451 #: kcalendarsystemgregorian.cpp:374 kcalendarsystemgregorianproleptic.cpp:370
    3452 #: kcalendarsystemhebrew.cpp:862
     3451#: kcalendarsystemgregorian.cpp:370 kcalendarsystemhebrew.cpp:862
     3452#: kcalendarsystemqdate.cpp:374
    34533453#, fuzzy
    34543454#| msgid "Tuesday"
     
    34643464
    34653465#. +> trunk
    3466 #: kcalendarsystemgregorian.cpp:376 kcalendarsystemgregorianproleptic.cpp:372
    3467 #: kcalendarsystemhebrew.cpp:864
     3466#: kcalendarsystemgregorian.cpp:372 kcalendarsystemhebrew.cpp:864
     3467#: kcalendarsystemqdate.cpp:376
    34683468#, fuzzy
    34693469#| msgid "Wednesday"
     
    34793479
    34803480#. +> trunk
    3481 #: kcalendarsystemgregorian.cpp:378 kcalendarsystemgregorianproleptic.cpp:374
    3482 #: kcalendarsystemhebrew.cpp:866
     3481#: kcalendarsystemgregorian.cpp:374 kcalendarsystemhebrew.cpp:866
     3482#: kcalendarsystemqdate.cpp:378
    34833483#, fuzzy
    34843484#| msgid "Thursday"
     
    34943494
    34953495#. +> trunk
    3496 #: kcalendarsystemgregorian.cpp:380 kcalendarsystemgregorianproleptic.cpp:376
    3497 #: kcalendarsystemhebrew.cpp:868
     3496#: kcalendarsystemgregorian.cpp:376 kcalendarsystemhebrew.cpp:868
     3497#: kcalendarsystemqdate.cpp:380
    34983498#, fuzzy
    34993499#| msgid "Friday"
     
    35093509
    35103510#. +> trunk
    3511 #: kcalendarsystemgregorian.cpp:382 kcalendarsystemgregorianproleptic.cpp:378
    3512 #: kcalendarsystemhebrew.cpp:870
     3511#: kcalendarsystemgregorian.cpp:378 kcalendarsystemhebrew.cpp:870
     3512#: kcalendarsystemqdate.cpp:382
    35133513#, fuzzy
    35143514#| msgid "Saturday"
     
    35243524
    35253525#. +> trunk
    3526 #: kcalendarsystemgregorian.cpp:384 kcalendarsystemgregorianproleptic.cpp:380
    3527 #: kcalendarsystemhebrew.cpp:872
     3526#: kcalendarsystemgregorian.cpp:380 kcalendarsystemhebrew.cpp:872
     3527#: kcalendarsystemqdate.cpp:384
    35283528#, fuzzy
    35293529#| msgid "Sunday"
     
    42424242
    42434243#. +> trunk stable
    4244 #: kcalendarsystemhijri.cpp:72
    4245 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, LongFormat"
    4246 msgid "Anno Hegirae"
    4247 msgstr "Anno Hegirae"
    4248 
    4249 #. +> trunk stable
    4250 #: kcalendarsystemhijri.cpp:73
    4251 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat"
    4252 msgid "AH"
    4253 msgstr "AH"
    4254 
    4255 #. +> trunk stable
    4256 #: kcalendarsystemhijri.cpp:74
    4257 #, c-format
    4258 msgctxt "(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH"
    4259 msgid "%Ey %EC"
    4260 msgstr "%Ey %EC"
    4261 
    4262 #. +> trunk
    4263 #: kcalendarsystemhijri.cpp:180
    4264 #, fuzzy
    4265 msgctxt "Hijri month 1 - KLocale::NarrowName"
    4266 msgid "M"
    4267 msgstr "AM"
    4268 
    4269 #. +> trunk
    4270 #: kcalendarsystemhijri.cpp:182
    4271 #, fuzzy
    4272 msgctxt "Hijri month 2 - KLocale::NarrowName"
    4273 msgid "S"
    4274 msgstr "S"
    4275 
    4276 #. +> trunk
    4277 #: kcalendarsystemhijri.cpp:184
    4278 #, fuzzy
    4279 msgctxt "Hijri month 3 - KLocale::NarrowName"
    4280 msgid "A"
    4281 msgstr "A"
    4282 
    4283 #. +> trunk
    4284 #: kcalendarsystemhijri.cpp:186
    4285 #, fuzzy
    4286 msgctxt "Hijri month 4 - KLocale::NarrowName"
    4287 msgid "T"
    4288 msgstr "TGA"
    4289 
    4290 #. +> trunk
    4291 #: kcalendarsystemhijri.cpp:188
    4292 #, fuzzy
    4293 msgctxt "Hijri month 5 - KLocale::NarrowName"
    4294 msgid "A"
    4295 msgstr "A"
    4296 
    4297 #. +> trunk
    4298 #: kcalendarsystemhijri.cpp:190
    4299 #, fuzzy
    4300 msgctxt "Hijri month 6 - KLocale::NarrowName"
    4301 msgid "T"
    4302 msgstr "TGA"
    4303 
    4304 #. +> trunk
    4305 #: kcalendarsystemhijri.cpp:192
    4306 #, fuzzy
    4307 msgctxt "Hijri month 7 - KLocale::NarrowName"
    4308 msgid "R"
    4309 msgstr "R"
    4310 
    4311 #. +> trunk
    4312 #: kcalendarsystemhijri.cpp:194
    4313 #, fuzzy
    4314 msgctxt "Hijri month 8 - KLocale::NarrowName"
    4315 msgid "S"
    4316 msgstr "S"
    4317 
    4318 #. +> trunk
    4319 #: kcalendarsystemhijri.cpp:196
    4320 #, fuzzy
    4321 msgctxt "Hijri month 9 - KLocale::NarrowName"
    4322 msgid "R"
    4323 msgstr "R"
    4324 
    4325 #. +> trunk
    4326 #: kcalendarsystemhijri.cpp:198
    4327 #, fuzzy
    4328 msgctxt "Hijri month 10 - KLocale::NarrowName"
    4329 msgid "S"
    4330 msgstr "S"
    4331 
    4332 #. +> trunk
    4333 #: kcalendarsystemhijri.cpp:200
    4334 #, fuzzy
    4335 msgctxt "Hijri month 11 - KLocale::NarrowName"
    4336 msgid "Q"
    4337 msgstr "Kv"
    4338 
    4339 #. +> trunk
    4340 #: kcalendarsystemhijri.cpp:202
    4341 #, fuzzy
    4342 msgctxt "Hijri month 12 - KLocale::NarrowName"
    4343 msgid "H"
    4344 msgstr "H:"
    4345 
    4346 #. +> trunk
    4347 #: kcalendarsystemhijri.cpp:211
    4348 #, fuzzy
    4349 #| msgctxt "of Mehr short"
    4350 #| msgid "of Meh"
    4351 msgctxt "Hijri month 1 - KLocale::ShortName Possessive"
    4352 msgid "of Muh"
    4353 msgstr "od Meh"
    4354 
    4355 #. +> trunk
    4356 #: kcalendarsystemhijri.cpp:213
    4357 #, fuzzy
    4358 #| msgid "of Safar"
    4359 msgctxt "Hijri month 2 - KLocale::ShortName Possessive"
    4360 msgid "of Saf"
    4361 msgstr "od Safara"
    4362 
    4363 #. +> trunk
    4364 #: kcalendarsystemhijri.cpp:215
    4365 #, fuzzy
    4366 #| msgid "of R. Awal"
    4367 msgctxt "Hijri month 3 - KLocale::ShortName Possessive"
    4368 msgid "of R.A"
    4369 msgstr "od R. Awala"
    4370 
    4371 #. +> trunk
    4372 #: kcalendarsystemhijri.cpp:217
    4373 #, fuzzy
    4374 #| msgid "of R. Thaani"
    4375 msgctxt "Hijri month 4 - KLocale::ShortName Possessive"
    4376 msgid "of R.T"
    4377 msgstr "od R. Thaania"
    4378 
    4379 #. +> trunk
    4380 #: kcalendarsystemhijri.cpp:219
    4381 #, fuzzy
    4382 #| msgid "of J. Awal"
    4383 msgctxt "Hijri month 5 - KLocale::ShortName Possessive"
    4384 msgid "of J.A"
    4385 msgstr "od J. Awala"
    4386 
    4387 #. +> trunk
    4388 #: kcalendarsystemhijri.cpp:221
    4389 #, fuzzy
    4390 #| msgid "of J. Thaani"
    4391 msgctxt "Hijri month 6 - KLocale::ShortName Possessive"
    4392 msgid "of J.T"
    4393 msgstr "od J. Thaania"
    4394 
    4395 #. +> trunk
    4396 #: kcalendarsystemhijri.cpp:223
    4397 #, fuzzy
    4398 #| msgid "of Rajab"
    4399 msgctxt "Hijri month 7 - KLocale::ShortName Possessive"
    4400 msgid "of Raj"
    4401 msgstr "od Rajaba"
    4402 
    4403 #. +> trunk
    4404 #: kcalendarsystemhijri.cpp:225
    4405 #, fuzzy
    4406 #| msgctxt "of Shahrivar short"
    4407 #| msgid "of Sha"
    4408 msgctxt "Hijri month 8 - KLocale::ShortName Possessive"
    4409 msgid "of Sha"
    4410 msgstr "od Sha"
    4411 
    4412 #. +> trunk
    4413 #: kcalendarsystemhijri.cpp:227
    4414 #, fuzzy
    4415 #| msgctxt "Coptic month 8 - ShortNamePossessive"
    4416 #| msgid "of Pam"
    4417 msgctxt "Hijri month 9 - KLocale::ShortName Possessive"
    4418 msgid "of Ram"
    4419 msgstr "od Pam"
    4420 
    4421 #. +> trunk
    4422 #: kcalendarsystemhijri.cpp:229
    4423 #, fuzzy
    4424 #| msgctxt "Indian National month 5 - ShortNamePossessive"
    4425 #| msgid "of Shr"
    4426 msgctxt "Hijri month 10 - KLocale::ShortName Possessive"
    4427 msgid "of Shw"
    4428 msgstr "od Shr"
    4429 
    4430 #. +> trunk
    4431 #: kcalendarsystemhijri.cpp:231
    4432 #, fuzzy
    4433 #| msgid "of Qi`dah"
    4434 msgctxt "Hijri month 11 - KLocale::ShortName Possessive"
    4435 msgid "of Qid"
    4436 msgstr "od Qi`daha"
    4437 
    4438 #. +> trunk
    4439 #: kcalendarsystemhijri.cpp:233
    4440 #, fuzzy
    4441 #| msgid "of Hijjah"
    4442 msgctxt "Hijri month 12 - KLocale::ShortName Possessive"
    4443 msgid "of Hij"
    4444 msgstr "od Hijjaha"
    4445 
    4446 #. +> trunk
    4447 #: kcalendarsystemhijri.cpp:242
    4448 #, fuzzy
    4449 #| msgctxt "City name (optional, probably does not need a translation)"
    4450 #| msgid "Muncy"
    4451 msgctxt "Hijri month 1 - KLocale::ShortName"
    4452 msgid "Muh"
    4453 msgstr "Muncy"
    4454 
    4455 #. +> trunk
    4456 #: kcalendarsystemhijri.cpp:244
    4457 #, fuzzy
    4458 #| msgid "Safar"
    4459 msgctxt "Hijri month 2 - KLocale::ShortName"
    4460 msgid "Saf"
    4461 msgstr "Safar"
    4462 
    4463 #. +> trunk
    4464 #: kcalendarsystemhijri.cpp:246
    4465 #, fuzzy
    4466 msgctxt "Hijri month 3 - KLocale::ShortName"
    4467 msgid "R.A"
    4468 msgstr "DU"
    4469 
    4470 #. +> trunk
    4471 #: kcalendarsystemhijri.cpp:248
    4472 #, fuzzy
    4473 msgctxt "Hijri month 4 - KLocale::ShortName"
    4474 msgid "R.T"
    4475 msgstr "RT"
    4476 
    4477 #. +> trunk
    4478 #: kcalendarsystemhijri.cpp:250
    4479 #, fuzzy
    4480 msgctxt "Hijri month 5 - KLocale::ShortName"
    4481 msgid "J.A"
    4482 msgstr "Mlađi"
    4483 
    4484 #. +> trunk
    4485 #: kcalendarsystemhijri.cpp:252
    4486 #, fuzzy
    4487 msgctxt "Hijri month 6 - KLocale::ShortName"
    4488 msgid "J.T"
    4489 msgstr "Mlađi"
    4490 
    4491 #. +> trunk
    4492 #: kcalendarsystemhijri.cpp:254
    4493 #, fuzzy
    4494 #| msgid "Rajab"
    4495 msgctxt "Hijri month 7 - KLocale::ShortName"
    4496 msgid "Raj"
    4497 msgstr "Rajab"
    4498 
    4499 #. +> trunk
    4500 #: kcalendarsystemhijri.cpp:256
    4501 #, fuzzy
    4502 #| msgctxt "Shahrivar short"
    4503 #| msgid "Sha"
    4504 msgctxt "Hijri month 8 - KLocale::ShortName"
    4505 msgid "Sha"
    4506 msgstr "Sha"
    4507 
    4508 #. +> trunk
    4509 #: kcalendarsystemhijri.cpp:258
    4510 #, fuzzy
    4511 msgctxt "Hijri month 9 - KLocale::ShortName"
    4512 msgid "Ram"
    4513 msgstr "Rampa"
    4514 
    4515 #. +> trunk
    4516 #: kcalendarsystemhijri.cpp:260
    4517 #, fuzzy
    4518 msgctxt "Hijri month 10 - KLocale::ShortName"
    4519 msgid "Shw"
    4520 msgstr "PrikaÅŸi"
    4521 
    4522 #. +> trunk
    4523 #: kcalendarsystemhijri.cpp:262
    4524 #, fuzzy
    4525 #| msgid "Qi`dah"
    4526 msgctxt "Hijri month 11 - KLocale::ShortName"
    4527 msgid "Qid"
    4528 msgstr "Qi`dah"
    4529 
    4530 #. +> trunk
    4531 #: kcalendarsystemhijri.cpp:264
    4532 #, fuzzy
    4533 #| msgctxt "@item Calendar system"
    4534 #| msgid "Hijri"
    4535 msgctxt "Hijri month 12 - KLocale::ShortName"
    4536 msgid "Hij"
    4537 msgstr "Hijri"
    4538 
    4539 #. +> trunk
    4540 #: kcalendarsystemhijri.cpp:273
    4541 #, fuzzy
    4542 #| msgid "of Muharram"
    4543 msgctxt "Hijri month 1 - KLocale::LongName Possessive"
    4544 msgid "of Muharram"
    4545 msgstr "od Muharrama"
    4546 
    4547 #. +> stable
    4548 #: kcalendarsystemhijri.cpp:335 kcalendarsystemhijri.cpp:366
    4549 msgid "of Muharram"
    4550 msgstr "od Muharrama"
    4551 
    4552 #. +> trunk
    4553 #: kcalendarsystemhijri.cpp:275
    4554 #, fuzzy
    4555 #| msgid "of Safar"
    4556 msgctxt "Hijri month 2 - KLocale::LongName Possessive"
    4557 msgid "of Safar"
    4558 msgstr "od Safara"
    4559 
    4560 #. +> stable
    4561 #: kcalendarsystemhijri.cpp:337 kcalendarsystemhijri.cpp:368
    4562 msgid "of Safar"
    4563 msgstr "od Safara"
    4564 
    4565 #. +> trunk
    4566 #: kcalendarsystemhijri.cpp:277
    4567 #, fuzzy
    4568 #| msgid "of Rabi` al-Awal"
    4569 msgctxt "Hijri month 3 - KLocale::LongName Possessive"
    4570 msgid "of Rabi` al-Awal"
    4571 msgstr "od Rabi` al-Awala"
    4572 
    4573 #. +> stable
    4574 #: kcalendarsystemhijri.cpp:370
    4575 msgid "of Rabi` al-Awal"
    4576 msgstr "od Rabi` al-Awala"
    4577 
    4578 #. +> trunk
    4579 #: kcalendarsystemhijri.cpp:279
    4580 #, fuzzy
    4581 #| msgid "of Rabi` al-Thaani"
    4582 msgctxt "Hijri month 4 - KLocale::LongName Possessive"
    4583 msgid "of Rabi` al-Thaani"
    4584 msgstr "od Rabi` al-Thaania"
    4585 
    4586 #. +> stable
    4587 #: kcalendarsystemhijri.cpp:372
    4588 msgid "of Rabi` al-Thaani"
    4589 msgstr "od Rabi` al-Thaania"
    4590 
    4591 #. +> trunk
    4592 #: kcalendarsystemhijri.cpp:281
    4593 #, fuzzy
    4594 #| msgid "of Jumaada al-Awal"
    4595 msgctxt "Hijri month 5 - KLocale::LongName Possessive"
    4596 msgid "of Jumaada al-Awal"
    4597 msgstr "od Jumaada al-Awala"
    4598 
    4599 #. +> stable
    4600 #: kcalendarsystemhijri.cpp:374
    4601 msgid "of Jumaada al-Awal"
    4602 msgstr "od Jumaada al-Awala"
    4603 
    4604 #. +> trunk
    4605 #: kcalendarsystemhijri.cpp:283
    4606 #, fuzzy
    4607 #| msgid "of Jumaada al-Thaani"
    4608 msgctxt "Hijri month 6 - KLocale::LongName Possessive"
    4609 msgid "of Jumaada al-Thaani"
    4610 msgstr "od Jumaada al-Thaania"
    4611 
    4612 #. +> stable
    4613 #: kcalendarsystemhijri.cpp:376
    4614 msgid "of Jumaada al-Thaani"
    4615 msgstr "od Jumaada al-Thaania"
    4616 
    4617 #. +> trunk
    4618 #: kcalendarsystemhijri.cpp:285
    4619 #, fuzzy
    4620 #| msgid "of Rajab"
    4621 msgctxt "Hijri month 7 - KLocale::LongName Possessive"
    4622 msgid "of Rajab"
    4623 msgstr "od Rajaba"
    4624 
    4625 #. +> stable
    4626 #: kcalendarsystemhijri.cpp:347 kcalendarsystemhijri.cpp:378
    4627 msgid "of Rajab"
    4628 msgstr "od Rajaba"
    4629 
    4630 #. +> trunk
    4631 #: kcalendarsystemhijri.cpp:287
    4632 #, fuzzy
    4633 #| msgid "of Sha`ban"
    4634 msgctxt "Hijri month 8 - KLocale::LongName Possessive"
    4635 msgid "of Sha`ban"
    4636 msgstr "od Sha`bana"
    4637 
    4638 #. +> stable
    4639 #: kcalendarsystemhijri.cpp:349 kcalendarsystemhijri.cpp:380
    4640 msgid "of Sha`ban"
    4641 msgstr "od Sha`bana"
    4642 
    4643 #. +> trunk
    4644 #: kcalendarsystemhijri.cpp:289
    4645 #, fuzzy
    4646 #| msgid "of Ramadan"
    4647 msgctxt "Hijri month 9 - KLocale::LongName Possessive"
    4648 msgid "of Ramadan"
    4649 msgstr "od Ramadana"
    4650 
    4651 #. +> stable
    4652 #: kcalendarsystemhijri.cpp:351 kcalendarsystemhijri.cpp:382
    4653 msgid "of Ramadan"
    4654 msgstr "od Ramadana"
    4655 
    4656 #. +> trunk
    4657 #: kcalendarsystemhijri.cpp:291
    4658 #, fuzzy
    4659 #| msgid "of Shawwal"
    4660 msgctxt "Hijri month 10 - KLocale::LongName Possessive"
    4661 msgid "of Shawwal"
    4662 msgstr "od Shawwala"
    4663 
    4664 #. +> stable
    4665 #: kcalendarsystemhijri.cpp:353 kcalendarsystemhijri.cpp:384
    4666 msgid "of Shawwal"
    4667 msgstr "od Shawwala"
    4668 
    4669 #. +> trunk
    4670 #: kcalendarsystemhijri.cpp:293
    4671 #, fuzzy
    4672 #| msgid "of Thu al-Qi`dah"
    4673 msgctxt "Hijri month 11 - KLocale::LongName Possessive"
    4674 msgid "of Thu al-Qi`dah"
    4675 msgstr "od Thu al-Qi`daha"
    4676 
    4677 #. +> stable
    4678 #: kcalendarsystemhijri.cpp:386
    4679 msgid "of Thu al-Qi`dah"
    4680 msgstr "od Thu al-Qi`daha"
    4681 
    4682 #. +> trunk
    4683 #: kcalendarsystemhijri.cpp:295
    4684 #, fuzzy
    4685 #| msgid "of Thu al-Hijjah"
    4686 msgctxt "Hijri month 12 - KLocale::LongName Possessive"
    4687 msgid "of Thu al-Hijjah"
    4688 msgstr "od Thu al-Hijjaha"
    4689 
    4690 #. +> stable
    4691 #: kcalendarsystemhijri.cpp:388
    4692 msgid "of Thu al-Hijjah"
    4693 msgstr "od Thu al-Hijjaha"
    4694 
    4695 #. +> trunk
    4696 #: kcalendarsystemhijri.cpp:304
    4697 #, fuzzy
    4698 #| msgid "Muharram"
    4699 msgctxt "Hijri month 1 - KLocale::LongName"
    4700 msgid "Muharram"
    4701 msgstr "Muharram"
    4702 
    4703 #. +> stable
    4704 #: kcalendarsystemhijri.cpp:397 kcalendarsystemhijri.cpp:428
    4705 msgid "Muharram"
    4706 msgstr "Muharram"
    4707 
    4708 #. +> trunk
    4709 #: kcalendarsystemhijri.cpp:306
    4710 #, fuzzy
    4711 #| msgid "Safar"
    4712 msgctxt "Hijri month 2 - KLocale::LongName"
    4713 msgid "Safar"
    4714 msgstr "Safar"
    4715 
    4716 #. +> stable
    4717 #: kcalendarsystemhijri.cpp:399 kcalendarsystemhijri.cpp:430
    4718 msgid "Safar"
    4719 msgstr "Safar"
    4720 
    4721 #. +> trunk
    4722 #: kcalendarsystemhijri.cpp:308
    4723 #, fuzzy
    4724 #| msgid "Rabi` al-Awal"
    4725 msgctxt "Hijri month 3 - KLocale::LongName"
    4726 msgid "Rabi` al-Awal"
    4727 msgstr "Rabi` al-Awal"
    4728 
    4729 #. +> stable
    4730 #: kcalendarsystemhijri.cpp:432
    4731 msgid "Rabi` al-Awal"
    4732 msgstr "Rabi` al-Awal"
    4733 
    4734 #. +> trunk
    4735 #: kcalendarsystemhijri.cpp:310
    4736 #, fuzzy
    4737 #| msgid "Rabi` al-Thaani"
    4738 msgctxt "Hijri month 4 - KLocale::LongName"
    4739 msgid "Rabi` al-Thaani"
    4740 msgstr "Rabi` al-Thaani"
    4741 
    4742 #. +> stable
    4743 #: kcalendarsystemhijri.cpp:434
    4744 msgid "Rabi` al-Thaani"
    4745 msgstr "Rabi` al-Thaani"
    4746 
    4747 #. +> trunk
    4748 #: kcalendarsystemhijri.cpp:312
    4749 #, fuzzy
    4750 #| msgid "Jumaada al-Awal"
    4751 msgctxt "Hijri month 5 - KLocale::LongName"
    4752 msgid "Jumaada al-Awal"
    4753 msgstr "Jumaada al-Awal"
    4754 
    4755 #. +> stable
    4756 #: kcalendarsystemhijri.cpp:436
    4757 msgid "Jumaada al-Awal"
    4758 msgstr "Jumaada al-Awal"
    4759 
    4760 #. +> trunk
    4761 #: kcalendarsystemhijri.cpp:314
    4762 #, fuzzy
    4763 #| msgid "Jumaada al-Thaani"
    4764 msgctxt "Hijri month 6 - KLocale::LongName"
    4765 msgid "Jumaada al-Thaani"
    4766 msgstr "Jumaada al-Thaani"
    4767 
    4768 #. +> stable
    4769 #: kcalendarsystemhijri.cpp:438
    4770 msgid "Jumaada al-Thaani"
    4771 msgstr "Jumaada al-Thaani"
    4772 
    4773 #. +> trunk
    4774 #: kcalendarsystemhijri.cpp:316
    4775 #, fuzzy
    4776 #| msgid "Rajab"
    4777 msgctxt "Hijri month 7 - KLocale::LongName"
    4778 msgid "Rajab"
    4779 msgstr "Rajab"
    4780 
    4781 #. +> stable
    4782 #: kcalendarsystemhijri.cpp:409 kcalendarsystemhijri.cpp:440
    4783 msgid "Rajab"
    4784 msgstr "Rajab"
    4785 
    4786 #. +> trunk
    4787 #: kcalendarsystemhijri.cpp:318
    4788 #, fuzzy
    4789 #| msgid "Sha`ban"
    4790 msgctxt "Hijri month 8 - KLocale::LongName"
    4791 msgid "Sha`ban"
    4792 msgstr "Sha`ban"
    4793 
    4794 #. +> stable
    4795 #: kcalendarsystemhijri.cpp:411 kcalendarsystemhijri.cpp:442
    4796 msgid "Sha`ban"
    4797 msgstr "Sha`ban"
    4798 
    4799 #. +> trunk
    4800 #: kcalendarsystemhijri.cpp:320
    4801 #, fuzzy
    4802 #| msgid "Ramadan"
    4803 msgctxt "Hijri month 9 - KLocale::LongName"
    4804 msgid "Ramadan"
    4805 msgstr "Ramadan"
    4806 
    4807 #. +> stable
    4808 #: kcalendarsystemhijri.cpp:413 kcalendarsystemhijri.cpp:444
    4809 msgid "Ramadan"
    4810 msgstr "Ramadan"
    4811 
    4812 #. +> trunk
    4813 #: kcalendarsystemhijri.cpp:322
    4814 #, fuzzy
    4815 #| msgid "Shawwal"
    4816 msgctxt "Hijri month 10 - KLocale::LongName"
    4817 msgid "Shawwal"
    4818 msgstr "Sha`ban"
    4819 
    4820 #. +> stable
    4821 #: kcalendarsystemhijri.cpp:415 kcalendarsystemhijri.cpp:446
    4822 msgid "Shawwal"
    4823 msgstr "Sha`ban"
    4824 
    4825 #. +> trunk
    4826 #: kcalendarsystemhijri.cpp:324
    4827 #, fuzzy
    4828 #| msgid "Thu al-Qi`dah"
    4829 msgctxt "Hijri month 11 - KLocale::LongName"
    4830 msgid "Thu al-Qi`dah"
    4831 msgstr "Thu al-Qi`dah"
    4832 
    4833 #. +> stable
    4834 #: kcalendarsystemhijri.cpp:448
    4835 msgid "Thu al-Qi`dah"
    4836 msgstr "Thu al-Qi`dah"
    4837 
    4838 #. +> trunk
    4839 #: kcalendarsystemhijri.cpp:326
    4840 #, fuzzy
    4841 #| msgid "Thu al-Hijjah"
    4842 msgctxt "Hijri month 12 - KLocale::LongName"
    4843 msgid "Thu al-Hijjah"
    4844 msgstr "Thu al-Hijjah"
    4845 
    4846 #. +> stable
    4847 #: kcalendarsystemhijri.cpp:450
    4848 msgid "Thu al-Hijjah"
    4849 msgstr "Thu al-Hijjah"
    4850 
    4851 #. +> trunk
    4852 #: kcalendarsystemhijri.cpp:337
    4853 #, fuzzy
    4854 msgctxt "Hijri weekday 1 - KLocale::NarrowName "
    4855 msgid "I"
    4856 msgstr "I"
    4857 
    4858 #. +> trunk
    4859 #: kcalendarsystemhijri.cpp:339
    4860 #, fuzzy
    4861 msgctxt "Hijri weekday 2 - KLocale::NarrowName "
    4862 msgid "T"
    4863 msgstr "TGA"
    4864 
    4865 #. +> stable
    4866 #: kcalendarsystemhijri.cpp:339
    4867 msgid "of R. Awal"
    4868 msgstr "od R. Awala"
    4869 
    4870 #. +> trunk
    4871 #: kcalendarsystemhijri.cpp:341
    4872 #, fuzzy
    4873 msgctxt "Hijri weekday 3 - KLocale::NarrowName "
    4874 msgid "A"
    4875 msgstr "A"
    4876 
    4877 #. +> stable
    4878 #: kcalendarsystemhijri.cpp:341
    4879 msgid "of R. Thaani"
    4880 msgstr "od R. Thaania"
    4881 
    4882 #. +> trunk
    4883 #: kcalendarsystemhijri.cpp:343
    4884 #, fuzzy
    4885 msgctxt "Hijri weekday 4 - KLocale::NarrowName "
    4886 msgid "K"
    4887 msgstr "K"
    4888 
    4889 #. +> stable
    4890 #: kcalendarsystemhijri.cpp:343
    4891 msgid "of J. Awal"
    4892 msgstr "od J. Awala"
    4893 
    4894 #. +> trunk
    4895 #: kcalendarsystemhijri.cpp:345
    4896 #, fuzzy
    4897 msgctxt "Hijri weekday 5 - KLocale::NarrowName "
    4898 msgid "J"
    4899 msgstr "J"
    4900 
    4901 #. +> stable
    4902 #: kcalendarsystemhijri.cpp:345
    4903 msgid "of J. Thaani"
    4904 msgstr "od J. Thaania"
    4905 
    4906 #. +> trunk
    4907 #: kcalendarsystemhijri.cpp:347
    4908 #, fuzzy
    4909 msgctxt "Hijri weekday 6 - KLocale::NarrowName "
    4910 msgid "S"
    4911 msgstr "S"
    4912 
    4913 #. +> trunk
    4914 #: kcalendarsystemhijri.cpp:349
    4915 #, fuzzy
    4916 msgctxt "Hijri weekday 7 - KLocale::NarrowName "
    4917 msgid "A"
    4918 msgstr "A"
    4919 
    4920 #. +> stable
    4921 #: kcalendarsystemhijri.cpp:355
    4922 msgid "of Qi`dah"
    4923 msgstr "od Qi`daha"
    4924 
    4925 #. +> stable
    4926 #: kcalendarsystemhijri.cpp:357
    4927 msgid "of Hijjah"
    4928 msgstr "od Hijjaha"
    4929 
    4930 #. +> trunk
    4931 #: kcalendarsystemhijri.cpp:358
    4932 #, fuzzy
    4933 #| msgid "Ith"
    4934 msgctxt "Hijri weekday 1 - KLocale::ShortName"
    4935 msgid "Ith"
    4936 msgstr "Ith"
    4937 
    4938 #. +> stable
    4939 #: kcalendarsystemhijri.cpp:466
    4940 msgid "Ith"
    4941 msgstr "Ith"
    4942 
    4943 #. +> trunk
    4944 #: kcalendarsystemhijri.cpp:360
    4945 #, fuzzy
    4946 #| msgid "Thl"
    4947 msgctxt "Hijri weekday 2 - KLocale::ShortName"
    4948 msgid "Thl"
    4949 msgstr "Thl"
    4950 
    4951 #. +> stable
    4952 #: kcalendarsystemhijri.cpp:468
    4953 msgid "Thl"
    4954 msgstr "Thl"
    4955 
    4956 #. +> trunk
    4957 #: kcalendarsystemhijri.cpp:362
    4958 #, fuzzy
    4959 #| msgid "Arb"
    4960 msgctxt "Hijri weekday 3 - KLocale::ShortName"
    4961 msgid "Arb"
    4962 msgstr "Arb"
    4963 
    4964 #. +> stable
    4965 #: kcalendarsystemhijri.cpp:470
    4966 msgid "Arb"
    4967 msgstr "Arb"
    4968 
    4969 #. +> trunk
    4970 #: kcalendarsystemhijri.cpp:364
    4971 #, fuzzy
    4972 #| msgid "Kha"
    4973 msgctxt "Hijri weekday 4 - KLocale::ShortName"
    4974 msgid "Kha"
    4975 msgstr "Kha"
    4976 
    4977 #. +> stable
    4978 #: kcalendarsystemhijri.cpp:472
    4979 msgid "Kha"
    4980 msgstr "Kha"
    4981 
    4982 #. +> trunk
    4983 #: kcalendarsystemhijri.cpp:366
    4984 #, fuzzy
    4985 #| msgid "Jum"
    4986 msgctxt "Hijri weekday 5 - KLocale::ShortName"
    4987 msgid "Jum"
    4988 msgstr "Jum"
    4989 
    4990 #. +> stable
    4991 #: kcalendarsystemhijri.cpp:474
    4992 msgid "Jum"
    4993 msgstr "Jum"
    4994 
    4995 #. +> trunk
    4996 #: kcalendarsystemhijri.cpp:368
    4997 #, fuzzy
    4998 #| msgid "Sab"
    4999 msgctxt "Hijri weekday 6 - KLocale::ShortName"
    5000 msgid "Sab"
    5001 msgstr "Sab"
    5002 
    5003 #. +> stable
    5004 #: kcalendarsystemhijri.cpp:476
    5005 msgid "Sab"
    5006 msgstr "Sab"
    5007 
    5008 #. +> trunk
    5009 #: kcalendarsystemhijri.cpp:370
    5010 #, fuzzy
    5011 #| msgid "Ahd"
    5012 msgctxt "Hijri weekday 7 - KLocale::ShortName"
    5013 msgid "Ahd"
    5014 msgstr "Ahd"
    5015 
    5016 #. +> stable
    5017 #: kcalendarsystemhijri.cpp:478
    5018 msgid "Ahd"
    5019 msgstr "Ahd"
    5020 
    5021 #. +> trunk
    5022 #: kcalendarsystemhijri.cpp:377
    5023 #, fuzzy
    5024 #| msgid "Yaum al-Ithnain"
    5025 msgctxt "Hijri weekday 1 - KLocale::LongName"
    5026 msgid "Yaum al-Ithnain"
    5027 msgstr "Yaum al-Ithnain"
    5028 
    5029 #. +> stable
    5030 #: kcalendarsystemhijri.cpp:487
    5031 msgid "Yaum al-Ithnain"
    5032 msgstr "Yaum al-Ithnain"
    5033 
    5034 #. +> trunk
    5035 #: kcalendarsystemhijri.cpp:379
    5036 #, fuzzy
    5037 #| msgid "Yau al-Thulatha"
    5038 msgctxt "Hijri weekday 2 - KLocale::LongName"
    5039 msgid "Yau al-Thulatha"
    5040 msgstr "Yau al-Thulatha"
    5041 
    5042 #. +> stable
    5043 #: kcalendarsystemhijri.cpp:489
    5044 msgid "Yau al-Thulatha"
    5045 msgstr "Yau al-Thulatha"
    5046 
    5047 #. +> trunk
    5048 #: kcalendarsystemhijri.cpp:381
    5049 #, fuzzy
    5050 #| msgid "Yaum al-Arbi'a"
    5051 msgctxt "Hijri weekday 3 - KLocale::LongName"
    5052 msgid "Yaum al-Arbi'a"
    5053 msgstr "Yaum al-Arbi'a"
    5054 
    5055 #. +> stable
    5056 #: kcalendarsystemhijri.cpp:491
    5057 msgid "Yaum al-Arbi'a"
    5058 msgstr "Yaum al-Arbi'a"
    5059 
    5060 #. +> trunk
    5061 #: kcalendarsystemhijri.cpp:383
    5062 #, fuzzy
    5063 #| msgid "Yaum al-Khamees"
    5064 msgctxt "Hijri weekday 4 - KLocale::LongName"
    5065 msgid "Yaum al-Khamees"
    5066 msgstr "Yaum al-Khamees"
    5067 
    5068 #. +> stable
    5069 #: kcalendarsystemhijri.cpp:493
    5070 msgid "Yaum al-Khamees"
    5071 msgstr "Yaum al-Khamees"
    5072 
    5073 #. +> trunk
    5074 #: kcalendarsystemhijri.cpp:385
    5075 #, fuzzy
    5076 #| msgid "Yaum al-Jumma"
    5077 msgctxt "Hijri weekday 5 - KLocale::LongName"
    5078 msgid "Yaum al-Jumma"
    5079 msgstr "Yaum al-Jumma"
    5080 
    5081 #. +> stable
    5082 #: kcalendarsystemhijri.cpp:495
    5083 msgid "Yaum al-Jumma"
    5084 msgstr "Yaum al-Jumma"
    5085 
    5086 #. +> trunk
    5087 #: kcalendarsystemhijri.cpp:387
    5088 #, fuzzy
    5089 #| msgid "Yaum al-Sabt"
    5090 msgctxt "Hijri weekday 6 - KLocale::LongName"
    5091 msgid "Yaum al-Sabt"
    5092 msgstr "Yaum al-Sabt"
    5093 
    5094 #. +> stable
    5095 #: kcalendarsystemhijri.cpp:497
    5096 msgid "Yaum al-Sabt"
    5097 msgstr "Yaum al-Sabt"
    5098 
    5099 #. +> trunk
    5100 #: kcalendarsystemhijri.cpp:389
    5101 #, fuzzy
    5102 #| msgid "Yaum al-Ahad"
    5103 msgctxt "Hijri weekday 7 - KLocale::LongName"
    5104 msgid "Yaum al-Ahad"
    5105 msgstr "Yaum al-Ahad"
    5106 
    5107 #. +> stable
    5108 #: kcalendarsystemhijri.cpp:401
    5109 msgid "R. Awal"
    5110 msgstr "R. Awal"
    5111 
    5112 #. +> stable
    5113 #: kcalendarsystemhijri.cpp:403
    5114 msgid "R. Thaani"
    5115 msgstr "R. Thaani"
    5116 
    5117 #. +> stable
    5118 #: kcalendarsystemhijri.cpp:405
    5119 msgid "J. Awal"
    5120 msgstr "J. Awal"
    5121 
    5122 #. +> stable
    5123 #: kcalendarsystemhijri.cpp:407
    5124 msgid "J. Thaani"
    5125 msgstr "J. Thaani"
    5126 
    5127 #. +> stable
    5128 #: kcalendarsystemhijri.cpp:417
    5129 msgid "Qi`dah"
    5130 msgstr "Qi`dah"
    5131 
    5132 #. +> stable
    5133 #: kcalendarsystemhijri.cpp:419
    5134 msgid "Hijjah"
    5135 msgstr "Hijjah"
    5136 
    5137 #. +> stable
    5138 #: kcalendarsystemhijri.cpp:499
    5139 msgid "Yaum al-Ahad"
    5140 msgstr "Yaum al-Ahad"
    5141 
    5142 #. +> trunk stable
    51434244#: kcalendarsystemindiannational.cpp:74
    51444245msgctxt "Calendar Era: Indian National Saka Era, years > 0, LongFormat"
     
    62275328
    62285329#. +> trunk stable
     5330#: kcalendarsystemislamiccivil.cpp:72
     5331msgctxt "Calendar Era: Hijri Islamic Era, years > 0, LongFormat"
     5332msgid "Anno Hegirae"
     5333msgstr "Anno Hegirae"
     5334
     5335#. +> trunk stable
     5336#: kcalendarsystemislamiccivil.cpp:73
     5337msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat"
     5338msgid "AH"
     5339msgstr "AH"
     5340
     5341#. +> trunk stable
     5342#: kcalendarsystemislamiccivil.cpp:74
     5343#, c-format
     5344msgctxt "(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH"
     5345msgid "%Ey %EC"
     5346msgstr "%Ey %EC"
     5347
     5348#. +> trunk
     5349#: kcalendarsystemislamiccivil.cpp:180
     5350#, fuzzy
     5351msgctxt "Hijri month 1 - KLocale::NarrowName"
     5352msgid "M"
     5353msgstr "AM"
     5354
     5355#. +> trunk
     5356#: kcalendarsystemislamiccivil.cpp:182
     5357#, fuzzy
     5358msgctxt "Hijri month 2 - KLocale::NarrowName"
     5359msgid "S"
     5360msgstr "S"
     5361
     5362#. +> trunk
     5363#: kcalendarsystemislamiccivil.cpp:184
     5364#, fuzzy
     5365msgctxt "Hijri month 3 - KLocale::NarrowName"
     5366msgid "A"
     5367msgstr "A"
     5368
     5369#. +> trunk
     5370#: kcalendarsystemislamiccivil.cpp:186
     5371#, fuzzy
     5372msgctxt "Hijri month 4 - KLocale::NarrowName"
     5373msgid "T"
     5374msgstr "TGA"
     5375
     5376#. +> trunk
     5377#: kcalendarsystemislamiccivil.cpp:188
     5378#, fuzzy
     5379msgctxt "Hijri month 5 - KLocale::NarrowName"
     5380msgid "A"
     5381msgstr "A"
     5382
     5383#. +> trunk
     5384#: kcalendarsystemislamiccivil.cpp:190
     5385#, fuzzy
     5386msgctxt "Hijri month 6 - KLocale::NarrowName"
     5387msgid "T"
     5388msgstr "TGA"
     5389
     5390#. +> trunk
     5391#: kcalendarsystemislamiccivil.cpp:192
     5392#, fuzzy
     5393msgctxt "Hijri month 7 - KLocale::NarrowName"
     5394msgid "R"
     5395msgstr "R"
     5396
     5397#. +> trunk
     5398#: kcalendarsystemislamiccivil.cpp:194
     5399#, fuzzy
     5400msgctxt "Hijri month 8 - KLocale::NarrowName"
     5401msgid "S"
     5402msgstr "S"
     5403
     5404#. +> trunk
     5405#: kcalendarsystemislamiccivil.cpp:196
     5406#, fuzzy
     5407msgctxt "Hijri month 9 - KLocale::NarrowName"
     5408msgid "R"
     5409msgstr "R"
     5410
     5411#. +> trunk
     5412#: kcalendarsystemislamiccivil.cpp:198
     5413#, fuzzy
     5414msgctxt "Hijri month 10 - KLocale::NarrowName"
     5415msgid "S"
     5416msgstr "S"
     5417
     5418#. +> trunk
     5419#: kcalendarsystemislamiccivil.cpp:200
     5420#, fuzzy
     5421msgctxt "Hijri month 11 - KLocale::NarrowName"
     5422msgid "Q"
     5423msgstr "Kv"
     5424
     5425#. +> trunk
     5426#: kcalendarsystemislamiccivil.cpp:202
     5427#, fuzzy
     5428msgctxt "Hijri month 12 - KLocale::NarrowName"
     5429msgid "H"
     5430msgstr "H:"
     5431
     5432#. +> trunk
     5433#: kcalendarsystemislamiccivil.cpp:211
     5434#, fuzzy
     5435#| msgctxt "of Mehr short"
     5436#| msgid "of Meh"
     5437msgctxt "Hijri month 1 - KLocale::ShortName Possessive"
     5438msgid "of Muh"
     5439msgstr "od Meh"
     5440
     5441#. +> trunk
     5442#: kcalendarsystemislamiccivil.cpp:213
     5443#, fuzzy
     5444#| msgid "of Safar"
     5445msgctxt "Hijri month 2 - KLocale::ShortName Possessive"
     5446msgid "of Saf"
     5447msgstr "od Safara"
     5448
     5449#. +> trunk
     5450#: kcalendarsystemislamiccivil.cpp:215
     5451#, fuzzy
     5452#| msgid "of R. Awal"
     5453msgctxt "Hijri month 3 - KLocale::ShortName Possessive"
     5454msgid "of R.A"
     5455msgstr "od R. Awala"
     5456
     5457#. +> trunk
     5458#: kcalendarsystemislamiccivil.cpp:217
     5459#, fuzzy
     5460#| msgid "of R. Thaani"
     5461msgctxt "Hijri month 4 - KLocale::ShortName Possessive"
     5462msgid "of R.T"
     5463msgstr "od R. Thaania"
     5464
     5465#. +> trunk
     5466#: kcalendarsystemislamiccivil.cpp:219
     5467#, fuzzy
     5468#| msgid "of J. Awal"
     5469msgctxt "Hijri month 5 - KLocale::ShortName Possessive"
     5470msgid "of J.A"
     5471msgstr "od J. Awala"
     5472
     5473#. +> trunk
     5474#: kcalendarsystemislamiccivil.cpp:221
     5475#, fuzzy
     5476#| msgid "of J. Thaani"
     5477msgctxt "Hijri month 6 - KLocale::ShortName Possessive"
     5478msgid "of J.T"
     5479msgstr "od J. Thaania"
     5480
     5481#. +> trunk
     5482#: kcalendarsystemislamiccivil.cpp:223
     5483#, fuzzy
     5484#| msgid "of Rajab"
     5485msgctxt "Hijri month 7 - KLocale::ShortName Possessive"
     5486msgid "of Raj"
     5487msgstr "od Rajaba"
     5488
     5489#. +> trunk
     5490#: kcalendarsystemislamiccivil.cpp:225
     5491#, fuzzy
     5492#| msgctxt "of Shahrivar short"
     5493#| msgid "of Sha"
     5494msgctxt "Hijri month 8 - KLocale::ShortName Possessive"
     5495msgid "of Sha"
     5496msgstr "od Sha"
     5497
     5498#. +> trunk
     5499#: kcalendarsystemislamiccivil.cpp:227
     5500#, fuzzy
     5501#| msgctxt "Coptic month 8 - ShortNamePossessive"
     5502#| msgid "of Pam"
     5503msgctxt "Hijri month 9 - KLocale::ShortName Possessive"
     5504msgid "of Ram"
     5505msgstr "od Pam"
     5506
     5507#. +> trunk
     5508#: kcalendarsystemislamiccivil.cpp:229
     5509#, fuzzy
     5510#| msgctxt "Indian National month 5 - ShortNamePossessive"
     5511#| msgid "of Shr"
     5512msgctxt "Hijri month 10 - KLocale::ShortName Possessive"
     5513msgid "of Shw"
     5514msgstr "od Shr"
     5515
     5516#. +> trunk
     5517#: kcalendarsystemislamiccivil.cpp:231
     5518#, fuzzy
     5519#| msgid "of Qi`dah"
     5520msgctxt "Hijri month 11 - KLocale::ShortName Possessive"
     5521msgid "of Qid"
     5522msgstr "od Qi`daha"
     5523
     5524#. +> trunk
     5525#: kcalendarsystemislamiccivil.cpp:233
     5526#, fuzzy
     5527#| msgid "of Hijjah"
     5528msgctxt "Hijri month 12 - KLocale::ShortName Possessive"
     5529msgid "of Hij"
     5530msgstr "od Hijjaha"
     5531
     5532#. +> trunk
     5533#: kcalendarsystemislamiccivil.cpp:242
     5534#, fuzzy
     5535#| msgctxt "City name (optional, probably does not need a translation)"
     5536#| msgid "Muncy"
     5537msgctxt "Hijri month 1 - KLocale::ShortName"
     5538msgid "Muh"
     5539msgstr "Muncy"
     5540
     5541#. +> trunk
     5542#: kcalendarsystemislamiccivil.cpp:244
     5543#, fuzzy
     5544#| msgid "Safar"
     5545msgctxt "Hijri month 2 - KLocale::ShortName"
     5546msgid "Saf"
     5547msgstr "Safar"
     5548
     5549#. +> trunk
     5550#: kcalendarsystemislamiccivil.cpp:246
     5551#, fuzzy
     5552msgctxt "Hijri month 3 - KLocale::ShortName"
     5553msgid "R.A"
     5554msgstr "DU"
     5555
     5556#. +> trunk
     5557#: kcalendarsystemislamiccivil.cpp:248
     5558#, fuzzy
     5559msgctxt "Hijri month 4 - KLocale::ShortName"
     5560msgid "R.T"
     5561msgstr "RT"
     5562
     5563#. +> trunk
     5564#: kcalendarsystemislamiccivil.cpp:250
     5565#, fuzzy
     5566msgctxt "Hijri month 5 - KLocale::ShortName"
     5567msgid "J.A"
     5568msgstr "Mlađi"
     5569
     5570#. +> trunk
     5571#: kcalendarsystemislamiccivil.cpp:252
     5572#, fuzzy
     5573msgctxt "Hijri month 6 - KLocale::ShortName"
     5574msgid "J.T"
     5575msgstr "Mlađi"
     5576
     5577#. +> trunk
     5578#: kcalendarsystemislamiccivil.cpp:254
     5579#, fuzzy
     5580#| msgid "Rajab"
     5581msgctxt "Hijri month 7 - KLocale::ShortName"
     5582msgid "Raj"
     5583msgstr "Rajab"
     5584
     5585#. +> trunk
     5586#: kcalendarsystemislamiccivil.cpp:256
     5587#, fuzzy
     5588#| msgctxt "Shahrivar short"
     5589#| msgid "Sha"
     5590msgctxt "Hijri month 8 - KLocale::ShortName"
     5591msgid "Sha"
     5592msgstr "Sha"
     5593
     5594#. +> trunk
     5595#: kcalendarsystemislamiccivil.cpp:258
     5596#, fuzzy
     5597msgctxt "Hijri month 9 - KLocale::ShortName"
     5598msgid "Ram"
     5599msgstr "Rampa"
     5600
     5601#. +> trunk
     5602#: kcalendarsystemislamiccivil.cpp:260
     5603#, fuzzy
     5604msgctxt "Hijri month 10 - KLocale::ShortName"
     5605msgid "Shw"
     5606msgstr "PrikaÅŸi"
     5607
     5608#. +> trunk
     5609#: kcalendarsystemislamiccivil.cpp:262
     5610#, fuzzy
     5611#| msgid "Qi`dah"
     5612msgctxt "Hijri month 11 - KLocale::ShortName"
     5613msgid "Qid"
     5614msgstr "Qi`dah"
     5615
     5616#. +> trunk
     5617#: kcalendarsystemislamiccivil.cpp:264
     5618#, fuzzy
     5619#| msgctxt "@item Calendar system"
     5620#| msgid "Hijri"
     5621msgctxt "Hijri month 12 - KLocale::ShortName"
     5622msgid "Hij"
     5623msgstr "Hijri"
     5624
     5625#. +> trunk
     5626#: kcalendarsystemislamiccivil.cpp:273
     5627#, fuzzy
     5628#| msgid "of Muharram"
     5629msgctxt "Hijri month 1 - KLocale::LongName Possessive"
     5630msgid "of Muharram"
     5631msgstr "od Muharrama"
     5632
     5633#. +> stable
     5634#: kcalendarsystemhijri.cpp:335 kcalendarsystemhijri.cpp:366
     5635msgid "of Muharram"
     5636msgstr "od Muharrama"
     5637
     5638#. +> trunk
     5639#: kcalendarsystemislamiccivil.cpp:275
     5640#, fuzzy
     5641#| msgid "of Safar"
     5642msgctxt "Hijri month 2 - KLocale::LongName Possessive"
     5643msgid "of Safar"
     5644msgstr "od Safara"
     5645
     5646#. +> stable
     5647#: kcalendarsystemhijri.cpp:337 kcalendarsystemhijri.cpp:368
     5648msgid "of Safar"
     5649msgstr "od Safara"
     5650
     5651#. +> trunk
     5652#: kcalendarsystemislamiccivil.cpp:277
     5653#, fuzzy
     5654#| msgid "of Rabi` al-Awal"
     5655msgctxt "Hijri month 3 - KLocale::LongName Possessive"
     5656msgid "of Rabi` al-Awal"
     5657msgstr "od Rabi` al-Awala"
     5658
     5659#. +> stable
     5660#: kcalendarsystemhijri.cpp:370
     5661msgid "of Rabi` al-Awal"
     5662msgstr "od Rabi` al-Awala"
     5663
     5664#. +> trunk
     5665#: kcalendarsystemislamiccivil.cpp:279
     5666#, fuzzy
     5667#| msgid "of Rabi` al-Thaani"
     5668msgctxt "Hijri month 4 - KLocale::LongName Possessive"
     5669msgid "of Rabi` al-Thaani"
     5670msgstr "od Rabi` al-Thaania"
     5671
     5672#. +> stable
     5673#: kcalendarsystemhijri.cpp:372
     5674msgid "of Rabi` al-Thaani"
     5675msgstr "od Rabi` al-Thaania"
     5676
     5677#. +> trunk
     5678#: kcalendarsystemislamiccivil.cpp:281
     5679#, fuzzy
     5680#| msgid "of Jumaada al-Awal"
     5681msgctxt "Hijri month 5 - KLocale::LongName Possessive"
     5682msgid "of Jumaada al-Awal"
     5683msgstr "od Jumaada al-Awala"
     5684
     5685#. +> stable
     5686#: kcalendarsystemhijri.cpp:374
     5687msgid "of Jumaada al-Awal"
     5688msgstr "od Jumaada al-Awala"
     5689
     5690#. +> trunk
     5691#: kcalendarsystemislamiccivil.cpp:283
     5692#, fuzzy
     5693#| msgid "of Jumaada al-Thaani"
     5694msgctxt "Hijri month 6 - KLocale::LongName Possessive"
     5695msgid "of Jumaada al-Thaani"
     5696msgstr "od Jumaada al-Thaania"
     5697
     5698#. +> stable
     5699#: kcalendarsystemhijri.cpp:376
     5700msgid "of Jumaada al-Thaani"
     5701msgstr "od Jumaada al-Thaania"
     5702
     5703#. +> trunk
     5704#: kcalendarsystemislamiccivil.cpp:285
     5705#, fuzzy
     5706#| msgid "of Rajab"
     5707msgctxt "Hijri month 7 - KLocale::LongName Possessive"
     5708msgid "of Rajab"
     5709msgstr "od Rajaba"
     5710
     5711#. +> stable
     5712#: kcalendarsystemhijri.cpp:347 kcalendarsystemhijri.cpp:378
     5713msgid "of Rajab"
     5714msgstr "od Rajaba"
     5715
     5716#. +> trunk
     5717#: kcalendarsystemislamiccivil.cpp:287
     5718#, fuzzy
     5719#| msgid "of Sha`ban"
     5720msgctxt "Hijri month 8 - KLocale::LongName Possessive"
     5721msgid "of Sha`ban"
     5722msgstr "od Sha`bana"
     5723
     5724#. +> stable
     5725#: kcalendarsystemhijri.cpp:349 kcalendarsystemhijri.cpp:380
     5726msgid "of Sha`ban"
     5727msgstr "od Sha`bana"
     5728
     5729#. +> trunk
     5730#: kcalendarsystemislamiccivil.cpp:289
     5731#, fuzzy
     5732#| msgid "of Ramadan"
     5733msgctxt "Hijri month 9 - KLocale::LongName Possessive"
     5734msgid "of Ramadan"
     5735msgstr "od Ramadana"
     5736
     5737#. +> stable
     5738#: kcalendarsystemhijri.cpp:351 kcalendarsystemhijri.cpp:382
     5739msgid "of Ramadan"
     5740msgstr "od Ramadana"
     5741
     5742#. +> trunk
     5743#: kcalendarsystemislamiccivil.cpp:291
     5744#, fuzzy
     5745#| msgid "of Shawwal"
     5746msgctxt "Hijri month 10 - KLocale::LongName Possessive"
     5747msgid "of Shawwal"
     5748msgstr "od Shawwala"
     5749
     5750#. +> stable
     5751#: kcalendarsystemhijri.cpp:353 kcalendarsystemhijri.cpp:384
     5752msgid "of Shawwal"
     5753msgstr "od Shawwala"
     5754
     5755#. +> trunk
     5756#: kcalendarsystemislamiccivil.cpp:293
     5757#, fuzzy
     5758#| msgid "of Thu al-Qi`dah"
     5759msgctxt "Hijri month 11 - KLocale::LongName Possessive"
     5760msgid "of Thu al-Qi`dah"
     5761msgstr "od Thu al-Qi`daha"
     5762
     5763#. +> stable
     5764#: kcalendarsystemhijri.cpp:386
     5765msgid "of Thu al-Qi`dah"
     5766msgstr "od Thu al-Qi`daha"
     5767
     5768#. +> trunk
     5769#: kcalendarsystemislamiccivil.cpp:295
     5770#, fuzzy
     5771#| msgid "of Thu al-Hijjah"
     5772msgctxt "Hijri month 12 - KLocale::LongName Possessive"
     5773msgid "of Thu al-Hijjah"
     5774msgstr "od Thu al-Hijjaha"
     5775
     5776#. +> stable
     5777#: kcalendarsystemhijri.cpp:388
     5778msgid "of Thu al-Hijjah"
     5779msgstr "od Thu al-Hijjaha"
     5780
     5781#. +> trunk
     5782#: kcalendarsystemislamiccivil.cpp:304
     5783#, fuzzy
     5784#| msgid "Muharram"
     5785msgctxt "Hijri month 1 - KLocale::LongName"
     5786msgid "Muharram"
     5787msgstr "Muharram"
     5788
     5789#. +> stable
     5790#: kcalendarsystemhijri.cpp:397 kcalendarsystemhijri.cpp:428
     5791msgid "Muharram"
     5792msgstr "Muharram"
     5793
     5794#. +> trunk
     5795#: kcalendarsystemislamiccivil.cpp:306
     5796#, fuzzy
     5797#| msgid "Safar"
     5798msgctxt "Hijri month 2 - KLocale::LongName"
     5799msgid "Safar"
     5800msgstr "Safar"
     5801
     5802#. +> stable
     5803#: kcalendarsystemhijri.cpp:399 kcalendarsystemhijri.cpp:430
     5804msgid "Safar"
     5805msgstr "Safar"
     5806
     5807#. +> trunk
     5808#: kcalendarsystemislamiccivil.cpp:308
     5809#, fuzzy
     5810#| msgid "Rabi` al-Awal"
     5811msgctxt "Hijri month 3 - KLocale::LongName"
     5812msgid "Rabi` al-Awal"
     5813msgstr "Rabi` al-Awal"
     5814
     5815#. +> stable
     5816#: kcalendarsystemhijri.cpp:432
     5817msgid "Rabi` al-Awal"
     5818msgstr "Rabi` al-Awal"
     5819
     5820#. +> trunk
     5821#: kcalendarsystemislamiccivil.cpp:310
     5822#, fuzzy
     5823#| msgid "Rabi` al-Thaani"
     5824msgctxt "Hijri month 4 - KLocale::LongName"
     5825msgid "Rabi` al-Thaani"
     5826msgstr "Rabi` al-Thaani"
     5827
     5828#. +> stable
     5829#: kcalendarsystemhijri.cpp:434
     5830msgid "Rabi` al-Thaani"
     5831msgstr "Rabi` al-Thaani"
     5832
     5833#. +> trunk
     5834#: kcalendarsystemislamiccivil.cpp:312
     5835#, fuzzy
     5836#| msgid "Jumaada al-Awal"
     5837msgctxt "Hijri month 5 - KLocale::LongName"
     5838msgid "Jumaada al-Awal"
     5839msgstr "Jumaada al-Awal"
     5840
     5841#. +> stable
     5842#: kcalendarsystemhijri.cpp:436
     5843msgid "Jumaada al-Awal"
     5844msgstr "Jumaada al-Awal"
     5845
     5846#. +> trunk
     5847#: kcalendarsystemislamiccivil.cpp:314
     5848#, fuzzy
     5849#| msgid "Jumaada al-Thaani"
     5850msgctxt "Hijri month 6 - KLocale::LongName"
     5851msgid "Jumaada al-Thaani"
     5852msgstr "Jumaada al-Thaani"
     5853
     5854#. +> stable
     5855#: kcalendarsystemhijri.cpp:438
     5856msgid "Jumaada al-Thaani"
     5857msgstr "Jumaada al-Thaani"
     5858
     5859#. +> trunk
     5860#: kcalendarsystemislamiccivil.cpp:316
     5861#, fuzzy
     5862#| msgid "Rajab"
     5863msgctxt "Hijri month 7 - KLocale::LongName"
     5864msgid "Rajab"
     5865msgstr "Rajab"
     5866
     5867#. +> stable
     5868#: kcalendarsystemhijri.cpp:409 kcalendarsystemhijri.cpp:440
     5869msgid "Rajab"
     5870msgstr "Rajab"
     5871
     5872#. +> trunk
     5873#: kcalendarsystemislamiccivil.cpp:318
     5874#, fuzzy
     5875#| msgid "Sha`ban"
     5876msgctxt "Hijri month 8 - KLocale::LongName"
     5877msgid "Sha`ban"
     5878msgstr "Sha`ban"
     5879
     5880#. +> stable
     5881#: kcalendarsystemhijri.cpp:411 kcalendarsystemhijri.cpp:442
     5882msgid "Sha`ban"
     5883msgstr "Sha`ban"
     5884
     5885#. +> trunk
     5886#: kcalendarsystemislamiccivil.cpp:320
     5887#, fuzzy
     5888#| msgid "Ramadan"
     5889msgctxt "Hijri month 9 - KLocale::LongName"
     5890msgid "Ramadan"
     5891msgstr "Ramadan"
     5892
     5893#. +> stable
     5894#: kcalendarsystemhijri.cpp:413 kcalendarsystemhijri.cpp:444
     5895msgid "Ramadan"
     5896msgstr "Ramadan"
     5897
     5898#. +> trunk
     5899#: kcalendarsystemislamiccivil.cpp:322
     5900#, fuzzy
     5901#| msgid "Shawwal"
     5902msgctxt "Hijri month 10 - KLocale::LongName"
     5903msgid "Shawwal"
     5904msgstr "Sha`ban"
     5905
     5906#. +> stable
     5907#: kcalendarsystemhijri.cpp:415 kcalendarsystemhijri.cpp:446
     5908msgid "Shawwal"
     5909msgstr "Sha`ban"
     5910
     5911#. +> trunk
     5912#: kcalendarsystemislamiccivil.cpp:324
     5913#, fuzzy
     5914#| msgid "Thu al-Qi`dah"
     5915msgctxt "Hijri month 11 - KLocale::LongName"
     5916msgid "Thu al-Qi`dah"
     5917msgstr "Thu al-Qi`dah"
     5918
     5919#. +> stable
     5920#: kcalendarsystemhijri.cpp:448
     5921msgid "Thu al-Qi`dah"
     5922msgstr "Thu al-Qi`dah"
     5923
     5924#. +> trunk
     5925#: kcalendarsystemislamiccivil.cpp:326
     5926#, fuzzy
     5927#| msgid "Thu al-Hijjah"
     5928msgctxt "Hijri month 12 - KLocale::LongName"
     5929msgid "Thu al-Hijjah"
     5930msgstr "Thu al-Hijjah"
     5931
     5932#. +> stable
     5933#: kcalendarsystemhijri.cpp:450
     5934msgid "Thu al-Hijjah"
     5935msgstr "Thu al-Hijjah"
     5936
     5937#. +> trunk
     5938#: kcalendarsystemislamiccivil.cpp:337
     5939#, fuzzy
     5940msgctxt "Hijri weekday 1 - KLocale::NarrowName "
     5941msgid "I"
     5942msgstr "I"
     5943
     5944#. +> trunk
     5945#: kcalendarsystemislamiccivil.cpp:339
     5946#, fuzzy
     5947msgctxt "Hijri weekday 2 - KLocale::NarrowName "
     5948msgid "T"
     5949msgstr "TGA"
     5950
     5951#. +> stable
     5952#: kcalendarsystemhijri.cpp:339
     5953msgid "of R. Awal"
     5954msgstr "od R. Awala"
     5955
     5956#. +> trunk
     5957#: kcalendarsystemislamiccivil.cpp:341
     5958#, fuzzy
     5959msgctxt "Hijri weekday 3 - KLocale::NarrowName "
     5960msgid "A"
     5961msgstr "A"
     5962
     5963#. +> stable
     5964#: kcalendarsystemhijri.cpp:341
     5965msgid "of R. Thaani"
     5966msgstr "od R. Thaania"
     5967
     5968#. +> trunk
     5969#: kcalendarsystemislamiccivil.cpp:343
     5970#, fuzzy
     5971msgctxt "Hijri weekday 4 - KLocale::NarrowName "
     5972msgid "K"
     5973msgstr "K"
     5974
     5975#. +> stable
     5976#: kcalendarsystemhijri.cpp:343
     5977msgid "of J. Awal"
     5978msgstr "od J. Awala"
     5979
     5980#. +> trunk
     5981#: kcalendarsystemislamiccivil.cpp:345
     5982#, fuzzy
     5983msgctxt "Hijri weekday 5 - KLocale::NarrowName "
     5984msgid "J"
     5985msgstr "J"
     5986
     5987#. +> stable
     5988#: kcalendarsystemhijri.cpp:345
     5989msgid "of J. Thaani"
     5990msgstr "od J. Thaania"
     5991
     5992#. +> trunk
     5993#: kcalendarsystemislamiccivil.cpp:347
     5994#, fuzzy
     5995msgctxt "Hijri weekday 6 - KLocale::NarrowName "
     5996msgid "S"
     5997msgstr "S"
     5998
     5999#. +> trunk
     6000#: kcalendarsystemislamiccivil.cpp:349
     6001#, fuzzy
     6002msgctxt "Hijri weekday 7 - KLocale::NarrowName "
     6003msgid "A"
     6004msgstr "A"
     6005
     6006#. +> stable
     6007#: kcalendarsystemhijri.cpp:355
     6008msgid "of Qi`dah"
     6009msgstr "od Qi`daha"
     6010
     6011#. +> stable
     6012#: kcalendarsystemhijri.cpp:357
     6013msgid "of Hijjah"
     6014msgstr "od Hijjaha"
     6015
     6016#. +> trunk
     6017#: kcalendarsystemislamiccivil.cpp:358
     6018#, fuzzy
     6019#| msgid "Ith"
     6020msgctxt "Hijri weekday 1 - KLocale::ShortName"
     6021msgid "Ith"
     6022msgstr "Ith"
     6023
     6024#. +> stable
     6025#: kcalendarsystemhijri.cpp:466
     6026msgid "Ith"
     6027msgstr "Ith"
     6028
     6029#. +> trunk
     6030#: kcalendarsystemislamiccivil.cpp:360
     6031#, fuzzy
     6032#| msgid "Thl"
     6033msgctxt "Hijri weekday 2 - KLocale::ShortName"
     6034msgid "Thl"
     6035msgstr "Thl"
     6036
     6037#. +> stable
     6038#: kcalendarsystemhijri.cpp:468
     6039msgid "Thl"
     6040msgstr "Thl"
     6041
     6042#. +> trunk
     6043#: kcalendarsystemislamiccivil.cpp:362
     6044#, fuzzy
     6045#| msgid "Arb"
     6046msgctxt "Hijri weekday 3 - KLocale::ShortName"
     6047msgid "Arb"
     6048msgstr "Arb"
     6049
     6050#. +> stable
     6051#: kcalendarsystemhijri.cpp:470
     6052msgid "Arb"
     6053msgstr "Arb"
     6054
     6055#. +> trunk
     6056#: kcalendarsystemislamiccivil.cpp:364
     6057#, fuzzy
     6058#| msgid "Kha"
     6059msgctxt "Hijri weekday 4 - KLocale::ShortName"
     6060msgid "Kha"
     6061msgstr "Kha"
     6062
     6063#. +> stable
     6064#: kcalendarsystemhijri.cpp:472
     6065msgid "Kha"
     6066msgstr "Kha"
     6067
     6068#. +> trunk
     6069#: kcalendarsystemislamiccivil.cpp:366
     6070#, fuzzy
     6071#| msgid "Jum"
     6072msgctxt "Hijri weekday 5 - KLocale::ShortName"
     6073msgid "Jum"
     6074msgstr "Jum"
     6075
     6076#. +> stable
     6077#: kcalendarsystemhijri.cpp:474
     6078msgid "Jum"
     6079msgstr "Jum"
     6080
     6081#. +> trunk
     6082#: kcalendarsystemislamiccivil.cpp:368
     6083#, fuzzy
     6084#| msgid "Sab"
     6085msgctxt "Hijri weekday 6 - KLocale::ShortName"
     6086msgid "Sab"
     6087msgstr "Sab"
     6088
     6089#. +> stable
     6090#: kcalendarsystemhijri.cpp:476
     6091msgid "Sab"
     6092msgstr "Sab"
     6093
     6094#. +> trunk
     6095#: kcalendarsystemislamiccivil.cpp:370
     6096#, fuzzy
     6097#| msgid "Ahd"
     6098msgctxt "Hijri weekday 7 - KLocale::ShortName"
     6099msgid "Ahd"
     6100msgstr "Ahd"
     6101
     6102#. +> stable
     6103#: kcalendarsystemhijri.cpp:478
     6104msgid "Ahd"
     6105msgstr "Ahd"
     6106
     6107#. +> trunk
     6108#: kcalendarsystemislamiccivil.cpp:377
     6109#, fuzzy
     6110#| msgid "Yaum al-Ithnain"
     6111msgctxt "Hijri weekday 1 - KLocale::LongName"
     6112msgid "Yaum al-Ithnain"
     6113msgstr "Yaum al-Ithnain"
     6114
     6115#. +> stable
     6116#: kcalendarsystemhijri.cpp:487
     6117msgid "Yaum al-Ithnain"
     6118msgstr "Yaum al-Ithnain"
     6119
     6120#. +> trunk
     6121#: kcalendarsystemislamiccivil.cpp:379
     6122#, fuzzy
     6123#| msgid "Yau al-Thulatha"
     6124msgctxt "Hijri weekday 2 - KLocale::LongName"
     6125msgid "Yau al-Thulatha"
     6126msgstr "Yau al-Thulatha"
     6127
     6128#. +> stable
     6129#: kcalendarsystemhijri.cpp:489
     6130msgid "Yau al-Thulatha"
     6131msgstr "Yau al-Thulatha"
     6132
     6133#. +> trunk
     6134#: kcalendarsystemislamiccivil.cpp:381
     6135#, fuzzy
     6136#| msgid "Yaum al-Arbi'a"
     6137msgctxt "Hijri weekday 3 - KLocale::LongName"
     6138msgid "Yaum al-Arbi'a"
     6139msgstr "Yaum al-Arbi'a"
     6140
     6141#. +> stable
     6142#: kcalendarsystemhijri.cpp:491
     6143msgid "Yaum al-Arbi'a"
     6144msgstr "Yaum al-Arbi'a"
     6145
     6146#. +> trunk
     6147#: kcalendarsystemislamiccivil.cpp:383
     6148#, fuzzy
     6149#| msgid "Yaum al-Khamees"
     6150msgctxt "Hijri weekday 4 - KLocale::LongName"
     6151msgid "Yaum al-Khamees"
     6152msgstr "Yaum al-Khamees"
     6153
     6154#. +> stable
     6155#: kcalendarsystemhijri.cpp:493
     6156msgid "Yaum al-Khamees"
     6157msgstr "Yaum al-Khamees"
     6158
     6159#. +> trunk
     6160#: kcalendarsystemislamiccivil.cpp:385
     6161#, fuzzy
     6162#| msgid "Yaum al-Jumma"
     6163msgctxt "Hijri weekday 5 - KLocale::LongName"
     6164msgid "Yaum al-Jumma"
     6165msgstr "Yaum al-Jumma"
     6166
     6167#. +> stable
     6168#: kcalendarsystemhijri.cpp:495
     6169msgid "Yaum al-Jumma"
     6170msgstr "Yaum al-Jumma"
     6171
     6172#. +> trunk
     6173#: kcalendarsystemislamiccivil.cpp:387
     6174#, fuzzy
     6175#| msgid "Yaum al-Sabt"
     6176msgctxt "Hijri weekday 6 - KLocale::LongName"
     6177msgid "Yaum al-Sabt"
     6178msgstr "Yaum al-Sabt"
     6179
     6180#. +> stable
     6181#: kcalendarsystemhijri.cpp:497
     6182msgid "Yaum al-Sabt"
     6183msgstr "Yaum al-Sabt"
     6184
     6185#. +> trunk
     6186#: kcalendarsystemislamiccivil.cpp:389
     6187#, fuzzy
     6188#| msgid "Yaum al-Ahad"
     6189msgctxt "Hijri weekday 7 - KLocale::LongName"
     6190msgid "Yaum al-Ahad"
     6191msgstr "Yaum al-Ahad"
     6192
     6193#. +> stable
     6194#: kcalendarsystemhijri.cpp:401
     6195msgid "R. Awal"
     6196msgstr "R. Awal"
     6197
     6198#. +> stable
     6199#: kcalendarsystemhijri.cpp:403
     6200msgid "R. Thaani"
     6201msgstr "R. Thaani"
     6202
     6203#. +> stable
     6204#: kcalendarsystemhijri.cpp:405
     6205msgid "J. Awal"
     6206msgstr "J. Awal"
     6207
     6208#. +> stable
     6209#: kcalendarsystemhijri.cpp:407
     6210msgid "J. Thaani"
     6211msgstr "J. Thaani"
     6212
     6213#. +> stable
     6214#: kcalendarsystemhijri.cpp:417
     6215msgid "Qi`dah"
     6216msgstr "Qi`dah"
     6217
     6218#. +> stable
     6219#: kcalendarsystemhijri.cpp:419
     6220msgid "Hijjah"
     6221msgstr "Hijjah"
     6222
     6223#. +> stable
     6224#: kcalendarsystemhijri.cpp:499
     6225msgid "Yaum al-Ahad"
     6226msgstr "Yaum al-Ahad"
     6227
     6228#. +> trunk stable
    62296229#: kcalendarsystemjalali.cpp:80
    62306230msgctxt "Calendar Era: Jalali Islamic Era, years > 0, LongFormat"
     
    73337333
    73347334#. +> trunk stable
    7335 #: kcalendarsystemjapanese.cpp:293
     7335#: kcalendarsystemjapanese.cpp:192
    73367336msgctxt "Japanese year 1 of era"
    73377337msgid "Gannen"
  • kde-croatia/kde4/summit/hr/summit/messages/kdelibs/kio4.po

    r1031 r1036  
    1111"Project-Id-Version: kio4 0\n"
    1212"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    13 "POT-Creation-Date: 2011-05-22 08:38+0200\n"
     13"POT-Creation-Date: 2011-05-25 09:40+0200\n"
    1414"PO-Revision-Date: 2011-05-05 10:23+0200\n"
    1515"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
     
    69836983
    69846984#. +> trunk stable
    6985 #: misc/kpac/proxyscout.cpp:201
     6985#: misc/kpac/proxyscout.cpp:203
    69866986#, kde-format
    69876987msgid ""
     
    69936993
    69946994#. +> trunk stable
    6995 #: misc/kpac/proxyscout.cpp:315
     6995#: misc/kpac/proxyscout.cpp:317
    69966996#, kde-format
    69976997msgid ""
  • kde-croatia/kde4/summit/hr/summit/messages/kdemultimedia/juk.po

    r1026 r1036  
    66"Project-Id-Version: juk 0\n"
    77"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    8 "POT-Creation-Date: 2011-05-19 07:16+0200\n"
     8"POT-Creation-Date: 2011-05-25 09:40+0200\n"
    99"PO-Revision-Date: 2004-04-20 13:21+CEST\n"
    1010"Last-Translator: auto\n"
     
    114114#. i18n: ectx: property (windowTitle), widget (QWidget, CoverDialogBase)
    115115#. +> trunk stable
    116 #: coverdialogbase.ui:13 playlistcollection.cpp:897
     116#: coverdialogbase.ui:13 playlistcollection.cpp:899
    117117#, fuzzy
    118118msgid "Cover Manager"
     
    13201320
    13211321#. +> trunk stable
    1322 #: playlistbox.cpp:214 playlistcollection.cpp:400
     1322#: playlistbox.cpp:214 playlistcollection.cpp:402
    13231323#, fuzzy
    13241324msgctxt "verb, copy the playlist"
     
    13691369
    13701370#. +> trunk stable
    1371 #: playlistbox.cpp:671 playlistcollection.cpp:889
     1371#: playlistbox.cpp:671 playlistcollection.cpp:891
    13721372msgid "R&emove"
    13731373msgstr "U&kloni"
     
    13801380
    13811381#. +> trunk stable
    1382 #: playlistcollection.cpp:229
     1382#: playlistcollection.cpp:231
    13831383#, fuzzy
    13841384msgid "Now Playing"
     
    13861386
    13871387#. +> trunk stable
    1388 #: playlistcollection.cpp:331
     1388#: playlistcollection.cpp:333
    13891389#, fuzzy
    13901390msgid "Do you want to add these items to the current list or to the collection list?"
     
    13921392
    13931393#. +> trunk stable
    1394 #: playlistcollection.cpp:333
     1394#: playlistcollection.cpp:335
    13951395#, fuzzy
    13961396#| msgid "Current"
     
    14001400
    14011401#. +> trunk stable
    1402 #: playlistcollection.cpp:334
     1402#: playlistcollection.cpp:336
    14031403msgid "Collection"
    14041404msgstr "Kolekcija"
    14051405
    14061406#. +> trunk stable
    1407 #: playlistcollection.cpp:388
     1407#: playlistcollection.cpp:390
    14081408msgid "Rename"
    14091409msgstr "Preimenuj"
    14101410
    14111411#. +> trunk stable
    1412 #: playlistcollection.cpp:502
     1412#: playlistcollection.cpp:504
    14131413#, fuzzy
    14141414msgid "Search Playlist"
     
    14161416
    14171417#. +> trunk stable
    1418 #: playlistcollection.cpp:519
     1418#: playlistcollection.cpp:521
    14191419#, fuzzy
    14201420msgid "Create Folder Playlist"
     
    14221422
    14231423#. +> trunk stable
    1424 #: playlistcollection.cpp:558
     1424#: playlistcollection.cpp:560
    14251425msgid "History"
    14261426msgstr "Povijest"
    14271427
    14281428#. +> trunk stable
    1429 #: playlistcollection.cpp:740
     1429#: playlistcollection.cpp:742
    14301430#, fuzzy
    14311431msgid "Please enter a name for this playlist:"
     
    14331433
    14341434#. +> trunk stable
    1435 #: playlistcollection.cpp:850
     1435#: playlistcollection.cpp:852
    14361436#, fuzzy
    14371437#| msgid "&New"
     
    14411441
    14421442#. +> trunk stable
    1443 #: playlistcollection.cpp:853
     1443#: playlistcollection.cpp:855
    14441444#, fuzzy
    14451445msgid "&Empty Playlist..."
     
    14471447
    14481448#. +> trunk stable
    1449 #: playlistcollection.cpp:855
     1449#: playlistcollection.cpp:857
    14501450#, fuzzy
    14511451msgid "&Search Playlist..."
     
    14531453
    14541454#. +> trunk stable
    1455 #: playlistcollection.cpp:857
     1455#: playlistcollection.cpp:859
    14561456#, fuzzy
    14571457msgid "Playlist From &Folder..."
     
    14591459
    14601460#. +> trunk stable
    1461 #: playlistcollection.cpp:863
     1461#: playlistcollection.cpp:865
    14621462#, fuzzy
    14631463msgid "&Guess Tag Information"
     
    14651465
    14661466#. +> trunk stable
    1467 #: playlistcollection.cpp:868
     1467#: playlistcollection.cpp:870
    14681468#, fuzzy
    14691469msgid "From &File Name"
     
    14711471
    14721472#. +> trunk stable
    1473 #: playlistcollection.cpp:870
     1473#: playlistcollection.cpp:872
    14741474#, fuzzy
    14751475msgid "From &Internet"
     
    14771477
    14781478#. +> trunk stable
    1479 #: playlistcollection.cpp:873
     1479#: playlistcollection.cpp:875
    14801480#, fuzzy
    14811481msgid "Guess Tag Information From &File Name"
     
    14831483
    14841484#. +> trunk stable
    1485 #: playlistcollection.cpp:878
     1485#: playlistcollection.cpp:880
    14861486#, fuzzy
    14871487msgid "Play First Track"
     
    14891489
    14901490#. +> trunk stable
    1491 #: playlistcollection.cpp:879
     1491#: playlistcollection.cpp:881
    14921492msgid "Play Next Album"
    14931493msgstr ""
    14941494
    14951495#. +> trunk stable
    1496 #: playlistcollection.cpp:885
     1496#: playlistcollection.cpp:887
    14971497msgid "Add &Folder..."
    14981498msgstr ""
    14991499
    15001500#. +> trunk stable
    1501 #: playlistcollection.cpp:886
     1501#: playlistcollection.cpp:888
    15021502msgid "&Rename..."
    15031503msgstr "&Promijeni ime 
"
    15041504
    15051505#. +> trunk stable
    1506 #: playlistcollection.cpp:887
     1506#: playlistcollection.cpp:889
    15071507#, fuzzy
    15081508#| msgid "D&uplicate..."
     
    15121512
    15131513#. +> trunk stable
    1514 #: playlistcollection.cpp:890
     1514#: playlistcollection.cpp:892
    15151515#, fuzzy
    15161516msgid "Reload"
     
    15181518
    15191519#. +> trunk stable
    1520 #: playlistcollection.cpp:891
     1520#: playlistcollection.cpp:893
    15211521msgid "Edit Search..."
    15221522msgstr ""
    15231523
    15241524#. +> trunk stable
    1525 #: playlistcollection.cpp:893
     1525#: playlistcollection.cpp:895
    15261526#, fuzzy
    15271527msgid "&Delete"
     
    15291529
    15301530#. +> trunk stable
    1531 #: playlistcollection.cpp:894
     1531#: playlistcollection.cpp:896
    15321532#, fuzzy
    15331533msgid "Refresh"
     
    15351535
    15361536#. +> trunk stable
    1537 #: playlistcollection.cpp:895
     1537#: playlistcollection.cpp:897
    15381538msgid "&Rename File"
    15391539msgstr "&Promijeni ime datoteci"
    15401540
    15411541#. +> trunk stable
    1542 #: playlistcollection.cpp:900
     1542#: playlistcollection.cpp:902
    15431543#, fuzzy
    15441544msgid "&View Cover"
     
    15461546
    15471547#. +> trunk stable
    1548 #: playlistcollection.cpp:902
     1548#: playlistcollection.cpp:904
    15491549msgid "Get Cover From &File..."
    15501550msgstr ""
    15511551
    15521552#. +> trunk stable
    1553 #: playlistcollection.cpp:904
     1553#: playlistcollection.cpp:906
    15541554#, fuzzy
    15551555msgid "Get Cover From &Internet..."
     
    15571557
    15581558#. +> trunk stable
    1559 #: playlistcollection.cpp:906
     1559#: playlistcollection.cpp:908
    15601560msgid "&Delete Cover"
    15611561msgstr ""
    15621562
    15631563#. +> trunk stable
    1564 #: playlistcollection.cpp:908
     1564#: playlistcollection.cpp:910
    15651565#, fuzzy
    15661566msgid "Show Cover &Manager"
     
    15681568
    15691569#. +> trunk stable
    1570 #: playlistcollection.cpp:912
     1570#: playlistcollection.cpp:914
    15711571#, fuzzy
    15721572msgid "Show &Play Queue"
  • kde-croatia/kde4/summit/hr/summit/messages/kdenetwork/desktop_kdenetwork.po

    r1027 r1036  
    88"Project-Id-Version: desktop_kdenetwork 0\n"
    99"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    10 "POT-Creation-Date: 2011-05-20 07:34+0200\n"
     10"POT-Creation-Date: 2011-05-25 09:40+0200\n"
    1111"PO-Revision-Date: 2010-05-26 11:57+0200\n"
    1212"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     
    841841
    842842#. +> trunk
    843 #: kopete/kopete/kopete.notifyrc:3140
     843#: kopete/kopete/kopete.notifyrc:3141
    844844#, fuzzy
    845845msgctxt "Name"
     
    848848
    849849#. +> trunk
    850 #: kopete/kopete/kopete.notifyrc:3161
     850#: kopete/kopete/kopete.notifyrc:3162
    851851#, fuzzy
    852852#| msgctxt "Comment"
  • kde-croatia/kde4/summit/hr/summit/messages/kdepim/desktop_kdepim.po

    r1032 r1036  
    77"Project-Id-Version: desktop_kdepim 0\n"
    88"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    9 "POT-Creation-Date: 2011-05-23 09:09+0200\n"
     9"POT-Creation-Date: 2011-05-25 09:40+0200\n"
    1010"PO-Revision-Date: 2011-02-27 12:29+0100\n"
    1111"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     
    305305
    306306#. +> trunk
    307 #: examples/coisceim/kontact-plugin/coisceim_plugin.desktop:30
     307#: examples/coisceim/kontact-plugin/coisceim_plugin.desktop:32
    308308#, fuzzy
    309309msgctxt "Name"
     
    344344
    345345#. +> trunk stable
    346 #: examples/mailreader/mailreader.desktop:42
     346#: examples/mailreader/mailreader.desktop:43
    347347#, fuzzy
    348348msgctxt "GenericName"
     
    358358
    359359#. +> trunk stable
    360 #: kaddressbook/grantlee/tests/themes/air/theme-air.desktop:32
     360#: kaddressbook/grantlee/tests/themes/air/theme-air.desktop:33
    361361#, fuzzy
    362362msgctxt "Description"
     
    372372
    373373#. +> trunk stable
    374 #: kaddressbook/grantlee/tests/themes/simple/theme-simple.desktop:32
     374#: kaddressbook/grantlee/tests/themes/simple/theme-simple.desktop:33
    375375#, fuzzy
    376376msgctxt "Description"
     
    386386
    387387#. +> trunk stable
    388 #: kaddressbook/grantlee/tests/themes/test/theme-test.desktop:32
     388#: kaddressbook/grantlee/tests/themes/test/theme-test.desktop:33
    389389#, fuzzy
    390390msgctxt "Description"
     
    565565
    566566#. +> trunk
    567 #: kalarm/rtcwakeaction.actions:78
     567#: kalarm/rtcwakeaction.actions:80
    568568msgctxt "Description"
    569569msgid "Set RTC wake-from-suspend time"
     
    14691469
    14701470#. +> trunk stable
    1471 #: kontact/src/kontactconfig.desktop:23
     1471#: kontact/src/kontactconfig.desktop:26
    14721472#, fuzzy
    14731473msgctxt "Comment"
     
    18771877
    18781878#. +> trunk stable
    1879 #: libkleo/libkleopatrarc-win32.desktop:87
     1879#: libkleo/libkleopatrarc-win32.desktop:88
    18801880msgctxt "Name"
    18811881msgid "sha256sum"
     
    18831883
    18841884#. +> trunk stable
    1885 #: libkleo/libkleopatrarc-win32.desktop:123 libkleo/libkleopatrarc.desktop:166
     1885#: libkleo/libkleopatrarc-win32.desktop:124 libkleo/libkleopatrarc.desktop:167
    18861886msgctxt "Name"
    18871887msgid "md5sum"
     
    18891889
    18901890#. +> trunk stable
    1891 #: libkleo/libkleopatrarc-win32.desktop:160 libkleo/libkleopatrarc.desktop:203
     1891#: libkleo/libkleopatrarc-win32.desktop:162 libkleo/libkleopatrarc.desktop:205
    18921892#, fuzzy
    18931893msgctxt "Name"
     
    18961896
    18971897#. +> trunk stable
    1898 #: libkleo/libkleopatrarc-win32.desktop:219 libkleo/libkleopatrarc.desktop:262
     1898#: libkleo/libkleopatrarc-win32.desktop:221 libkleo/libkleopatrarc.desktop:264
    18991899#, fuzzy
    19001900msgctxt "Name"
     
    19031903
    19041904#. +> trunk stable
    1905 #: libkleo/libkleopatrarc-win32.desktop:279 libkleo/libkleopatrarc.desktop:322
     1905#: libkleo/libkleopatrarc-win32.desktop:281 libkleo/libkleopatrarc.desktop:324
    19061906#, fuzzy
    19071907msgctxt "Name"
     
    19101910
    19111911#. +> trunk stable
    1912 #: libkleo/libkleopatrarc-win32.desktop:339 libkleo/libkleopatrarc.desktop:382
     1912#: libkleo/libkleopatrarc-win32.desktop:341 libkleo/libkleopatrarc.desktop:384
    19131913msgctxt "Name"
    19141914msgid "Trusted Root Certificate"
     
    19161916
    19171917#. +> trunk stable
    1918 #: libkleo/libkleopatrarc-win32.desktop:401 libkleo/libkleopatrarc.desktop:444
     1918#: libkleo/libkleopatrarc-win32.desktop:403 libkleo/libkleopatrarc.desktop:446
    19191919msgctxt "Name"
    19201920msgid "Not Trusted Root Certificate"
     
    19221922
    19231923#. +> trunk stable
    1924 #: libkleo/libkleopatrarc-win32.desktop:459 libkleo/libkleopatrarc.desktop:502
     1924#: libkleo/libkleopatrarc-win32.desktop:461 libkleo/libkleopatrarc.desktop:504
    19251925msgctxt "Name"
    19261926msgid "Keys for Qualified Signatures"
     
    19281928
    19291929#. +> trunk stable
    1930 #: libkleo/libkleopatrarc-win32.desktop:502 libkleo/libkleopatrarc.desktop:545
     1930#: libkleo/libkleopatrarc-win32.desktop:504 libkleo/libkleopatrarc.desktop:547
    19311931#, fuzzy
    19321932msgctxt "Name"
     
    19351935
    19361936#. +> trunk stable
    1937 #: libkleo/libkleopatrarc-win32.desktop:548 libkleo/libkleopatrarc.desktop:591
     1937#: libkleo/libkleopatrarc-win32.desktop:550 libkleo/libkleopatrarc.desktop:593
    19381938msgctxt "Name"
    19391939msgid "Smartcard Key"
  • kde-croatia/kde4/summit/hr/summit/messages/kdeutils/ark.po

    r1021 r1036  
    99"Project-Id-Version: ark 0\n"
    1010"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    11 "POT-Creation-Date: 2011-05-16 09:01+0200\n"
     11"POT-Creation-Date: 2011-05-25 09:41+0200\n"
    1212"PO-Revision-Date: 2011-03-03 21:22+0100\n"
    1313"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     
    4040
    4141#. +> trunk stable
    42 #: app/batchextract.cpp:135 app/batchextract.cpp:188
     42#: app/batchextract.cpp:136 app/batchextract.cpp:192
    4343msgid "Extracting file..."
    4444msgstr "Otpakiravam datoteku
"
    4545
    4646#. +> trunk stable
    47 #: app/batchextract.cpp:136 app/batchextract.cpp:189
     47#: app/batchextract.cpp:137 app/batchextract.cpp:193
    4848msgid "Source archive"
    4949msgstr "Izvorna arhiva"
    5050
    5151#. +> trunk stable
    52 #: app/batchextract.cpp:137 app/batchextract.cpp:190
     52#: app/batchextract.cpp:138 app/batchextract.cpp:194
    5353msgid "Destination"
    5454msgstr "Odredište"
    5555
    5656#. +> trunk stable
    57 #: app/batchextract.cpp:150
     57#: app/batchextract.cpp:151
    5858msgid "The following files could not be extracted:"
    5959msgstr "Sljedeće datoteke ne mogu biti otpakirane:"
    6060
    6161#. +> trunk stable
    62 #: app/batchextract.cpp:166
     62#: app/batchextract.cpp:170
    6363msgid "There was an error during extraction."
    6464msgstr "Dogodila se greška prilikom otpakiravanja."
     
    341341
    342342#. +> trunk stable
    343 #: kerfuffle/cliinterface.cpp:494 kerfuffle/cliinterface.cpp:535
     343#: kerfuffle/cliinterface.cpp:494 kerfuffle/cliinterface.cpp:534
    344344msgid "Incorrect password."
    345345msgstr "Netočna zaporka."
    346346
    347347#. +> trunk stable
    348 #: kerfuffle/cliinterface.cpp:502 kerfuffle/cliinterface.cpp:543
     348#: kerfuffle/cliinterface.cpp:501 kerfuffle/cliinterface.cpp:541
    349349msgid "Extraction failed because of an unexpected error."
    350350msgstr "Otpakiravanje nije uspjelo zbog neočekivane greške."
  • kde-croatia/kde4/summit/hr/summit/messages/kdeutils/desktop_kdeutils.po

    r1027 r1036  
    77"Project-Id-Version: desktop_kdeutils 0\n"
    88"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    9 "POT-Creation-Date: 2011-05-20 07:35+0200\n"
     9"POT-Creation-Date: 2011-05-25 09:41+0200\n"
    1010"PO-Revision-Date: 2010-02-14 12:30+0100\n"
    1111"Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
     
    2828
    2929#. +> trunk stable
    30 #: ark/app/ark.desktop:74
     30#: ark/app/ark.desktop:75
    3131msgctxt "Name"
    3232msgid "Ark"
     
    4646
    4747#. +> trunk stable
    48 #: ark/app/ark_addtoservicemenu.desktop:124
     48#: ark/app/ark_addtoservicemenu.desktop:125
    4949msgctxt "Name"
    5050msgid "As ZIP Archive"
     
    5252
    5353#. +> trunk stable
    54 #: ark/app/ark_addtoservicemenu.desktop:181
     54#: ark/app/ark_addtoservicemenu.desktop:183
    5555msgctxt "Name"
    5656msgid "As RAR Archive"
     
    5858
    5959#. +> trunk stable
    60 #: ark/app/ark_addtoservicemenu.desktop:238
     60#: ark/app/ark_addtoservicemenu.desktop:241
    6161msgctxt "Name"
    6262msgid "As ZIP/TAR Archive"
     
    6464
    6565#. +> trunk stable
    66 #: ark/app/ark_addtoservicemenu.desktop:294
     66#: ark/app/ark_addtoservicemenu.desktop:298
    6767msgctxt "Name"
    6868msgid "Compress To..."
  • kde-croatia/kde4/summit/hr/summit/messages/koffice/karbon.po

    r945 r1036  
    55"Project-Id-Version: karbon 0\n"
    66"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    7 "POT-Creation-Date: 2011-04-07 08:11+0200\n"
     7"POT-Creation-Date: 2011-05-25 09:41+0200\n"
    88"PO-Revision-Date: 2007-01-08 01:49+0100\n"
    99"Last-Translator: Renato Pavicic <renato@translator-shop.org>\n"
     
    5555#. i18n: ectx: Menu (object_order)
    5656#. +> trunk stable
    57 #: data/karbon.rc:16 data/karbon.rc:76
     57#: data/karbon.rc:16 data/karbon.rc:78
    5858msgid "&Order"
    5959msgstr "&Redoslijed"
     
    6161#. i18n: ectx: Menu (object_align)
    6262#. +> trunk stable
    63 #: data/karbon.rc:23 data/karbon.rc:83
     63#: data/karbon.rc:23 data/karbon.rc:85
    6464msgid "&Align"
    6565msgstr "&Poravnanje"
     
    8181#. i18n: ectx: Menu (view)
    8282#. +> trunk stable
    83 #: data/karbon.rc:50 data/karbon_readonly.rc:17
     83#: data/karbon.rc:52 data/karbon_readonly.rc:17
    8484#, fuzzy
    8585msgid "&View"
     
    8888#. i18n: ectx: Menu (object)
    8989#. +> trunk stable
    90 #: data/karbon.rc:73
     90#: data/karbon.rc:75
    9191msgid "&Object"
    9292msgstr "&Objekt 
"
     
    9494#. i18n: ectx: Menu (object_distribute)
    9595#. +> trunk stable
    96 #: data/karbon.rc:93
     96#: data/karbon.rc:95
    9797msgid "&Distribute"
    9898msgstr ""
     
    100100#. i18n: ectx: Menu (path)
    101101#. +> trunk stable
    102 #: data/karbon.rc:112
     102#: data/karbon.rc:114
    103103#, fuzzy
    104104msgid "&Path"
     
    107107#. i18n: ectx: Menu (effects)
    108108#. +> trunk stable
    109 #: data/karbon.rc:126
     109#: data/karbon.rc:128
    110110#, fuzzy
    111111msgid "Effe&cts"
     
    114114#. i18n: ectx: Menu (settings)
    115115#. +> trunk stable
    116 #: data/karbon.rc:128
     116#: data/karbon.rc:130
    117117#, fuzzy
    118118msgid "&Settings"
     
    121121#. i18n: ectx: ToolBar (edit_toolbar)
    122122#. +> trunk stable
    123 #: data/karbon.rc:136
     123#: data/karbon.rc:138
    124124#, fuzzy
    125125msgid "Edit"
     
    128128#. i18n: ectx: ToolBar (object_toolbar)
    129129#. +> trunk stable
    130 #: data/karbon.rc:146
     130#: data/karbon.rc:148
    131131msgid "Object"
    132132msgstr "Objekt"
     
    134134#. i18n: ectx: ToolBar (align_toolbar)
    135135#. +> trunk stable
    136 #: data/karbon.rc:155
     136#: data/karbon.rc:157
    137137#, fuzzy
    138138msgid "Align"
     
    141141#. i18n: ectx: ToolBar (Effects)
    142142#. +> trunk stable
    143 #: data/karbon.rc:164
     143#: data/karbon.rc:166
    144144msgid "Effects"
    145145msgstr "Efekti"
     
    988988
    989989#. +> trunk
    990 #: ui/KarbonView.cpp:703 ui/KarbonView.cpp:1029
     990#: ui/KarbonView.cpp:703 ui/KarbonView.cpp:1033
    991991#, fuzzy
    992992msgid "Mirror Horizontally"
     
    994994
    995995#. +> trunk
    996 #: ui/KarbonView.cpp:705 ui/KarbonView.cpp:1025
     996#: ui/KarbonView.cpp:705 ui/KarbonView.cpp:1029
    997997#, fuzzy
    998998msgid "Mirror Vertically"
     
    10321032msgstr "O&briši"
    10331033
    1034 #. +> trunk stable
    1035 #: ui/KarbonView.cpp:952
     1034#. +> trunk
     1035#: ui/KarbonView.cpp:950
     1036#, fuzzy
     1037#| msgid "End Time"
     1038msgid "Edit Guides"
     1039msgstr "ZavrÅ¡no vrijeme:"
     1040
     1041#. +> trunk stable
     1042#: ui/KarbonView.cpp:956
    10361043#, fuzzy
    10371044#| msgid "&Duplicate"
     
    10411048
    10421049#. +> trunk stable
    1043 #: ui/KarbonView.cpp:957
     1050#: ui/KarbonView.cpp:961
    10441051msgid "Distribute Center (Horizontal)"
    10451052msgstr ""
    10461053
    10471054#. +> trunk stable
    1048 #: ui/KarbonView.cpp:961
     1055#: ui/KarbonView.cpp:965
    10491056msgid "Distribute Gaps (Horizontal)"
    10501057msgstr ""
    10511058
    10521059#. +> trunk stable
    1053 #: ui/KarbonView.cpp:965
     1060#: ui/KarbonView.cpp:969
    10541061#, fuzzy
    10551062msgid "Distribute Left Borders"
     
    10571064
    10581065#. +> trunk stable
    1059 #: ui/KarbonView.cpp:969
     1066#: ui/KarbonView.cpp:973
    10601067#, fuzzy
    10611068msgid "Distribute Right Borders"
     
    10631070
    10641071#. +> trunk stable
    1065 #: ui/KarbonView.cpp:973
     1072#: ui/KarbonView.cpp:977
    10661073msgid "Distribute Center (Vertical)"
    10671074msgstr ""
    10681075
    10691076#. +> trunk stable
    1070 #: ui/KarbonView.cpp:977
     1077#: ui/KarbonView.cpp:981
    10711078msgid "Distribute Gaps (Vertical)"
    10721079msgstr ""
    10731080
    10741081#. +> trunk stable
    1075 #: ui/KarbonView.cpp:981
     1082#: ui/KarbonView.cpp:985
    10761083#, fuzzy
    10771084msgid "Distribute Bottom Borders"
     
    10791086
    10801087#. +> trunk stable
    1081 #: ui/KarbonView.cpp:985
     1088#: ui/KarbonView.cpp:989
    10821089#, fuzzy
    10831090msgid "Distribute Top Borders"
     
    10851092
    10861093#. +> trunk stable
    1087 #: ui/KarbonView.cpp:989
     1094#: ui/KarbonView.cpp:993
    10881095msgid "Show Rulers"
    10891096msgstr "P&odnoÅŸje"
    10901097
    10911098#. +> trunk stable
    1092 #: ui/KarbonView.cpp:991
     1099#: ui/KarbonView.cpp:995
    10931100#, fuzzy
    10941101msgid "Hide Rulers"
     
    10961103
    10971104#. +> trunk stable
    1098 #: ui/KarbonView.cpp:992
     1105#: ui/KarbonView.cpp:996
    10991106#, fuzzy
    11001107msgid "Shows or hides rulers"
     
    11021109
    11031110#. +> trunk stable
    1104 #: ui/KarbonView.cpp:1003
     1111#: ui/KarbonView.cpp:1007
    11051112msgid "Snap to Grid"
    11061113msgstr "Poravnaj s rešetkom"
    11071114
    11081115#. +> trunk stable
    1109 #: ui/KarbonView.cpp:1005
     1116#: ui/KarbonView.cpp:1009
    11101117#, fuzzy
    11111118msgid "Snaps to grid"
     
    11131120
    11141121#. +> trunk
    1115 #: ui/KarbonView.cpp:1017
     1122#: ui/KarbonView.cpp:1021
    11161123#, fuzzy
    11171124msgid "&Clip Object"
     
    11191126
    11201127#. +> trunk
    1121 #: ui/KarbonView.cpp:1021
     1128#: ui/KarbonView.cpp:1025
    11221129#, fuzzy
    11231130#| msgid "&Group Objects"
     
    11261133
    11271134#. +> trunk stable
    1128 #: ui/KarbonView.cpp:1036
     1135#: ui/KarbonView.cpp:1040
    11291136#, fuzzy
    11301137msgid "&Close Path"
     
    11321139
    11331140#. +> trunk stable
    1134 #: ui/KarbonView.cpp:1042
     1141#: ui/KarbonView.cpp:1046
    11351142msgid "Com&bine Path"
    11361143msgstr ""
    11371144
    11381145#. +> trunk stable
    1139 #: ui/KarbonView.cpp:1048
     1146#: ui/KarbonView.cpp:1052
    11401147msgid "Se&parate Path"
    11411148msgstr ""
    11421149
    11431150#. +> trunk stable
    1144 #: ui/KarbonView.cpp:1054
     1151#: ui/KarbonView.cpp:1058
    11451152msgid "Re&verse Path"
    11461153msgstr ""
    11471154
    11481155#. +> trunk stable
    1149 #: ui/KarbonView.cpp:1060
     1156#: ui/KarbonView.cpp:1064
    11501157msgid "Intersect Paths"
    11511158msgstr ""
    11521159
    11531160#. +> trunk stable
    1154 #: ui/KarbonView.cpp:1066
     1161#: ui/KarbonView.cpp:1070
    11551162#, fuzzy
    11561163msgid "Subtract Paths"
     
    11581165
    11591166#. +> trunk stable
    1160 #: ui/KarbonView.cpp:1072
     1167#: ui/KarbonView.cpp:1076
    11611168msgid "Unite Paths"
    11621169msgstr ""
    11631170
    11641171#. +> trunk stable
    1165 #: ui/KarbonView.cpp:1078
     1172#: ui/KarbonView.cpp:1082
    11661173msgid "Exclude Paths"
    11671174msgstr ""
    11681175
    11691176#. +> trunk stable
    1170 #: ui/KarbonView.cpp:1084
     1177#: ui/KarbonView.cpp:1088
    11711178#, fuzzy
    11721179#| msgid "Snap to Grid"
     
    11751182
    11761183#. +> trunk stable
    1177 #: ui/KarbonView.cpp:1091
     1184#: ui/KarbonView.cpp:1095
    11781185msgid "Configure Karbon..."
    11791186msgstr ""
    11801187
    11811188#. +> trunk stable
    1182 #: ui/KarbonView.cpp:1095
     1189#: ui/KarbonView.cpp:1099
    11831190msgid "Page &Layout..."
    11841191msgstr ""
    11851192
    11861193#. +> trunk stable
    1187 #: ui/KarbonView.cpp:1100
     1194#: ui/KarbonView.cpp:1104
    11881195#, fuzzy
    11891196#| msgid "Selection"
     
    11921199
    11931200#. +> trunk stable
    1194 #: ui/KarbonView.cpp:1104
     1201#: ui/KarbonView.cpp:1108
    11951202msgid "Zoom to Drawing"
    11961203msgstr ""
  • kde-croatia/kde4/summit/hr/summit/messages/koffice/koffice.po

    r1031 r1036  
    66"Project-Id-Version: koffice 0\n"
    77"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    8 "POT-Creation-Date: 2011-05-22 08:40+0200\n"
     8"POT-Creation-Date: 2011-05-25 09:41+0200\n"
    99"PO-Revision-Date: 2009-09-29 20:45+0200\n"
    1010"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     
    42134213msgstr "Informacije o dokumentu"
    42144214
     4215#. +> trunk
     4216#: pigment/compositeops/KoCompositeOpInversedSubtract.h:37
     4217#, fuzzy
     4218msgid "Inverse Subtract"
     4219msgstr "Informacije o dokumentu"
     4220
    42154221#. +> trunk stable
    42164222#: pigment/compositeops/KoCompositeOpOver.h:61
     
    57825788
    57835789#. +> trunk
    5784 #: main/KoFindText.cpp:100
     5790#: main/KoFindText.cpp:101
    57855791#, fuzzy
    57865792msgid "Case Sensitive"
     
    57885794
    57895795#. +> trunk
    5790 #: main/KoFindText.cpp:100
     5796#: main/KoFindText.cpp:101
    57915797#, fuzzy
    57925798msgid "Match cases when searching"
     
    57945800
    57955801#. +> trunk
    5796 #: main/KoFindText.cpp:101
     5802#: main/KoFindText.cpp:102
    57975803#, fuzzy
    57985804msgid "Whole Words Only"
     
    58005806
    58015807#. +> trunk
    5802 #: main/KoFindText.cpp:101
     5808#: main/KoFindText.cpp:102
    58035809#, fuzzy
    58045810msgid "Match only whole words"
     
    60006006
    60016007#. +> trunk
    6002 #: pigment/compositeops/KoCompositeOps.h:105
     6008#: pigment/compositeops/KoCompositeOps.h:102
     6009#, fuzzy
     6010msgid "Inversed-Subtract"
     6011msgstr "Informacije o dokumentu"
     6012
     6013#. +> trunk
     6014#: pigment/compositeops/KoCompositeOps.h:106
    60036015#, fuzzy
    60046016msgid "Arcus Tangent"
     
    60066018
    60076019#. +> trunk
    6008 #: pigment/compositeops/KoCompositeOps.h:106
     6020#: pigment/compositeops/KoCompositeOps.h:107
    60096021#, fuzzy
    60106022msgid "Difference"
     
    60126024
    60136025#. +> trunk
    6014 #: pigment/compositeops/KoCompositeOps.h:107
     6026#: pigment/compositeops/KoCompositeOps.h:108
    60156027#, fuzzy
    60166028msgid "Exclusion"
     
    60186030
    60196031#. +> trunk
    6020 #: pigment/compositeops/KoCompositeOps.h:108
     6032#: pigment/compositeops/KoCompositeOps.h:109
    60216033#, fuzzy
    60226034msgid "Equivalence"
     
    60246036
    60256037#. +> trunk
    6026 #: pigment/compositeops/KoCompositeOps.h:109
     6038#: pigment/compositeops/KoCompositeOps.h:110
    60276039#, fuzzy
    60286040msgid "Additive-Substractive"
     
    60306042
    60316043#. +> trunk
    6032 #: pigment/compositeops/KoCompositeOps.h:114
    6033 #, fuzzy
    6034 msgid "Copy Alpha"
    6035 msgstr "Postavi sve"
    6036 
    6037 #. +> trunk
    6038 #: pigment/compositeops/KoCompositeOps.h:139
     6044#: pigment/compositeops/KoCompositeOps.h:137
    60396045#, fuzzy
    60406046msgid "Copy Red"
     
    60426048
    60436049#. +> trunk
    6044 #: pigment/compositeops/KoCompositeOps.h:140
     6050#: pigment/compositeops/KoCompositeOps.h:138
    60456051#, fuzzy
    60466052msgid "Copy Green"
     
    60486054
    60496055#. +> trunk
    6050 #: pigment/compositeops/KoCompositeOps.h:141
     6056#: pigment/compositeops/KoCompositeOps.h:139
    60516057#, fuzzy
    60526058msgid "Copy Blue"
     
    60546060
    60556061#. +> trunk
    6056 #: pigment/compositeops/KoCompositeOps.h:146
     6062#: pigment/compositeops/KoCompositeOps.h:144
    60576063#, fuzzy
    60586064msgid "Increase Saturation"
     
    60606066
    60616067#. +> trunk
    6062 #: pigment/compositeops/KoCompositeOps.h:147
     6068#: pigment/compositeops/KoCompositeOps.h:145
    60636069#, fuzzy
    60646070msgid "Decrease Saturation"
     
    60666072
    60676073#. +> trunk
    6068 #: pigment/compositeops/KoCompositeOps.h:148
     6074#: pigment/compositeops/KoCompositeOps.h:146
    60696075#, fuzzy
    60706076msgid "Luminosity"
     
    60726078
    60736079#. +> trunk
    6074 #: pigment/compositeops/KoCompositeOps.h:149
     6080#: pigment/compositeops/KoCompositeOps.h:147
    60756081#, fuzzy
    60766082msgid "Increase Luminosity"
     
    60786084
    60796085#. +> trunk
    6080 #: pigment/compositeops/KoCompositeOps.h:150
     6086#: pigment/compositeops/KoCompositeOps.h:148
    60816087#, fuzzy
    60826088msgid "Decrease Luminosity"
     
    60846090
    60856091#. +> trunk
    6086 #: pigment/compositeops/KoCompositeOps.h:152
     6092#: pigment/compositeops/KoCompositeOps.h:150
    60876093#, fuzzy
    60886094msgid "Color HSI"
     
    60906096
    60916097#. +> trunk
    6092 #: pigment/compositeops/KoCompositeOps.h:153
     6098#: pigment/compositeops/KoCompositeOps.h:151
    60936099#, fuzzy
    60946100msgid "Hue HSI"
     
    60966102
    60976103#. +> trunk
    6098 #: pigment/compositeops/KoCompositeOps.h:154
     6104#: pigment/compositeops/KoCompositeOps.h:152
    60996105#, fuzzy
    61006106msgid "Saturation HSI"
     
    61026108
    61036109#. +> trunk
    6104 #: pigment/compositeops/KoCompositeOps.h:155
     6110#: pigment/compositeops/KoCompositeOps.h:153
    61056111#, fuzzy
    61066112msgid "Increase Saturation HSI"
     
    61086114
    61096115#. +> trunk
    6110 #: pigment/compositeops/KoCompositeOps.h:156
     6116#: pigment/compositeops/KoCompositeOps.h:154
    61116117#, fuzzy
    61126118msgid "Decrease Saturation HSI"
     
    61146120
    61156121#. +> trunk
    6116 #: pigment/compositeops/KoCompositeOps.h:157
     6122#: pigment/compositeops/KoCompositeOps.h:155
    61176123#, fuzzy
    61186124msgid "Intensity"
     
    61206126
    61216127#. +> trunk
    6122 #: pigment/compositeops/KoCompositeOps.h:158
     6128#: pigment/compositeops/KoCompositeOps.h:156
    61236129#, fuzzy
    61246130#| msgid "Change Indent"
     
    61276133
    61286134#. +> trunk
    6129 #: pigment/compositeops/KoCompositeOps.h:159
     6135#: pigment/compositeops/KoCompositeOps.h:157
    61306136#, fuzzy
    61316137#| msgid "Change Indent"
     
    61346140
    61356141#. +> trunk
    6136 #: pigment/compositeops/KoCompositeOps.h:161
     6142#: pigment/compositeops/KoCompositeOps.h:159
    61376143#, fuzzy
    61386144msgid "Color HSL"
     
    61406146
    61416147#. +> trunk
    6142 #: pigment/compositeops/KoCompositeOps.h:162
     6148#: pigment/compositeops/KoCompositeOps.h:160
    61436149#, fuzzy
    61446150msgid "Hue HSL"
     
    61466152
    61476153#. +> trunk
    6148 #: pigment/compositeops/KoCompositeOps.h:163
     6154#: pigment/compositeops/KoCompositeOps.h:161
    61496155#, fuzzy
    61506156msgid "Saturation HSL"
     
    61526158
    61536159#. +> trunk
    6154 #: pigment/compositeops/KoCompositeOps.h:164
     6160#: pigment/compositeops/KoCompositeOps.h:162
    61556161#, fuzzy
    61566162msgid "Increase Saturation HSL"
     
    61586164
    61596165#. +> trunk
    6160 #: pigment/compositeops/KoCompositeOps.h:165
     6166#: pigment/compositeops/KoCompositeOps.h:163
    61616167#, fuzzy
    61626168msgid "Decrease Saturation HSL"
     
    61646170
    61656171#. +> trunk
    6166 #: pigment/compositeops/KoCompositeOps.h:167
     6172#: pigment/compositeops/KoCompositeOps.h:165
    61676173#, fuzzy
    61686174msgid "Increase Lightness"
     
    61706176
    61716177#. +> trunk
    6172 #: pigment/compositeops/KoCompositeOps.h:168
     6178#: pigment/compositeops/KoCompositeOps.h:166
    61736179#, fuzzy
    61746180msgid "Decrease Lightness"
     
    61766182
    61776183#. +> trunk
    6178 #: pigment/compositeops/KoCompositeOps.h:170
     6184#: pigment/compositeops/KoCompositeOps.h:168
    61796185#, fuzzy
    61806186msgid "Color HSV"
     
    61826188
    61836189#. +> trunk
    6184 #: pigment/compositeops/KoCompositeOps.h:171
     6190#: pigment/compositeops/KoCompositeOps.h:169
    61856191#, fuzzy
    61866192msgid "Hue HSV"
     
    61886194
    61896195#. +> trunk
    6190 #: pigment/compositeops/KoCompositeOps.h:172
     6196#: pigment/compositeops/KoCompositeOps.h:170
    61916197#, fuzzy
    61926198msgid "Saturation HSV"
     
    61946200
    61956201#. +> trunk
    6196 #: pigment/compositeops/KoCompositeOps.h:173
     6202#: pigment/compositeops/KoCompositeOps.h:171
    61976203#, fuzzy
    61986204msgid "Increase Saturation HSV"
     
    62006206
    62016207#. +> trunk
    6202 #: pigment/compositeops/KoCompositeOps.h:174
     6208#: pigment/compositeops/KoCompositeOps.h:172
    62036209#, fuzzy
    62046210msgid "Decrease Saturation HSV"
     
    62066212
    62076213#. +> trunk
    6208 #: pigment/compositeops/KoCompositeOps.h:175
     6214#: pigment/compositeops/KoCompositeOps.h:173
    62096215msgid "Value"
    62106216msgstr "Vrijednost"
    62116217
    62126218#. +> trunk
    6213 #: pigment/compositeops/KoCompositeOps.h:176
     6219#: pigment/compositeops/KoCompositeOps.h:174
    62146220#, fuzzy
    62156221msgid "Increase Value"
     
    62176223
    62186224#. +> trunk
    6219 #: pigment/compositeops/KoCompositeOps.h:177
     6225#: pigment/compositeops/KoCompositeOps.h:175
    62206226#, fuzzy
    62216227msgid "Decrease Value"
     
    64656471msgid "Set miter limit"
    64666472msgstr "došao do internog ograničenja"
     6473
     6474#, fuzzy
     6475#~ msgid "Copy Alpha"
     6476#~ msgstr "Postavi sve"
    64676477
    64686478#, fuzzy
  • kde-croatia/kde4/summit/hr/summit/messages/koffice/krita.po

    r1032 r1036  
    77"Project-Id-Version: krita 0\n"
    88"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    9 "POT-Creation-Date: 2011-05-23 09:11+0200\n"
     9"POT-Creation-Date: 2011-05-25 09:41+0200\n"
    1010"PO-Revision-Date: 2011-03-18 18:21+0100\n"
    1111"Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
     
    16551655#. i18n: ectx: Menu (view_fast_grid_config)
    16561656#. +> trunk stable
    1657 #: krita.rc:53
     1657#: krita.rc:52
    16581658#, fuzzy
    16591659msgid "Grid Spacing"
     
    16621662#. i18n: ectx: Menu (Image)
    16631663#. +> trunk stable
    1664 #: krita.rc:73 plugins/colorspaces/lms_f32/lms_f32_plugin.rc:3
     1664#: krita.rc:72 plugins/colorspaces/lms_f32/lms_f32_plugin.rc:3
    16651665#: plugins/extensions/colorspaceconversion/colorspaceconversion.rc:4
    16661666#: plugins/extensions/dockers/trianglecolorselector/trianglecolorselector.rc:4
     
    16731673#. i18n: ectx: Menu (Layer)
    16741674#. +> trunk stable
    1675 #: krita.rc:84 plugins/extensions/bracketing2hdr/bracketing2hdr.rc:4
     1675#: krita.rc:83 plugins/extensions/bracketing2hdr/bracketing2hdr.rc:4
    16761676#: plugins/extensions/dockers/defaultdockers/kis_layer_box.cpp:310
    16771677#: plugins/extensions/histogram/histogram.rc:4
     
    16821682#. i18n: ectx: Menu (LayerNew)
    16831683#. +> trunk stable
    1684 #: krita.rc:85 plugins/extensions/bracketing2hdr/bracketing2hdr.rc:5
     1684#: krita.rc:84 plugins/extensions/bracketing2hdr/bracketing2hdr.rc:5
    16851685#, fuzzy
    16861686msgid "New"
     
    16901690#. i18n: ectx: Menu (Select)
    16911691#. +> trunk stable
    1692 #: krita.rc:110 plugins/extensions/colorrange/wdg_colorrange.ui:133
     1692#: krita.rc:109 plugins/extensions/colorrange/wdg_colorrange.ui:133
    16931693#: plugins/extensions/imagesize/imagesize.rc:12
    16941694#: plugins/extensions/modify_selection/modify_selection.rc:4
     
    16991699#. i18n: ectx: Menu (Filter)
    17001700#. +> trunk stable
    1701 #: krita.rc:124
     1701#: krita.rc:123
    17021702#, fuzzy
    17031703msgid "Filte&r"
     
    17061706#. i18n: ectx: Menu (Tools)
    17071707#. +> trunk stable
    1708 #: krita.rc:141 plugins/extensions/extensionsmanager/extensionsmanager.rc:4
     1708#: krita.rc:140 plugins/extensions/extensionsmanager/extensionsmanager.rc:4
    17091709#, fuzzy
    17101710msgid "&Tools"
     
    17141714#. i18n: ectx: Menu (settings)
    17151715#. +> trunk stable
    1716 #: krita.rc:144 plugins/filters/bumpmap/wdgbumpmap.ui:115
     1716#: krita.rc:143 plugins/filters/bumpmap/wdgbumpmap.ui:115
    17171717msgid "Settings"
    17181718msgstr "Postavke"
     
    17201720#. i18n: ectx: Menu (help)
    17211721#. +> trunk stable
    1722 #: krita.rc:150
     1722#: krita.rc:151
    17231723#, fuzzy
    17241724msgid "&Help"
     
    17271727#. i18n: ectx: ToolBar (BrushesAndStuff)
    17281728#. +> trunk stable
    1729 #: krita.rc:158
     1729#: krita.rc:159
    17301730msgid "Brushes and Stuff"
    17311731msgstr ""
     
    23052305#: plugins/extensions/bracketing2hdr/wdgbracketing2hdr.ui:162
    23062306#: plugins/extensions/tonemapping/wdgtonemappingdialog.ui:93
    2307 #: ui/forms/wdgfilterdialog.ui:70 ui/kis_view2.cpp:398
     2307#: ui/forms/wdgfilterdialog.ui:70 ui/kis_view2.cpp:412
    23082308#, fuzzy
    23092309msgid "Cancel"
     
    27642764
    27652765#. +> trunk stable
    2766 #: plugins/extensions/dockers/advancedcolorselector/kis_shade_selector_line.cpp:155
     2766#: plugins/extensions/dockers/advancedcolorselector/kis_shade_selector_line.cpp:154
    27672767#, kde-format
    27682768msgid "delta h=%1 s=%2 v=%3 shift h=%4 s=%5 v=%6"
     
    1397813978
    1397913979#. +> trunk stable
    13980 #: ui/kis_view2.cpp:206
     13980#: ui/kis_view2.cpp:207
    1398113981msgid "Total Refresh"
    1398213982msgstr ""
    1398313983
    1398413984#. +> trunk stable
    13985 #: ui/kis_view2.cpp:211
     13985#: ui/kis_view2.cpp:212
    1398613986#, fuzzy
    1398713987msgid "&Create Template From Image..."
     
    1398913989
    1399013990#. +> trunk stable
    13991 #: ui/kis_view2.cpp:215
     13991#: ui/kis_view2.cpp:216
    1399213992#, fuzzy
    1399313993msgid "Load Tutorial"
     
    1399513995
    1399613996#. +> trunk stable
    13997 #: ui/kis_view2.cpp:264
     13997#: ui/kis_view2.cpp:265
    1399813998#, fuzzy
    1399913999msgid "Mirror Image"
     
    1401814018msgstr "&Bijela"
    1401914019
     14020#. +> trunk
     14021#: ui/kis_view2.cpp:286
     14022#, fuzzy
     14023msgid "Show Status Bar"
     14024msgstr "PrikaÅŸi podnoÅŸje"
     14025
     14026#. +> trunk
     14027#: ui/kis_view2.cpp:287
     14028#, fuzzy
     14029#| msgid "Show &status bar"
     14030msgid "Hide Status Bar"
     14031msgstr "&PrikaÅŸi traku stanja"
     14032
    1402014033#. +> stable
    1402114034#: ui/kis_view2.cpp:287
     
    1402414037msgstr "&Alat za linije"
    1402514038
    14026 #. +> trunk stable
    14027 #: ui/kis_view2.cpp:392
     14039#. +> trunk
     14040#: ui/kis_view2.cpp:289
     14041#, fuzzy
     14042#| msgid "Show &status bar"
     14043msgid "Shows or hides the status bar"
     14044msgstr "&PrikaÅŸi traku stanja"
     14045
     14046#. +> trunk
     14047#: ui/kis_view2.cpp:293
     14048#, fuzzy
     14049msgid "Show Canvas Only"
     14050msgstr "Danas"
     14051
     14052#. +> trunk
     14053#: ui/kis_view2.cpp:294
     14054#, fuzzy
     14055msgid "Return to Window"
     14056msgstr "Podprozor"
     14057
     14058#. +> trunk
     14059#: ui/kis_view2.cpp:295
     14060#, fuzzy
     14061msgid "Shows just the canvas or the whole window"
     14062msgstr "PokaÅŸi ili sakrij traku izbornika u prozoru terminala"
     14063
     14064#. +> trunk stable
     14065#: ui/kis_view2.cpp:406
    1402814066#, fuzzy
    1402914067msgid "Insert as New Layer"
     
    1403114069
    1403214070#. +> trunk stable
    14033 #: ui/kis_view2.cpp:393
     14071#: ui/kis_view2.cpp:407
    1403414072#, fuzzy
    1403514073msgid "Insert as New Layers"
     
    1403714075
    1403814076#. +> trunk stable
    14039 #: ui/kis_view2.cpp:395
     14077#: ui/kis_view2.cpp:409
    1404014078msgid "Open in New Document"
    1404114079msgstr ""
    1404214080
    1404314081#. +> trunk stable
    14044 #: ui/kis_view2.cpp:396
     14082#: ui/kis_view2.cpp:410
    1404514083msgid "Open in New Documents"
    1404614084msgstr ""
    1404714085
    1404814086#. +> trunk stable
    14049 #: ui/kis_view2.cpp:606
     14087#: ui/kis_view2.cpp:620
    1405014088#, fuzzy
    1405114089msgid "Edit Palette..."
     
    1405314091
    1405414092#. +> trunk stable
    14055 #: ui/kis_view2.cpp:721 ui/kis_view2.cpp:724
     14093#: ui/kis_view2.cpp:735 ui/kis_view2.cpp:738
    1405614094#, fuzzy
    1405714095msgid "Edit Palette"
  • kde-croatia/kde4/summit/hr/summit/messages/koffice/kword.po

    r1030 r1036  
    66"Project-Id-Version: kword 0\n"
    77"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    8 "POT-Creation-Date: 2011-05-21 08:10+0200\n"
     8"POT-Creation-Date: 2011-05-25 09:42+0200\n"
    99"PO-Revision-Date: 2009-09-29 21:20+0200\n"
    1010"Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
     
    648648#. i18n: ectx: property (text), widget (QPushButton, createButton)
    649649#. +> trunk stable
    650 #: part/dialogs/KWStartupWidget.ui:102 part/KWView.cpp:330
     650#: part/dialogs/KWStartupWidget.ui:102 part/KWView.cpp:334
    651651msgid "Create"
    652652msgstr "Napravi"
     
    753753#. +> trunk stable
    754754#: part/dialogs/KWStatisticsDialog.cpp:29
    755 #: part/dockers/KWStatisticsDocker.cpp:36 part/KWView.cpp:404
     755#: part/dockers/KWStatisticsDocker.cpp:36 part/KWView.cpp:408
    756756msgid "Statistics"
    757757msgstr "Statistike"
     
    15671567
    15681568#. +> trunk stable
    1569 #: part/KWView.cpp:256
     1569#: part/KWView.cpp:260
    15701570#, fuzzy
    15711571msgid "Frame/Frameset Properties"
     
    15731573
    15741574#. +> trunk stable
    1575 #: part/KWView.cpp:258
     1575#: part/KWView.cpp:262
    15761576#, fuzzy
    15771577msgid "Alter frameset properties"
     
    15851585
    15861586#. +> trunk stable
    1587 #: part/KWView.cpp:266
     1587#: part/KWView.cpp:270
    15881588msgid "Page Break"
    15891589msgstr "Prijelom stranice"
    15901590
    15911591#. +> trunk stable
    1592 #: part/KWView.cpp:267
     1592#: part/KWView.cpp:271
    15931593msgid "Force the remainder of the text into the next page"
    15941594msgstr ""
    15951595
    15961596#. +> trunk stable
    1597 #: part/KWView.cpp:268
     1597#: part/KWView.cpp:272
    15981598msgid "All text after this point will be moved into the next page."
    15991599msgstr ""
    16001600
    16011601#. +> trunk stable
    1602 #: part/KWView.cpp:270
     1602#: part/KWView.cpp:274
    16031603msgid "Enable Document Headers"
    16041604msgstr "Omogući zaglavlja dokumenta"
    16051605
    16061606#. +> trunk stable
    1607 #: part/KWView.cpp:272
     1607#: part/KWView.cpp:276
    16081608msgid "Disable Document Headers"
    16091609msgstr "Onemogući zaglavlja dokumenta"
    16101610
    16111611#. +> trunk stable
    1612 #: part/KWView.cpp:273
     1612#: part/KWView.cpp:277
    16131613#, fuzzy
    16141614msgid "Shows and hides header display"
     
    16161616
    16171617#. +> trunk
    1618 #: part/KWView.cpp:274
     1618#: part/KWView.cpp:278
    16191619msgid "Selecting this option toggles the display of headers in Words.<br/><br/>Headers are special frames at the top of each page which can contain page numbers or other information."
    16201620msgstr ""
     
    16311631
    16321632#. +> trunk stable
    1633 #: part/KWView.cpp:279
     1633#: part/KWView.cpp:283
    16341634msgid "Enable Document Footers"
    16351635msgstr "Omogući podnoÅŸja dokumenta"
    16361636
    16371637#. +> trunk stable
    1638 #: part/KWView.cpp:281
     1638#: part/KWView.cpp:285
    16391639msgid "Disable Document Footers"
    16401640msgstr "Omogući podnoÅŸja dokumenta"
    16411641
    16421642#. +> trunk stable
    1643 #: part/KWView.cpp:282
     1643#: part/KWView.cpp:286
    16441644#, fuzzy
    16451645msgid "Shows and hides footer display"
     
    16471647
    16481648#. +> trunk
    1649 #: part/KWView.cpp:283
     1649#: part/KWView.cpp:287
    16501650msgid "Selecting this option toggles the display of footers in Words. <br/><br/>Footers are special frames at the bottom of each page which can contain page numbers or other information."
    16511651msgstr ""
     
    16621662
    16631663#. +> trunk stable
    1664 #: part/KWView.cpp:288
     1664#: part/KWView.cpp:292
    16651665#, fuzzy
    16661666msgid "Snap to Grid"
     
    16681668
    16691669#. +> trunk stable
    1670 #: part/KWView.cpp:293
     1670#: part/KWView.cpp:297
    16711671#, fuzzy
    16721672msgid "Raise Frame"
     
    16801680
    16811681#. +> trunk stable
    1682 #: part/KWView.cpp:296
     1682#: part/KWView.cpp:300
    16831683#, fuzzy
    16841684msgid "Raise the currently selected frame so that it appears above all the other frames"
     
    16921692
    16931693#. +> trunk stable
    1694 #: part/KWView.cpp:298
     1694#: part/KWView.cpp:302
    16951695msgid "Raise the currently selected frame so that it appears above all the other frames. This is only useful if frames overlap each other. If multiple frames are selected they are all raised in turn."
    16961696msgstr ""
     
    17021702
    17031703#. +> trunk stable
    1704 #: part/KWView.cpp:303
     1704#: part/KWView.cpp:307
    17051705#, fuzzy
    17061706msgid "Lower Frame"
     
    17141714
    17151715#. +> trunk stable
    1716 #: part/KWView.cpp:306
     1716#: part/KWView.cpp:310
    17171717msgid "Lower the currently selected frame so that it disappears under any frame that overlaps it"
    17181718msgstr ""
     
    17251725
    17261726#. +> trunk stable
    1727 #: part/KWView.cpp:308
     1727#: part/KWView.cpp:312
    17281728msgid "Lower the currently selected frame so that it disappears under any frame that overlaps it. If multiple frames are selected they are all lowered in turn."
    17291729msgstr ""
     
    17351735
    17361736#. +> trunk stable
    1737 #: part/KWView.cpp:312
     1737#: part/KWView.cpp:316
    17381738msgid "Bring to Front"
    17391739msgstr "Stavi ispred"
    17401740
    17411741#. +> trunk stable
    1742 #: part/KWView.cpp:316
     1742#: part/KWView.cpp:320
    17431743msgid "Send to Back"
    17441744msgstr "Pošalji unazad"
    17451745
    17461746#. +> trunk stable
    1747 #: part/KWView.cpp:320
     1747#: part/KWView.cpp:324
    17481748msgid "Variable"
    17491749msgstr "Varijabla"
    17501750
    17511751#. +> trunk stable
    1752 #: part/KWView.cpp:338
     1752#: part/KWView.cpp:342
    17531753msgid "Bookmark..."
    17541754msgstr "Oznaka 
"
    17551755
    17561756#. +> trunk stable
    1757 #: part/KWView.cpp:343
     1757#: part/KWView.cpp:347
    17581758#, fuzzy
    17591759msgid "Select Bookmark..."
     
    17611761
    17621762#. +> trunk
    1763 #: part/KWView.cpp:344
     1763#: part/KWView.cpp:348
    17641764#, fuzzy
    17651765msgid "Bookmark"
     
    17671767
    17681768#. +> trunk
    1769 #: part/KWView.cpp:350
     1769#: part/KWView.cpp:354
    17701770#, fuzzy
    17711771msgid "Picture..."
     
    17781778
    17791779#. +> trunk stable
    1780 #: part/KWView.cpp:351
     1780#: part/KWView.cpp:355
    17811781msgid "Insert a picture into document"
    17821782msgstr ""
     
    17891789
    17901790#. +> trunk
    1791 #: part/KWView.cpp:355
     1791#: part/KWView.cpp:359
    17921792msgid "Footnote/Endnote..."
    17931793msgstr ""
    17941794
    17951795#. +> trunk
    1796 #: part/KWView.cpp:356
     1796#: part/KWView.cpp:360
    17971797#, fuzzy
    17981798msgid "Insert a footnote referencing the selected text"
     
    18001800
    18011801#. +> trunk
    1802 #: part/KWView.cpp:360
     1802#: part/KWView.cpp:363
     1803#, fuzzy
     1804msgid "Anchor to Text"
     1805msgstr "Tekst objave"
     1806
     1807#. +> trunk
     1808#: part/KWView.cpp:364
    18031809#, fuzzy
    18041810msgid "Page Borders"
     
    18171823
    18181824#. +> trunk stable
    1819 #: part/KWView.cpp:361
     1825#: part/KWView.cpp:365
    18201826msgid "Turns the border display on and off"
    18211827msgstr ""
     
    18261832msgstr ""
    18271833
    1828 #. +> trunk
    1829 #: part/KWView.cpp:363
    1830 #, fuzzy
    1831 msgid "Anchor to Text"
    1832 msgstr "Tekst objave"
    1833 
    1834 #. +> trunk stable
    1835 #: part/KWView.cpp:366
     1834#. +> trunk stable
     1835#: part/KWView.cpp:370
    18361836msgid "Turns the border display on and off.<br/><br/>The borders are never printed. This option is useful to see how the document will appear on the printed page."
    18371837msgstr ""
    18381838
    18391839#. +> trunk stable
    1840 #: part/KWView.cpp:368
     1840#: part/KWView.cpp:372
    18411841#, fuzzy
    18421842#| msgid "Page &Layout..."
     
    18451845
    18461846#. +> trunk stable
    1847 #: part/KWView.cpp:370
     1847#: part/KWView.cpp:374
    18481848msgid "Change properties of entire page"
    18491849msgstr "Promijeni svojstva cijele stranice"
    18501850
    18511851#. +> trunk stable
    1852 #: part/KWView.cpp:371
     1852#: part/KWView.cpp:375
    18531853msgid "Change properties of the entire page.<p>Currently you can change paper size, paper orientation, header and footer sizes, and column settings.</p>"
    18541854msgstr ""
    18551855
    18561856#. +> trunk stable
    1857 #: part/KWView.cpp:375
     1857#: part/KWView.cpp:379
    18581858#, fuzzy
    18591859msgid "Semantic Stylesheets..."
     
    18611861
    18621862#. +> trunk stable
    1863 #: part/KWView.cpp:377
     1863#: part/KWView.cpp:381
    18641864msgid "Modify and add semantic stylesheets"
    18651865msgstr ""
    18661866
    18671867#. +> trunk stable
    1868 #: part/KWView.cpp:378
     1868#: part/KWView.cpp:382
    18691869msgid "Stylesheets are used to format contact, event, and location information which is stored in Rdf"
    18701870msgstr ""
    18711871
    18721872#. +> trunk stable
    1873 #: part/KWView.cpp:382
     1873#: part/KWView.cpp:386
    18741874#, fuzzy
    18751875msgid "Make inline"
     
    18771877
    18781878#. +> trunk stable
    1879 #: part/KWView.cpp:383
     1879#: part/KWView.cpp:387
    18801880#, fuzzy
    18811881msgid "Convert current frame to an inline frame"
     
    18891889
    18901890#. +> trunk stable
    1891 #: part/KWView.cpp:384
     1891#: part/KWView.cpp:388
    18921892msgid "Convert the current frame to an inline frame.<br><br>Place the inline frame within the text at the point nearest to the frames current position."
    18931893msgstr ""
     
    18991899
    19001900#. +> trunk stable
    1901 #: part/KWView.cpp:388
     1901#: part/KWView.cpp:392
    19021902#, fuzzy
    19031903msgid "Previous Page"
     
    19051905
    19061906#. +> trunk stable
    1907 #: part/KWView.cpp:392
     1907#: part/KWView.cpp:396
    19081908#, fuzzy
    19091909msgid "Next Page"
     
    19171917
    19181918#. +> trunk stable
    1919 #: part/KWView.cpp:406
     1919#: part/KWView.cpp:410
    19201920msgid "Sentence, word and letter counts for this document"
    19211921msgstr ""
    19221922
    19231923#. +> trunk stable
    1924 #: part/KWView.cpp:407
     1924#: part/KWView.cpp:411
    19251925msgid "Information on the number of letters, words, syllables and sentences for this document.<p>Evaluates readability using the Flesch reading score.</p>"
    19261926msgstr ""
    19271927
    19281928#. +> trunk stable
    1929 #: part/KWView.cpp:410
     1929#: part/KWView.cpp:414
    19301930msgid "Show Rulers"
    19311931msgstr "P&odnoÅŸje"
    19321932
    19331933#. +> trunk stable
    1934 #: part/KWView.cpp:412
     1934#: part/KWView.cpp:416
    19351935#, fuzzy
    19361936msgid "Shows or hides rulers"
     
    19381938
    19391939#. +> trunk stable
    1940 #: part/KWView.cpp:413
     1940#: part/KWView.cpp:417
    19411941msgid "The rulers are the white measuring spaces top and left of the document. The rulers show the position and width of pages and of frames and can be used to position tabulators among others.<p>Uncheck this to disable the rulers from being displayed.</p>"
    19421942msgstr ""
     
    19481948
    19491949#. +> trunk stable
    1950 #: part/KWView.cpp:421
     1950#: part/KWView.cpp:425
    19511951#, fuzzy
    19521952msgid "Page..."
     
    19541954
    19551955#. +> trunk stable
    1956 #: part/KWView.cpp:425
     1956#: part/KWView.cpp:429
    19571957msgid "Delete Page"
    19581958msgstr "Izbriši tabelu"
    19591959
    19601960#. +> trunk stable
    1961 #: part/KWView.cpp:432
     1961#: part/KWView.cpp:436
    19621962#, fuzzy
    19631963#| msgid "&Formatting Characters"
     
    19661966
    19671967#. +> trunk stable
    1968 #: part/KWView.cpp:436
     1968#: part/KWView.cpp:440
    19691969msgid "Toggle the display of non-printing characters"
    19701970msgstr ""
    19711971
    19721972#. +> trunk
    1973 #: part/KWView.cpp:437
     1973#: part/KWView.cpp:441
    19741974msgid "Toggle the display of non-printing characters.<br/><br/>When this is enabled, Words shows you tabs, spaces, carriage returns and other non-printing characters."
    19751975msgstr ""
     
    19811981
    19821982#. +> trunk stable
    1983 #: part/KWView.cpp:440
     1983#: part/KWView.cpp:444
    19841984#, fuzzy
    19851985msgid "Select All Frames"
     
    19951995#: part/KWView.cpp:445
    19961996#, fuzzy
     1997msgid "Create Custom Outline"
     1998msgstr "Napravi &tabelu"
     1999
     2000#. +> trunk stable
     2001#: part/KWView.cpp:447
     2002msgid "Create a custom vector outline that text will run around"
     2003msgstr ""
     2004
     2005#. +> trunk stable
     2006#: part/KWView.cpp:448
     2007msgid "Text normally runs around the content of a shape, when you want a custom outline that is independent of the content you can create one and alter it with the vector tools"
     2008msgstr ""
     2009
     2010#. +> trunk stable
     2011#: part/KWView.cpp:449
     2012#, fuzzy
    19972013msgid "Delete"
    19982014msgstr "Izbriši Red"
    19992015
    20002016#. +> trunk stable
    2001 #: part/KWView.cpp:445
    2002 #, fuzzy
    2003 msgid "Create Custom Outline"
    2004 msgstr "Napravi &tabelu"
    2005 
    2006 #. +> trunk stable
    2007 #: part/KWView.cpp:447
    2008 msgid "Create a custom vector outline that text will run around"
    2009 msgstr ""
    2010 
    2011 #. +> trunk stable
    2012 #: part/KWView.cpp:448
    2013 msgid "Text normally runs around the content of a shape, when you want a custom outline that is independent of the content you can create one and alter it with the vector tools"
    2014 msgstr ""
    2015 
    2016 #. +> trunk stable
    2017 #: part/KWView.cpp:458 part/KWView.cpp:1226
     2017#: part/KWView.cpp:459
     2018#, fuzzy
     2019msgid "Add Text on Shape"
     2020msgstr "Dodaj tekst&ualnu oznaku"
     2021
     2022#. +> trunk stable
     2023#: part/KWView.cpp:462 part/KWView.cpp:1230
    20182024#, fuzzy
    20192025msgid "Create Linked Copy"
     
    20212027
    20222028#. +> trunk stable
    2023 #: part/KWView.cpp:459
    2024 #, fuzzy
    2025 msgid "Add Text on Shape"
    2026 msgstr "Dodaj tekst&ualnu oznaku"
    2027 
    2028 #. +> trunk stable
    20292029#: part/KWView.cpp:1224
    20302030#, fuzzy
     
    20332033
    20342034#. +> trunk stable
    2035 #: part/KWView.cpp:460
     2035#: part/KWView.cpp:464
    20362036msgid "Create a copy of the current frame, always showing the same contents"
    20372037msgstr ""
     
    20432043
    20442044#. +> trunk stable
    2045 #: part/KWView.cpp:461
     2045#: part/KWView.cpp:465
    20462046msgid "Create a copy of the current frame, that remains linked to it. This means they always show the same contents: modifying the contents in such a frame will update all its linked copies."
    20472047msgstr ""
     
    20532053
    20542054#. +> trunk stable
    2055 #: part/KWView.cpp:464
     2055#: part/KWView.cpp:468
    20562056#, fuzzy
    20572057msgid "Create Frame-clip"
     
    20652065
    20662066#. +> trunk stable
    2067 #: part/KWView.cpp:468
     2067#: part/KWView.cpp:472
    20682068#, fuzzy
    20692069msgid "Remove Frame-clip"
     
    20772077
    20782078#. +> trunk stable
    2079 #: part/KWView.cpp:472
     2079#: part/KWView.cpp:476
    20802080#, fuzzy
    20812081msgid "Show Status Bar"
     
    20832083
    20842084#. +> trunk stable
    2085 #: part/KWView.cpp:473
     2085#: part/KWView.cpp:477
    20862086#, fuzzy
    20872087#| msgid "Show &status bar"
     
    20902090
    20912091#. +> trunk stable
    2092 #: part/KWView.cpp:474
     2092#: part/KWView.cpp:478
    20932093#, fuzzy
    20942094#| msgid "Show &status bar"
     
    20972097
    20982098#. +> trunk stable
    2099 #: part/KWView.cpp:1165
     2099#: part/KWView.cpp:1169
    21002100msgid "Please select at least one non-locked shape and try again"
    21012101msgstr ""
  • kde-croatia/kde4/summit/hr/summit/messages/playground-base/desktop_playground-base.po

    r1021 r1036  
    99"Project-Id-Version: desktop files\n"
    1010"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    11 "POT-Creation-Date: 2011-05-16 09:02+0200\n"
     11"POT-Creation-Date: 2011-05-25 09:42+0200\n"
    1212"PO-Revision-Date: 2010-04-30 19:05+0200\n"
    1313"Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
     
    10921092
    10931093#. +> trunk
    1094 #: plasma/applets/dataengines_tasks/plasma-applet-dataengines_tasks.desktop:8
     1094#: plasma/applets/dataengines_tasks/plasma-applet-dataengines_tasks.desktop:9
    10951095msgctxt "Comment"
    10961096msgid "Applet displaying tasks using dataengines"
  • kde-croatia/kde4/summit/hr/summit/messages/playground-multimedia/desktop_playground-multimedia_plasma-mediacenter.po

    r1032 r1036  
    99"Project-Id-Version: desktop files\n"
    1010"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
    11 "POT-Creation-Date: 2011-05-23 09:11+0200\n"
     11"POT-Creation-Date: 2011-05-25 09:42+0200\n"
    1212"PO-Revision-Date: 2010-04-30 19:05+0200\n"
    1313"Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
     
    259259
    260260#. +> trunk
     261#: dataengines/mediacentercontrol/plasma-engine-mediacentercontrol.desktop:2
     262#, fuzzy
     263msgctxt "Name"
     264msgid "MediaCenterControl"
     265msgstr "MultiMedijaUpravitelj"
     266
     267#. +> trunk
     268#: dataengines/mediacentercontrol/plasma-engine-mediacentercontrol.desktop:3
     269#, fuzzy
     270msgctxt "Comment"
     271msgid " controlling the MediaCenter"
     272msgstr "Upravljanje sjednicama."
     273
     274#. +> trunk
    261275#: dataengines/picasa/plasma-engine-picasa.desktop:2
    262276#, fuzzy
Note: See TracChangeset for help on using the changeset viewer.