Changeset 1036

Timestamp:

May 26, 2011, 3:08:15 AM (13 years ago)

Author:

kde-how-scripter

Message:

SF-KDE: Ažuriranje datoteka bazirano na zadnjim template datotekama + padeži.

Location:

kde-croatia/kde4/summit/hr/summit/messages

Files:

• extragear-base/plasma_applet_networkmanagement.po (modified) (4 diffs)
• extragear-graphics/digikam.po (modified) (11 diffs)
• extragear-kdevelop/kdevcmake.po (modified) (5 diffs)
• extragear-multimedia/desktop_extragear-multimedia_amarok.po (modified) (15 diffs)
• extragear-multimedia/desktop_extragear-multimedia_k3b.po (modified) (16 diffs)
• extragear-multimedia/desktop_extragear-multimedia_kmid.po (modified) (7 diffs)
• extragear-multimedia/desktop_extragear-multimedia_kplayer.po (modified) (3 diffs)
• extragear-multimedia/k3b.po (modified) (162 diffs)
• extragear-multimedia/kaffeine.po (modified) (21 diffs)
• extragear-multimedia/kplayer.po (modified) (4 diffs)
• extragear-multimedia/libk3b.po (modified) (9 diffs)
• kdebase/desktop_kdebase_kate.po (modified) (18 diffs)
• kdebase/katepart4.po (modified) (4 diffs)
• kdebase/konqueror.po (modified) (3 diffs)
• kdebase/nepomukstorage.po (modified) (2 diffs)
• kdeedu/blinken.po (modified) (3 diffs)
• kdeedu/kalgebra.po (modified) (27 diffs)
• kdeedu/kalzium.po (modified) (9 diffs)
• kdeedu/marble_qt.po (modified) (6 diffs)
• kdegraphics/gwenview.po (modified) (28 diffs)
• kdelibs/kdecalendarsystems.po (modified) (199 diffs)
• kdelibs/kio4.po (modified) (3 diffs)
• kdemultimedia/juk.po (modified) (27 diffs)
• kdenetwork/desktop_kdenetwork.po (modified) (3 diffs)
• kdepim/desktop_kdepim.po (modified) (18 diffs)
• kdeutils/ark.po (modified) (3 diffs)
• kdeutils/desktop_kdeutils.po (modified) (6 diffs)
• koffice/karbon.po (modified) (30 diffs)
• koffice/koffice.po (modified) (42 diffs)
• koffice/krita.po (modified) (21 diffs)
• koffice/kword.po (modified) (46 diffs)
• playground-base/desktop_playground-base.po (modified) (2 diffs)
• playground-multimedia/desktop_playground-multimedia_plasma-mediacenter.po (modified) (2 diffs)

kde-croatia/kde4/summit/hr/summit/messages/extragear-base/plasma_applet_networkmanagement.po

@@ -7 +7 @@
 "Project-Id-Version: \n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-20 07:30+0200\n"
+"POT-Creation-Date: 2011-05-25 09:36+0200\n"
 "PO-Revision-Date: 2011-03-03 22:15+0100\n"
 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
@@ -324 +324 @@
 
 #. +> trunk
-#: nmpopup.cpp:88 nmpopup.cpp:752
+#: nmpopup.cpp:88 nmpopup.cpp:758
 msgctxt "title on the LHS of the plasmoid"
 msgid "<h3>Interfaces</h3>"
@@ -388 +388 @@
 
 #. +> trunk
-#: nmpopup.cpp:669
+#: nmpopup.cpp:675
 msgctxt "pressed show more button"
 msgid "Show Less..."
@@ -394 +394 @@
 
 #. +> trunk
-#: nmpopup.cpp:674
+#: nmpopup.cpp:680
 msgctxt "unpressed show more button"
 msgid "Show More..."

kde-croatia/kde4/summit/hr/summit/messages/extragear-graphics/digikam.po

@@ -7 +7 @@
 "Project-Id-Version: \n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-22 08:35+0200\n"
+"POT-Creation-Date: 2011-05-25 09:36+0200\n"
 "PO-Revision-Date: 2011-03-11 10:04+0100\n"
 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
@@ -3523 +3523 @@
 
 #. +> trunk
-#: digikam/views/digikamview.cpp:881 libs/database/schemaupdater.cpp:965
+#: digikam/views/digikamview.cpp:881 libs/database/schemaupdater.cpp:964
 #, fuzzy
 msgid "Last Search"
@@ -6851 +6851 @@
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:211
+#: libs/database/schemaupdater.cpp:210
 msgid "The database is not valid: the \"DBVersion\" setting does not exist. The current database schema version cannot be verified. Try to start with an empty database. "
 msgstr ""
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:240
+#: libs/database/schemaupdater.cpp:239
 msgid "The database has been used with a more recent version of digiKam and has been updated to a database schema which cannot be used with this version. (This means this digiKam version is too old, or the database format is too recent.) Please use the more recent version of digiKam that you used before. "
 msgstr ""
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:312
+#: libs/database/schemaupdater.cpp:311
 #: libs/database/thumbnailschemaupdater.cpp:173
 msgid ""
@@ -6869 +6869 @@
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:334
+#: libs/database/schemaupdater.cpp:333
 #, kde-format
 msgid "Failed to open a database transaction on your database file \"%1\". This is unusual. Please check that you can access the file and no other process has currently locked the file. If the problem persists you can get help from the digikam-devel@kde.org mailing list. As well, please have a look at what digiKam prints on the console. "
@@ -6875 +6875 @@
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:391
+#: libs/database/schemaupdater.cpp:390
 #, kde-format
 msgid "The schema updating process from version 4 to 6 failed, caused by an error that we did not expect. You can try to discard your old database and start with an empty one. (In this case, please move the database files \"%1\" and \"%2\" from the directory \"%3\"). More probably you will want to report this error to the digikam-devel@kde.org mailing list. As well, please have a look at what digiKam prints on the console. "
@@ -6881 +6881 @@
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:419
+#: libs/database/schemaupdater.cpp:418
 msgid "Failed to update the database schema from version 5 to version 6. Please read the error messages printed on the console and report this error as a bug at bugs.kde.org. "
 msgstr ""
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:578
+#: libs/database/schemaupdater.cpp:577
 msgid "The database update action cannot be found. Please ensure that the dbconfig.xml file of the current version of digiKam is installed at the correct place. "
 msgstr ""
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:597
+#: libs/database/schemaupdater.cpp:596
 msgid "Updated schema to version 6."
 msgstr ""
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:624
+#: libs/database/schemaupdater.cpp:623
 #, kde-format
 msgid "Failed to copy the old database file (\"%1\") to its new location (\"%2\"). Error message: \"%3\". Please make sure that the file can be copied, or delete it."
@@ -6902 +6902 @@
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:644
+#: libs/database/schemaupdater.cpp:643
 msgid "Copied database file"
 msgstr ""
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:649
+#: libs/database/schemaupdater.cpp:648
 #, kde-format
 msgid "The old database file (\"%1\") has been copied to the new location (\"%2\") but it cannot be opened. Please delete both files and try again, starting with an empty database. "
@@ -6913 +6913 @@
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:669
+#: libs/database/schemaupdater.cpp:668
 msgid "Opened new database file"
 msgstr ""
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:690
+#: libs/database/schemaupdater.cpp:689
 #, kde-format
 msgid "Could not update from the old SQLite2 file (\"%1\"). Please delete this file and try again, starting with an empty database. "
@@ -6924 +6924 @@
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:706
+#: libs/database/schemaupdater.cpp:705
 msgid "Updated from 0.7 database"
 msgstr ""
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:794
+#: libs/database/schemaupdater.cpp:793
 msgid "Prepared table creation"
 msgstr ""
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:813
+#: libs/database/schemaupdater.cpp:812
 msgid "Created tables"
 msgstr ""
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:826
+#: libs/database/schemaupdater.cpp:825
 msgid "No album library path has been found in the configuration file. Giving up the schema updating process. Please try with an empty database, or repair your configuration."
 msgstr ""
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:847
+#: libs/database/schemaupdater.cpp:846
 #, kde-format
 msgid "There was an error associating your albumLibraryPath (\"%1\") with a storage volume of your system. This problem may indicate that there is a problem with your installation. If you are working on Linux, check that HAL is installed and running. In any case, you can seek advice from the digikam-devel@kde.org mailing list. The database updating process will now be aborted because we do not want to create a new database based on false assumptions from a broken installation."
@@ -6950 +6950 @@
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:874
+#: libs/database/schemaupdater.cpp:873
 msgid "Configured one album root"
 msgstr ""
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:900
+#: libs/database/schemaupdater.cpp:899
 msgid "Imported albums"
 msgstr ""
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:936
+#: libs/database/schemaupdater.cpp:935
 msgid "Imported images information"
 msgstr ""
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:967
+#: libs/database/schemaupdater.cpp:966
 #, fuzzy
 msgid "Last Search (0.9)"
@@ -6971 +6971 @@
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:1024
+#: libs/database/schemaupdater.cpp:1023
 msgid "Initialized and imported file suffix filter"
 msgstr ""
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:1046
+#: libs/database/schemaupdater.cpp:1045
 msgid "Did the initial full scan"
 msgstr ""
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:1070
+#: libs/database/schemaupdater.cpp:1069
 msgid "Imported creation dates"
 msgstr ""
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:1100
+#: libs/database/schemaupdater.cpp:1099
 msgid "Imported comments"
 msgstr ""
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:1126
+#: libs/database/schemaupdater.cpp:1125
 msgid "Imported ratings"
 msgstr ""
 
 #. +> trunk
-#: libs/database/schemaupdater.cpp:1137
+#: libs/database/schemaupdater.cpp:1136
 msgid "Dropped v3 tables"
 msgstr ""

kde-croatia/kde4/summit/hr/summit/messages/extragear-kdevelop/kdevcmake.po

@@ -6 +6 @@
 "Project-Id-Version: \n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-12 09:39+0200\n"
+"POT-Creation-Date: 2011-05-25 09:36+0200\n"
 "PO-Revision-Date: 2010-01-24 16:58+0100\n"
 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
@@ -319 +319 @@
 
 #. +> trunk
-#: cmakemanager.cpp:1417
+#: cmakemanager.cpp:1418
 #, kde-format
 msgid "Modify target '%2' as follows:"
@@ -325 +325 @@
 
 #. +> trunk
-#: cmakemanager.cpp:1424
+#: cmakemanager.cpp:1425
 #, fuzzy
 msgid "CMakeLists changes failed."
@@ -337 +337 @@
 
 #. +> trunk
-#: cmakemanager.cpp:1433
+#: cmakemanager.cpp:1434
 #, fuzzy, kde-format
 msgid "Rename '%1' to '%2':"
@@ -343 +343 @@
 
 #. +> trunk
-#: cmakemanager.cpp:1452
+#: cmakemanager.cpp:1453
 msgid "Changes to CMakeLists failed, abort rename?"
 msgstr ""

kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/desktop_extragear-multimedia_amarok.po

@@ -7 +7 @@
 "Project-Id-Version: desktop files\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-22 08:35+0200\n"
+"POT-Creation-Date: 2011-05-25 09:37+0200\n"
 "PO-Revision-Date: 2010-07-08 15:31+0200\n"
 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
@@ -78 +78 @@
 
 #. +> trunk
-#: playground/src/context/engines/jsengine/metadata.desktop:42
+#: playground/src/context/engines/jsengine/metadata.desktop:43
 msgctxt "Comment"
 msgid "Javascript Sample Engine"
@@ -322 +322 @@
 
 #. +> trunk
-#: src/context/scriptengine/javascript/amarok-scriptengine-applet-simple-javascript.desktop:46
+#: src/context/scriptengine/javascript/amarok-scriptengine-applet-simple-javascript.desktop:47
 msgctxt "Comment"
 msgid "Native Amarok applet written in JavaScript"
@@ -372 +372 @@
 
 #. +> trunk
-#: src/core-impl/collections/audiocd/amarok_collection-audiocdcollection.desktop:49
+#: src/core-impl/collections/audiocd/amarok_collection-audiocdcollection.desktop:50
 msgctxt "Comment"
 msgid "AudioCd collection plugin for Amarok"
@@ -432 +432 @@
 
 #. +> trunk
-#: src/core-impl/collections/db/sql/mysqlecollection/amarok_collection-mysqlecollection.desktop:48
-#: src/core-impl/collections/db/sql/mysqlservercollection/amarok_collection-mysqlservercollection.desktop:48
+#: src/core-impl/collections/db/sql/mysqlecollection/amarok_collection-mysqlecollection.desktop:49
+#: src/core-impl/collections/db/sql/mysqlservercollection/amarok_collection-mysqlservercollection.desktop:49
 msgctxt "Comment"
 msgid "Collection plugin for Amarok"
@@ -494 +494 @@
 
 #. +> trunk
-#: src/core-impl/collections/playdarcollection/amarok_collection-playdarcollection.desktop:28
+#: src/core-impl/collections/playdarcollection/amarok_collection-playdarcollection.desktop:29
 msgctxt "Comment"
 msgid "Music that Playdar can find"
@@ -524 +524 @@
 
 #. +> trunk
-#: src/data/amarok.notifyrc:50
+#: src/data/amarok.notifyrc:51
 msgctxt "Name"
 msgid "Track Change"
@@ -530 +530 @@
 
 #. +> trunk
-#: src/data/amarok.notifyrc:92
+#: src/data/amarok.notifyrc:94
 msgctxt "Comment"
 msgid "Amarok changed to a new track"
@@ -542 +542 @@
 
 #. +> trunk
-#: src/services/ampache/amarok_service_ampache.desktop:54
+#: src/services/ampache/amarok_service_ampache.desktop:55
 msgctxt "Comment"
 msgid "Listen to music from an Ampache server"
@@ -566 +566 @@
 
 #. +> trunk
-#: src/services/gpodder/amarok_service_gpodder.desktop:24
+#: src/services/gpodder/amarok_service_gpodder.desktop:26
 #, fuzzy
 msgctxt "Comment"
@@ -582 +582 @@
 
 #. +> trunk
-#: src/services/jamendo/amarok_service_jamendo.desktop:56
+#: src/services/jamendo/amarok_service_jamendo.desktop:57
 msgctxt "Comment"
 msgid "Listen to and download music uploaded by independent artists"
@@ -594 +594 @@
 
 #. +> trunk
-#: src/services/lastfm/amarok_service_lastfm.desktop:55
+#: src/services/lastfm/amarok_service_lastfm.desktop:56
 msgctxt "Comment"
 msgid "A service that integrates Last.fm functionality into Amarok"
@@ -642 +642 @@
 
 #. +> trunk
-#: src/services/mp3tunes/amarok_service_mp3tunes.desktop:44
+#: src/services/mp3tunes/amarok_service_mp3tunes.desktop:45
 msgctxt "Comment"
 msgid "Browse and listen to the music stored in your MP3tunes account"
@@ -655 +655 @@
 
 #. +> trunk
-#: src/services/mp3tunes/amarok_service_mp3tunes_config.desktop:49
+#: src/services/mp3tunes/amarok_service_mp3tunes_config.desktop:50
 msgctxt "Comment"
 msgid "Configure mp3tunes credentials"
@@ -667 +667 @@
 
 #. +> trunk
-#: src/services/opmldirectory/amarok_service_opmldirectory.desktop:52
+#: src/services/opmldirectory/amarok_service_opmldirectory.desktop:53
 msgctxt "Comment"
 msgid "Browse and subscribe to a huge list of podcasts"

kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/desktop_extragear-multimedia_k3b.po

@@ -8 +8 @@
 "Project-Id-Version: desktop files\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-22 08:35+0200\n"
+"POT-Creation-Date: 2011-05-25 09:37+0200\n"
 "PO-Revision-Date: 2011-05-21 13:00+0200\n"
 "Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
@@ -29 +29 @@
 
 #. +> trunk stable
-#: k3bsetup/k3bsetup.actions:41
+#: k3bsetup/k3bsetup.actions:42
 msgctxt "Description"
 msgid "Authentication is required to update permissions of devices and programs"
@@ -41 +41 @@
 
 #. +> trunk stable
-#: k3bsetup/k3bsetup.desktop:46
+#: k3bsetup/k3bsetup.desktop:47
 msgctxt "Keywords"
 msgid "K3bSetup,k3bsetup"
@@ -47 +47 @@
 
 #. +> trunk stable
-#: k3bsetup/k3bsetup.desktop:90
+#: k3bsetup/k3bsetup.desktop:92
 msgctxt "Name"
 msgid "K3bSetup"
@@ -53 +53 @@
 
 #. +> trunk stable
-#: k3bsetup/k3bsetup.desktop:157
+#: k3bsetup/k3bsetup.desktop:159
 msgctxt "GenericName"
 msgid "CD/DVD/BD Burning Setup"
@@ -263 +263 @@
 
 #. +> trunk stable
-#: plugins/project/audiometainforenamer/k3baudiometainforenamerplugin.desktop:41
+#: plugins/project/audiometainforenamer/k3baudiometainforenamerplugin.desktop:42
 msgctxt "Comment"
 msgid "Plugin to rename audio files in a data project based on the meta info."
@@ -275 +275 @@
 
 #. +> trunk stable
-#: plugins/project/audioprojectcddb/k3baudioprojectcddbplugin.desktop:45
+#: plugins/project/audioprojectcddb/k3baudioprojectcddbplugin.desktop:46
 msgctxt "Comment"
 msgid "Plugin to query a cddb server for information about an audio project."
@@ -282 +282 @@
 # pmap: =/nom=K3b/gen=K3b-a/dat=K3b-u/aku=K3b/lok=K3b-u/ins=K3b-om/_r=m/_b=j/
 #. +> trunk stable
-#: src/k3b-cue.desktop:7 src/k3b-iso.desktop:7 src/k3b.desktop:93
+#: src/k3b-cue.desktop:7 src/k3b-iso.desktop:7 src/k3b.desktop:95
 msgctxt "Name"
 msgid "K3b"
@@ -294 +294 @@
 
 #. +> trunk stable
-#: src/k3b.desktop:49
+#: src/k3b.desktop:50
 msgctxt "Comment"
 msgid "Disk writing program"
@@ -348 +348 @@
 
 #. +> trunk
-#: src/k3b.notifyrc:426
+#: src/k3b.notifyrc:428
 msgctxt "Comment"
 msgid "K3b is currently busy and cannot start any other operations"
@@ -354 +354 @@
 
 #. +> trunk
-#: src/k3b.notifyrc:449
+#: src/k3b.notifyrc:452
 msgctxt "Name"
 msgid "No problems found"
@@ -360 +360 @@
 
 #. +> trunk
-#: src/k3b.notifyrc:469
+#: src/k3b.notifyrc:474
 msgctxt "Comment"
 msgid "No problems found in system configuration"
@@ -366 +366 @@
 
 #. +> trunk
-#: src/k3b.notifyrc:492
+#: src/k3b.notifyrc:498
 msgctxt "Name"
 msgid "Mount/unmount failed"
@@ -372 +372 @@
 
 #. +> trunk
-#: src/k3b.notifyrc:510
+#: src/k3b.notifyrc:518
 msgctxt "Comment"
 msgid "Medium cannot be mount or unmounted"
@@ -378 +378 @@
 
 #. +> trunk
-#: src/k3b.notifyrc:532
+#: src/k3b.notifyrc:541
 msgctxt "Name"
 msgid "Track data not found"
@@ -384 +384 @@
 
 #. +> trunk
-#: src/k3b.notifyrc:550
+#: src/k3b.notifyrc:561
 msgctxt "Comment"
 msgid "Track information has not been found in the online database"

kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/desktop_extragear-multimedia_kmid.po

@@ -6 +6 @@
 "Project-Id-Version: desktop files\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-22 08:35+0200\n"
+"POT-Creation-Date: 2011-05-25 09:37+0200\n"
 "PO-Revision-Date: 2010-01-24 16:33+0100\n"
 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
@@ -27 +27 @@
 
 #. +> trunk
-#: alsa/kmid_alsa.desktop:46
+#: alsa/kmid_alsa.desktop:47
 msgctxt "Comment"
 msgid "ALSA sequencer backend"
@@ -40 +40 @@
 
 #. +> trunk
-#: dummy/kmid_dummy.desktop:44
+#: dummy/kmid_dummy.desktop:45
 #, fuzzy
 msgctxt "Comment"
@@ -54 +54 @@
 
 #. +> trunk
-#: examples/kmidtest/kmidtest.desktop:31
+#: examples/kmidtest/kmidtest.desktop:32
 #, fuzzy
 msgctxt "GenericName"
@@ -75 +75 @@
 
 #. +> trunk
-#: mac/kmid_mac.desktop:44
+#: mac/kmid_mac.desktop:45
 #, fuzzy
 msgctxt "Comment"
@@ -102 +102 @@
 
 #. +> trunk
-#: src/kmid_part.desktop:40
+#: src/kmid_part.desktop:41
 #, fuzzy
 msgctxt "GenericName"
@@ -116 +116 @@
 
 #. +> trunk
-#: win/kmid_win.desktop:44
+#: win/kmid_win.desktop:45
 #, fuzzy
 msgctxt "Comment"

kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/desktop_extragear-multimedia_kplayer.po

@@ -6 +6 @@
 "Project-Id-Version: desktop files\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-22 08:35+0200\n"
+"POT-Creation-Date: 2011-05-25 09:37+0200\n"
 "PO-Revision-Date: 2010-01-24 16:33+0100\n"
 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
@@ -70 +70 @@
 
 #. +> trunk
-#: kplayer/kplayer.desktop:33 kplayer/kplayerpart.desktop:5
+#: kplayer/kplayer.desktop:34 kplayer/kplayerpart.desktop:5
 msgctxt "Name"
 msgid "KPlayer"
@@ -76 +76 @@
 
 #. +> trunk
-#: kplayer/kplayer.desktop:82
+#: kplayer/kplayer.desktop:83
 #, fuzzy
 msgctxt "GenericName"

kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/k3b.po

@@ -7 +7 @@
 "Project-Id-Version: \n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-04 11:04+0200\n"
+"POT-Creation-Date: 2011-05-25 09:37+0200\n"
 "PO-Revision-Date: 2011-05-21 13:34+0200\n"
 "Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
@@ -15 +15 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Language: hr\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<"
-"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
 "X-Generator: Lokalize 1.2\n"
 "X-Environment: kde\n"
@@ -54 +53 @@
 #. +> trunk stable
 #: ../plugins/decoder/flac/k3bflacdecoder.cpp:369
-#| msgid "FLAC"
 msgid "FLAC"
 msgstr "FLAC"
@@ -276 +274 @@
 #: ../plugins/encoder/external/base_k3bexternalencoderconfigwidget.ui:22
 msgid ""
-"<p>This dialog can be used to setup external command line applications as "
-"audio encoders. These can then be used by K3b to encode audio data (Tracks "
-"from an audio CD or the titles from an audio project) to formats that are "
-"normally not supported (i.e. no encoder plugin exists).\n"
-"<p>K3b comes with a selection of predefined external applications that "
-"depends on the installed applications."
+"<p>This dialog can be used to setup external command line applications as audio encoders. These can then be used by K3b to encode audio data (Tracks from an audio CD or the titles from an audio project) to formats that are normally not supported (i.e. no encoder plugin exists).\n"
+"<p>K3b comes with a selection of predefined external applications that depends on the installed applications."
 msgstr ""
 
@@ -353 +347 @@
 #, no-c-format
 msgid ""
-"Please insert the command used to encode the audio data. The command has to "
-"read raw little endian (see <em>Swap Byte Order</em>) 16-bit stereo audio "
-"frames from stdin.\n"
+"Please insert the command used to encode the audio data. The command has to read raw little endian (see <em>Swap Byte Order</em>) 16-bit stereo audio frames from stdin.\n"
 "<p>The following strings will be replaced by K3b:<br>\n"
-"<b>%f</b> - The filename of the resulting file. This is where the command has "
-"to write its output to.<br>\n"
-"<em>The following refer to metadata stored for example in the ID3 tag of an "
-"mp3 file (Be aware that these values might be empty).</em><br>\n"
+"<b>%f</b> - The filename of the resulting file. This is where the command has to write its output to.<br>\n"
+"<em>The following refer to metadata stored for example in the ID3 tag of an mp3 file (Be aware that these values might be empty).</em><br>\n"
 "<b>%t</b> - Title<br>\n"
 "<b>%a</b> - Artist<br>\n"
@@ -391 +381 @@
 #: ../plugins/encoder/external/base_k3bexternalencodereditwidget.ui:119
 msgid ""
-"<p> If this option is checked K3b will swap the byte order of the input data. "
-"Thus, the command has to read big endian audio frames.\n"
-"<p>If the resulting audio file sounds bad it is highly likely that the byte "
-"order is wrong and this option has to be checked."
+"<p> If this option is checked K3b will swap the byte order of the input data. Thus, the command has to read big endian audio frames.\n"
+"<p>If the resulting audio file sounds bad it is highly likely that the byte order is wrong and this option has to be checked."
 msgstr ""
 
@@ -412 +400 @@
 #. +> trunk stable
 #: ../plugins/encoder/external/base_k3bexternalencodereditwidget.ui:132
-msgid ""
-"<p>If this option is checked K3b will write a wave header. This is useful in "
-"case the encoder application cannot read plain raw audio data."
+msgid "<p>If this option is checked K3b will write a wave header. This is useful in case the encoder application cannot read plain raw audio data."
 msgstr ""
 
@@ -588 +574 @@
 #: ../plugins/encoder/lame/base_k3blameencodersettingswidget.ui:267
 msgid ""
-"<p>Bitrate is of course the main influence on quality. The higher the "
-"bitrate, the higher the quality. But for a given bitrate, we have a choice of "
-"algorithms to determine the best scalefactors and huffman encoding (noise "
-"shaping).\n"
+"<p>Bitrate is of course the main influence on quality. The higher the bitrate, the higher the quality. But for a given bitrate, we have a choice of algorithms to determine the best scalefactors and huffman encoding (noise shaping).\n"
 "<p>The quality increases from 0 to 9 while the encoding speed drops.\n"
 "<p>9 uses the slowest & best possible version of all algorithms.\n"
-"<p><b>7 is the recommended setting</b> while 4 still produced reasonable "
-"quality at good speed.\n"
-"<p>0 disables almost all algorithms including psy-model resulting in poor "
-"quality.\n"
+"<p><b>7 is the recommended setting</b> while 4 still produced reasonable quality at good speed.\n"
+"<p>0 disables almost all algorithms including psy-model resulting in poor quality.\n"
 "<p><b>This setting has no influence on the size of the resulting file.</b>"
 msgstr ""
@@ -641 +622 @@
 #: ../plugins/encoder/lame/base_k3blameencodersettingswidget.ui:347
 msgid ""
-"<p>If this option is checked, LAME will enforce the 7680 bit limitation on "
-"total frame size.<br>\n"
-"This results in many wasted bits for high bitrate encodings but will ensure "
-"strict ISO compatibility. This compatibility might be important for hardware "
-"players."
+"<p>If this option is checked, LAME will enforce the 7680 bit limitation on total frame size.<br>\n"
+"This results in many wasted bits for high bitrate encodings but will ensure strict ISO compatibility. This compatibility might be important for hardware players."
 msgstr ""
 
@@ -663 +641 @@
 #. +> trunk stable
 #: ../plugins/encoder/lame/base_k3blameencodersettingswidget.ui:360
-msgid ""
-"<p>If this option is checked, a cyclic redundancy check (CRC) code will be "
-"added to each frame, allowing transmission errors that could occur on the MP3 "
-"stream to be detected; however, it takes 16 bits per frame that would "
-"otherwise be used for encoding, thus slightly reducing the sound quality."
+msgid "<p>If this option is checked, a cyclic redundancy check (CRC) code will be added to each frame, allowing transmission errors that could occur on the MP3 stream to be detected; however, it takes 16 bits per frame that would otherwise be used for encoding, thus slightly reducing the sound quality."
 msgstr ""
 
@@ -742 +716 @@
 "<p>Select the channel mode of the resulting Mp3 file:\n"
 "<p><b>Stereo</b><br>\n"
-"In this mode, the encoder makes no use of potential correlations between the "
-"two input channels; it can, however, negotiate the bit demand between both "
-"channel, i.e. give one channel more bits if the other contains silence or "
-"needs fewer bits because of a lower complexity.\n"
+"In this mode, the encoder makes no use of potential correlations between the two input channels; it can, however, negotiate the bit demand between both channel, i.e. give one channel more bits if the other contains silence or needs fewer bits because of a lower complexity.\n"
 "<p><b>Joint-Stereo</b><br>\n"
-"In this mode, the encoder will make use of correlations between both channels."
-" The signal will be matrixed into a sum (\"mid\"), computed by L+R, and "
-"difference (\"side\") signal, computed by L-R, and more bits are allocated to "
-"the mid channel. This will effectively increase the bandwidth if the signal "
-"does not have too much stereo separation, thus giving a significant gain in "
-"encoding quality.\n"
+"In this mode, the encoder will make use of correlations between both channels. The signal will be matrixed into a sum (\"mid\"), computed by L+R, and difference (\"side\") signal, computed by L-R, and more bits are allocated to the mid channel. This will effectively increase the bandwidth if the signal does not have too much stereo separation, thus giving a significant gain in encoding quality.\n"
 "<p><b>Mono</b><br>\n"
-"The input will be encoded as a mono signal. If it was a stereo signal, it "
-"will be downsampled to mono. The downmix is calculated as the sum of the left "
-"and right channel, attenuated by 6 dB."
+"The input will be encoded as a mono signal. If it was a stereo signal, it will be downsampled to mono. The downmix is calculated as the sum of the left and right channel, attenuated by 6 dB."
 msgstr ""
 
@@ -856 +820 @@
 #. +> trunk stable
 #: ../plugins/encoder/ogg/base_k3boggvorbisencodersettingswidget.ui:32
-msgid ""
-"<p>Vorbis' audio quality is not best measured in kilobits per second, but on "
-"a scale from -1 to 10 called \"quality\". <p>For now, quality -1 is roughly "
-"equivalent to 45kbps average, 5 is roughly 160kbps, and 10 gives about "
-"400kbps. Most people seeking very-near-CD-quality audio encode at a quality "
-"of 5 or, for lossless stereo coupling, 6. The default setting is quality 3, "
-"which at approximately 110kbps gives a smaller filesize and significantly "
-"better fidelity than .mp3 compression at 128kbps. <p><em>This explanation was "
-"copied from the www.vorbis.com FAQ.</em>"
+msgid "<p>Vorbis' audio quality is not best measured in kilobits per second, but on a scale from -1 to 10 called \"quality\". <p>For now, quality -1 is roughly equivalent to 45kbps average, 5 is roughly 160kbps, and 10 gives about 400kbps. Most people seeking very-near-CD-quality audio encode at a quality of 5 or, for lossless stereo coupling, 6. The default setting is quality 3, which at approximately 110kbps gives a smaller filesize and significantly better fidelity than .mp3 compression at 128kbps. <p><em>This explanation was copied from the www.vorbis.com FAQ.</em>"
 msgstr ""
 
@@ -914 +870 @@
 #. +> trunk stable
 #: ../plugins/encoder/ogg/k3boggvorbisencoderconfigwidget.cpp:64
-msgid ""
-"<p>Vorbis' audio quality is not best measured in kilobits per second, but on "
-"a scale from -1 to 10 called <em>quality</em>.<p>For now, quality -1 is "
-"roughly equivalent to 45kbps average, 5 is roughly 160kbps, and 10 gives "
-"about 400kbps. Most people seeking very-near-CD-quality audio encode at a "
-"quality of 5 or, for lossless stereo coupling, 6. The quality 3 gives, at "
-"approximately 110kbps a smaller filesize and significantly better fidelity "
-"than .mp3 compression at 128kbps.<p><em>This explanation is based on the one "
-"from the www.vorbis.com FAQ.</em>"
+msgid "<p>Vorbis' audio quality is not best measured in kilobits per second, but on a scale from -1 to 10 called <em>quality</em>.<p>For now, quality -1 is roughly equivalent to 45kbps average, 5 is roughly 160kbps, and 10 gives about 400kbps. Most people seeking very-near-CD-quality audio encode at a quality of 5 or, for lossless stereo coupling, 6. The quality 3 gives, at approximately 110kbps a smaller filesize and significantly better fidelity than .mp3 compression at 128kbps.<p><em>This explanation is based on the one from the www.vorbis.com FAQ.</em>"
 msgstr ""
 
@@ -947 +895 @@
 #: ../plugins/encoder/sox/base_k3bsoxencoderconfigwidget.ui:63
 msgid ""
-"<p>The sample data encoding is signed linear (2's complement), unsigned "
-"linear, u-law (logarithmic), A-law (logarithmic), ADPCM, IMA_ADPCM, GSM, or "
-"Floating-point.</p>\n"
-"<p><b>U-law</b> (actually shorthand for mu-law) and <b>A-law</b> are the U.S. "
-"and international standards for logarithmic telephone sound compression. When "
-"uncompressed u-law has roughly the precision of 14-bit PCM audio and A-law "
-"has roughly the precision of 13-bit PCM audio. A-law and u-law data is "
-"sometimes encoded using a reversed bit-ordering (i.e. MSB becomes LSB).<br> <"
-"b>ADPCM </b> is a form of sound compression that has a good compromise "
-"between good sound quality and fast encoding/decoding time. It is used for "
-"telephone sound compression and places where full fidelity is not as "
-"important. When uncompressed it has roughly the precision of 16-bit PCM audio."
-" Popular versions of ADPCM include G.726, MS ADPCM, and IMA ADPCM. It has "
-"different meanings in different file handlers. In .wav files it represents MS "
-"ADPCM files, in all others it means G.726 ADPCM. <br> <b>IMA ADPCM</b> is a "
-"specific form of ADPCM compression, slightly simpler and slightly lower "
-"fidelity than Microsoft's flavor of ADPCM. IMA ADPCM is also called DVI ADPCM."
-"<br> <b>GSM</b> is a standard used for telephone sound compression in "
-"European countries and is gaining popularity because of its good quality. It "
-"is usually CPU intensive to work with GSM audio data.</p> <p><em>Description "
-"based on the SoX manpage</em></p>"
+"<p>The sample data encoding is signed linear (2's complement), unsigned linear, u-law (logarithmic), A-law (logarithmic), ADPCM, IMA_ADPCM, GSM, or Floating-point.</p>\n"
+"<p><b>U-law</b> (actually shorthand for mu-law) and <b>A-law</b> are the U.S. and international standards for logarithmic telephone sound compression. When uncompressed u-law has roughly the precision of 14-bit PCM audio and A-law has roughly the precision of 13-bit PCM audio. A-law and u-law data is sometimes encoded using a reversed bit-ordering (i.e. MSB becomes LSB).<br> <b>ADPCM </b> is a form of sound compression that has a good compromise between good sound quality and fast encoding/decoding time. It is used for telephone sound compression and places where full fidelity is not as important. When uncompressed it has roughly the precision of 16-bit PCM audio. Popular versions of ADPCM include G.726, MS ADPCM, and IMA ADPCM. It has different meanings in different file handlers. In .wav files it represents MS ADPCM files, in all others it means G.726 ADPCM. <br> <b>IMA ADPCM</b> is a specific form of ADPCM compression, slightly simpler and slightly lower fidelity than Microsoft's flavor of ADPCM. IMA ADPCM is also called DVI ADPCM.<br> <b>GSM</b> is a standard used for telephone sound compression in European countries and is gaining popularity because of its good quality. It is usually CPU intensive to work with GSM audio data.</p> <p><em>Description based on the SoX manpage</em></p>"
 msgstr ""
 
@@ -1213 +1142 @@
 #. +> trunk stable
 #: ../plugins/project/audiometainforenamer/k3baudiometainforenamerplugin.cpp:146
-msgid ""
-"<qt>This specifies how the files should be renamed. Currently only the "
-"special strings <em>%a</em> (Artist), <em>%n</em> (Track number), and <em>%t<"
-"/em> (Title) are supported."
+msgid "<qt>This specifies how the files should be renamed. Currently only the special strings <em>%a</em> (Artist), <em>%n</em> (Track number), and <em>%t</em> (Title) are supported."
 msgstr ""
 
@@ -1811 +1737 @@
 #: k3bappdevicemanager.cpp:289
 #, kde-format
-msgid ""
-"<p>Please enter the preferred read speed for <b>%1</b>. This speed will be "
-"used for the currently mounted medium.<p>This is especially useful to slow "
-"down the drive when watching movies which are read directly from the drive "
-"and the spinning noise is intrusive.<p>Be aware that this has no influence on "
-"K3b since it will change the reading speed again when copying CDs or DVDs."
+msgid "<p>Please enter the preferred read speed for <b>%1</b>. This speed will be used for the currently mounted medium.<p>This is especially useful to slow down the drive when watching movies which are read directly from the drive and the spinning noise is intrusive.<p>Be aware that this has no influence on K3b since it will change the reading speed again when copying CDs or DVDs."
 msgstr ""
 
@@ -1902 +1823 @@
 #. +> trunk stable
 #: k3bdatamodewidget.cpp:38
-msgid ""
-"<p><b>Data Mode</b><p>Data tracks may be written in two different modes:</p><"
-"p><b>Auto</b><br>Let K3b select the best suited data mode.</p><p><b>Mode 1</b>"
-"<br>This is the <em>original</em> writing mode as introduced in the <em>"
-"Yellow Book</em> standard. It is the preferred mode when writing pure data "
-"CDs.</p><p><b>Mode 2</b><br>To be exact <em>XA Mode 2 Form 1</em>, but since "
-"the other modes are rarely used it is common to refer to it as <em>Mode 2</em>"
-".</p><p><b>Be aware:</b> Do not mix different modes on one CD. Some older "
-"drives may have problems reading mode 1 multisession CDs."
+msgid "<p><b>Data Mode</b><p>Data tracks may be written in two different modes:</p><p><b>Auto</b><br>Let K3b select the best suited data mode.</p><p><b>Mode 1</b><br>This is the <em>original</em> writing mode as introduced in the <em>Yellow Book</em> standard. It is the preferred mode when writing pure data CDs.</p><p><b>Mode 2</b><br>To be exact <em>XA Mode 2 Form 1</em>, but since the other modes are rarely used it is common to refer to it as <em>Mode 2</em>.</p><p><b>Be aware:</b> Do not mix different modes on one CD. Some older drives may have problems reading mode 1 multisession CDs."
 msgstr ""
 
@@ -1957 +1870 @@
 #. +> trunk stable
 #: k3bdirview.cpp:206
-msgid ""
-"K3b uses vcdxrip from the vcdimager package to rip Video CDs. Please make "
-"sure it is installed."
+msgid "K3b uses vcdxrip from the vcdimager package to rip Video CDs. Please make sure it is installed."
 msgstr ""
 
@@ -1981 +1892 @@
 #: k3bdirview.cpp:257
 #, kde-format
-msgid ""
-"<p>K3b was unable to unmount medium <b>%1</b> in device <em>%2 - %3</em>"
-msgstr ""
-"<p>K3b nije mogao demontirati medij <b>%1</b> u uređaju <em>%2 – %3</em>"
+msgid "<p>K3b was unable to unmount medium <b>%1</b> in device <em>%2 - %3</em>"
+msgstr "<p>K3b nije mogao demontirati medij <b>%1</b> u uređaju <em>%2 – %3</em>"
 
 #. +> trunk stable
@@ -2140 +2049 @@
 #. +> trunk stable
 #: k3bdiskinfoview.cpp:300 k3bdiskinfoview.cpp:302 k3bdiskinfoview.cpp:306
-#: projects/k3bfillstatusdisplay.cpp:188 projects/k3bfillstatusdisplay.cpp:191
-#: projects/k3bfillstatusdisplay.cpp:196
+#: projects/k3bfillstatusdisplay.cpp:180 projects/k3bfillstatusdisplay.cpp:188
+#: projects/k3bfillstatusdisplay.cpp:191 projects/k3bfillstatusdisplay.cpp:196
+#: projects/k3bfillstatusdisplay.cpp:849
 #, kde-format
 msgid "%1 min"
@@ -2451 +2361 @@
 #. +> trunk stable
 #: k3binteractiondialog.cpp:205
-msgid ""
-"<p>Load a set of settings either from the default K3b settings, settings "
-"saved before, or the last used ones."
+msgid "<p>Load a set of settings either from the default K3b settings, settings saved before, or the last used ones."
 msgstr ""
 
 #. +> trunk stable
 #: k3binteractiondialog.cpp:207
-msgid ""
-"<p>Saves the current settings of the action dialog.<p>These settings can be "
-"loaded with the <em>Load saved settings</em> button.<p><b>The K3b defaults "
-"are not overwritten by this.</b>"
+msgid "<p>Saves the current settings of the action dialog.<p>These settings can be loaded with the <em>Load saved settings</em> button.<p><b>The K3b defaults are not overwritten by this.</b>"
 msgstr ""
 
@@ -2471 +2376 @@
 #. +> stable
 #: k3binteractiondialog.cpp:288
-msgid ""
-"<p>K3b handles three sets of settings in action dialogs: the defaults, the "
-"saved settings, and the last used settings. Please choose which of these sets "
-"should be loaded if an action dialog is opened again.<p><em>Be aware that "
-"this choice can always be changed from the K3b configuration dialog.</em>"
+msgid "<p>K3b handles three sets of settings in action dialogs: the defaults, the saved settings, and the last used settings. Please choose which of these sets should be loaded if an action dialog is opened again.<p><em>Be aware that this choice can always be changed from the K3b configuration dialog.</em>"
 msgstr ""
 
@@ -2586 +2487 @@
 #: k3blsofwrapperdialog.cpp:73
 #, kde-format
-msgid ""
-"<p>Device <b>'%1'</b> is already in use by other applications (<em>%2</em>).<"
-"p>It is highly recommended to quit those before continuing. Otherwise K3b "
-"might not be able to fully access the device.<p><em>Hint: Sometimes shutting "
-"down an application does not happen instantly. In that case you might have to "
-"use the '%3' button."
-msgstr ""
-
-#. +> trunk stable
+msgid "<p>Device <b>'%1'</b> is already in use by other applications (<em>%2</em>).<p>It is highly recommended to quit those before continuing. Otherwise K3b might not be able to fully access the device.<p><em>Hint: Sometimes shutting down an application does not happen instantly. In that case you might have to use the '%3' button."
+msgstr ""
+
+#. +> trunk
+#: k3blsofwrapperdialog.cpp:101
+#, fuzzy, kde-format
+msgid "<p>Do you really want K3b to kill the following processes: <em>%1</em>?</p>"
+msgstr "<qt>Da li zaista şelite da obrišete zabelešku <b>%1</b>?</qt>"
+
+#. +> stable
 #: k3blsofwrapperdialog.cpp:101
 msgid "<p>Do you really want K3b to kill the following processes: <em>"
@@ -2831 +2733 @@
 #. +> trunk stable
 #: k3bsystemproblemdialog.cpp:200
-msgid ""
-"K3b did not find an optical writing device in your system. Thus, you will not "
-"be able to burn CDs or DVDs. However, you can still use other K3b features "
-"such as audio track extraction, audio transcoding or ISO9660 image creation."
+msgid "K3b did not find an optical writing device in your system. Thus, you will not be able to burn CDs or DVDs. However, you can still use other K3b features such as audio track extraction, audio transcoding or ISO9660 image creation."
 msgstr ""
 
@@ -2864 +2763 @@
 #. +> trunk stable
 #: k3bsystemproblemdialog.cpp:219
-msgid ""
-"Although K3b supports all cdrtools versions since 1.10 it is highly "
-"recommended to at least use version 2.0."
+msgid "Although K3b supports all cdrtools versions since 1.10 it is highly recommended to at least use version 2.0."
 msgstr ""
 
@@ -2883 +2780 @@
 #: k3bsystemproblemdialog.cpp:240
 #, kde-format
-msgid ""
-"Since Linux kernel 2.6.8 %1 will not work when run suid root for security "
-"reasons anymore."
+msgid "Since Linux kernel 2.6.8 %1 will not work when run suid root for security reasons anymore."
 msgstr ""
 
@@ -2896 +2791 @@
 #. +> trunk stable
 #: k3bsystemproblemdialog.cpp:251
-msgid ""
-"It is highly recommended to configure cdrecord to run with root privileges, "
-"as then cdrecord runs with high priority that increases the overall stability "
-"of the burning process. As well as this, it allows the size of the burning "
-"buffer to be changed, and a lot of user problems can be solved this way."
+msgid "It is highly recommended to configure cdrecord to run with root privileges, as then cdrecord runs with high priority that increases the overall stability of the burning process. As well as this, it allows the size of the burning buffer to be changed, and a lot of user problems can be solved this way."
 msgstr ""
 
@@ -2915 +2806 @@
 #. +> trunk stable
 #: k3bsystemproblemdialog.cpp:276
-msgid ""
-"It is highly recommended to configure cdrdao to run with root privileges to "
-"increase the overall stability of the burning process."
+msgid "It is highly recommended to configure cdrdao to run with root privileges to increase the overall stability of the burning process."
 msgstr ""
 
 #. +> trunk stable
 #: k3bsystemproblemdialog.cpp:291
-msgid ""
-"K3b uses growisofs to actually write DVDs. Without growisofs you will not be "
-"able to write DVDs. Make sure to install at least version 5.10."
+msgid "K3b uses growisofs to actually write DVDs. Without growisofs you will not be able to write DVDs. Make sure to install at least version 5.10."
 msgstr ""
 
@@ -2934 +2821 @@
 #. +> trunk stable
 #: k3bsystemproblemdialog.cpp:300
-msgid ""
-"K3b needs at least growisofs version 5.10 to write DVDs. All older versions "
-"will not work and K3b will refuse to use them."
+msgid "K3b needs at least growisofs version 5.10 to write DVDs. All older versions will not work and K3b will refuse to use them."
 msgstr ""
 
@@ -2948 +2833 @@
 #. +> trunk stable
 #: k3bsystemproblemdialog.cpp:307
-msgid ""
-"K3b will not be able to copy DVDs on-the-fly or write a DVD+RW in multiple "
-"sessions using a growisofs version older than 5.12."
+msgid "K3b will not be able to copy DVDs on-the-fly or write a DVD+RW in multiple sessions using a growisofs version older than 5.12."
 msgstr ""
 
 #. +> trunk stable
 #: k3bsystemproblemdialog.cpp:315
-msgid ""
-"It is highly recommended to use growisofs 7.0 or higher. K3b will not be able "
-"to write a DVD+RW in multiple sessions using a growisofs version older than 7."
-"0."
+msgid "It is highly recommended to use growisofs 7.0 or higher. K3b will not be able to write a DVD+RW in multiple sessions using a growisofs version older than 7.0."
 msgstr ""
 
@@ -2968 +2848 @@
 #. +> trunk stable
 #: k3bsystemproblemdialog.cpp:349
-msgid ""
-"K3b needs at least mkisofs version 1.14. Older versions may introduce "
-"problems when creating data projects."
+msgid "K3b needs at least mkisofs version 1.14. Older versions may introduce problems when creating data projects."
 msgstr ""
 
@@ -2981 +2859 @@
 #. +> trunk stable
 #: k3bsystemproblemdialog.cpp:375
-msgid ""
-"K3b is not able to unmount automounted devices. Thus, especially DVD+RW "
-"rewriting might fail. There is no need to report this as a bug or feature "
-"wish; it is not possible to solve this problem from within K3b."
+msgid "K3b is not able to unmount automounted devices. Thus, especially DVD+RW rewriting might fail. There is no need to report this as a bug or feature wish; it is not possible to solve this problem from within K3b."
 msgstr ""
 
 #. +> trunk stable
 #: k3bsystemproblemdialog.cpp:379
-msgid ""
-"Replace the automounting entries in /etc/fstab with old-fashioned ones or use "
-"a user-space mounting solution like pmount or ivman."
+msgid "Replace the automounting entries in /etc/fstab with old-fashioned ones or use a user-space mounting solution like pmount or ivman."
 msgstr ""
 
@@ -3001 +2874 @@
 #. +> trunk stable
 #: k3bsystemproblemdialog.cpp:389
-msgid ""
-"Your kernel does not support writing without SCSI emulation but there is at "
-"least one writer in your system not configured to use SCSI emulation."
+msgid "Your kernel does not support writing without SCSI emulation but there is at least one writer in your system not configured to use SCSI emulation."
 msgstr ""
 
 #. +> trunk stable
 #: k3bsystemproblemdialog.cpp:393
-msgid ""
-"The best and recommended solution is to enable ide-scsi (SCSI emulation) for "
-"all devices. This way you will not have any problems. Be aware that you may "
-"still enable DMA on ide-scsi emulated drives."
+msgid "The best and recommended solution is to enable ide-scsi (SCSI emulation) for all devices. This way you will not have any problems. Be aware that you may still enable DMA on ide-scsi emulated drives."
 msgstr ""
 
@@ -3023 +2891 @@
 #: k3bsystemproblemdialog.cpp:410 k3bsystemproblemdialog.cpp:431
 #, kde-format
-msgid ""
-"The configured version of %1 does not support writing to ATAPI devices "
-"without SCSI emulation and there is at least one writer in your system not "
-"configured to use SCSI emulation."
+msgid "The configured version of %1 does not support writing to ATAPI devices without SCSI emulation and there is at least one writer in your system not configured to use SCSI emulation."
 msgstr ""
 
@@ -3032 +2897 @@
 #: k3bsystemproblemdialog.cpp:415 k3bsystemproblemdialog.cpp:439
 #, kde-format
-msgid ""
-"The best, and recommended, solution is to use ide-scsi (SCSI emulation) for "
-"all writer devices: this way you will not have any problems; or, you can "
-"install (or select as the default) a more recent version of %1."
+msgid "The best, and recommended, solution is to use ide-scsi (SCSI emulation) for all writer devices: this way you will not have any problems; or, you can install (or select as the default) a more recent version of %1."
 msgstr ""
 
@@ -3041 +2903 @@
 #: k3bsystemproblemdialog.cpp:414
 #, kde-format
-msgid ""
-"The best and recommended solution is to enable ide-scsi (SCSI emulation) for "
-"all devices. This way you will not have any problems. Or you install (or "
-"select as the default) a more recent version of %1."
+msgid "The best and recommended solution is to enable ide-scsi (SCSI emulation) for all devices. This way you will not have any problems. Or you install (or select as the default) a more recent version of %1."
 msgstr ""
 
 #. +> trunk stable
 #: k3bsystemproblemdialog.cpp:437
-msgid ""
-"Install cdrdao >= 1.1.8 which supports writing to ATAPI devices directly."
+msgid "Install cdrdao >= 1.1.8 which supports writing to ATAPI devices directly."
 msgstr ""
 
 #. +> trunk stable
 #: k3bsystemproblemdialog.cpp:453
-msgid ""
-"K3b will not be able to write DVD-R Dual Layer media using a growisofs "
-"version older than 6.0."
+msgid "K3b will not be able to write DVD-R Dual Layer media using a growisofs version older than 6.0."
 msgstr ""
 
@@ -3074 +2930 @@
 #: k3bsystemproblemdialog.cpp:468
 #, kde-format
-msgid ""
-"K3b needs write access to all the devices to perform certain tasks. Without "
-"it you might encounter problems with %1 - %2"
+msgid "K3b needs write access to all the devices to perform certain tasks. Without it you might encounter problems with %1 - %2"
 msgstr ""
 
@@ -3082 +2936 @@
 #: k3bsystemproblemdialog.cpp:470
 #, kde-format
-msgid ""
-"Make sure you have write access to %1. In case you are not using devfs or "
-"udev click \"Modify Permissions...\" and setup permissions by hand."
+msgid "Make sure you have write access to %1. In case you are not using devfs or udev click \"Modify Permissions...\" and setup permissions by hand."
 msgstr ""
 
@@ -3095 +2947 @@
 #. +> trunk stable
 #: k3bsystemproblemdialog.cpp:477
-msgid ""
-"With most modern CD/DVD/BD devices enabling DMA highly increases read/write "
-"performance. If you experience very low writing speeds this is probably the "
-"cause."
+msgid "With most modern CD/DVD/BD devices enabling DMA highly increases read/write performance. If you experience very low writing speeds this is probably the cause."
 msgstr ""
 
@@ -3115 +2964 @@
 #. +> trunk stable
 #: k3bsystemproblemdialog.cpp:496
-msgid ""
-"Sometimes it may be necessary to specify user parameters in addition to the "
-"parameters generated by K3b. This is simply a warning to make sure that these "
-"parameters are really wanted and will not be part of some bug report."
+msgid "Sometimes it may be necessary to specify user parameters in addition to the parameters generated by K3b. This is simply a warning to make sure that these parameters are really wanted and will not be part of some bug report."
 msgstr ""
 
@@ -3124 +2970 @@
 #: k3bsystemproblemdialog.cpp:499
 #, kde-format
-msgid ""
-"To remove the user parameters for the external program %1 open the K3b "
-"settings page 'Programs' and choose the tab 'User Parameters'."
+msgid "To remove the user parameters for the external program %1 open the K3b settings page 'Programs' and choose the tab 'User Parameters'."
 msgstr ""
 
@@ -3136 +2980 @@
 #. +> trunk stable
 #: k3bsystemproblemdialog.cpp:521
-msgid ""
-"K3b could not load or find the MP3 decoder plugin. This means that you will "
-"not be able to create Audio CDs from MP3 files. Many Linux distributions do "
-"not include MP3 support for legal reasons."
+msgid "K3b could not load or find the MP3 decoder plugin. This means that you will not be able to create Audio CDs from MP3 files. Many Linux distributions do not include MP3 support for legal reasons."
 msgstr ""
 
 #. +> trunk stable
 #: k3bsystemproblemdialog.cpp:524
-msgid ""
-"To enable MP3 support, please install the MAD MP3 decoding library as well as "
-"the K3b MAD MP3 decoder plugin (the latter may already be installed but not "
-"functional due to the missing libmad). Some distributions allow installation "
-"of MP3 support via an online update tool."
+msgid "To enable MP3 support, please install the MAD MP3 decoding library as well as the K3b MAD MP3 decoder plugin (the latter may already be installed but not functional due to the missing libmad). Some distributions allow installation of MP3 support via an online update tool."
 msgstr ""
 
@@ -3158 +2995 @@
 #. +> trunk stable
 #: k3bsystemproblemdialog.cpp:540
-msgid ""
-"Your system's locale charset (i.e. the charset used to encode filenames) is "
-"set to ANSI_X3.4-1968. It is highly unlikely that this has been done "
-"intentionally. Most likely the locale is not set at all. An invalid setting "
-"will result in problems when creating data projects."
+msgid "Your system's locale charset (i.e. the charset used to encode filenames) is set to ANSI_X3.4-1968. It is highly unlikely that this has been done intentionally. Most likely the locale is not set at all. An invalid setting will result in problems when creating data projects."
 msgstr ""
 
 #. +> trunk stable
 #: k3bsystemproblemdialog.cpp:544
-msgid ""
-"To properly set the locale charset make sure the LC_* environment variables "
-"are set. Normally the distribution setup tools take care of this."
+msgid "To properly set the locale charset make sure the LC_* environment variables are set. Normally the distribution setup tools take care of this."
 msgstr ""
 
@@ -3179 +3010 @@
 #. +> trunk stable
 #: k3bsystemproblemdialog.cpp:558
-msgid ""
-"It is not recommended to run K3b under the root user account. This introduces "
-"unnecessary security risks."
+msgid "It is not recommended to run K3b under the root user account. This introduces unnecessary security risks."
 msgstr ""
 
 #. +> trunk stable
 #: k3bsystemproblemdialog.cpp:560
-msgid ""
-"Run K3b from a proper user account and setup the device and external tool "
-"permissions appropriately."
+msgid "Run K3b from a proper user account and setup the device and external tool permissions appropriately."
 msgstr ""
 
@@ -3218 +3045 @@
 #. +> trunk stable
 #: k3btempdirselectionwidget.cpp:83
-msgid ""
-"<p>This is the folder in which K3b will save the <em>image files</em>.<p>"
-"Please make sure that it resides on a partition that has enough free space."
+msgid "<p>This is the folder in which K3b will save the <em>image files</em>.<p>Please make sure that it resides on a partition that has enough free space."
 msgstr ""
 
@@ -3363 +3188 @@
 #. +> trunk stable
 #: k3bwriterselectionwidget.cpp:173
-msgid ""
-"<p>Select the medium that you want to use for burning.<p>In most cases there "
-"will only be one medium available which does not leave much choice."
+msgid "<p>Select the medium that you want to use for burning.<p>In most cases there will only be one medium available which does not leave much choice."
 msgstr ""
 
 #. +> trunk stable
 #: k3bwriterselectionwidget.cpp:176
-msgid ""
-"<p>Select the speed with which you want to burn.<p><b>Auto</b><br>This will "
-"choose the maximum writing speed possible with the used medium. This is the "
-"recommended selection for most media.</p><p><b>Ignore</b> (DVD only)<br>This "
-"will leave the speed selection to the writer device. Use this if K3b is "
-"unable to set the writing speed.<p>1x refers to 175 KB/s for CD, 1385 KB/s "
-"for DVD, and 4496 KB/s for Blu-ray.</p><p><b>Caution:</b> Make sure your "
-"system is able to send the data fast enough to prevent buffer underruns."
+msgid "<p>Select the speed with which you want to burn.<p><b>Auto</b><br>This will choose the maximum writing speed possible with the used medium. This is the recommended selection for most media.</p><p><b>Ignore</b> (DVD only)<br>This will leave the speed selection to the writer device. Use this if K3b is unable to set the writing speed.<p>1x refers to 175 KB/s for CD, 1385 KB/s for DVD, and 4496 KB/s for Blu-ray.</p><p><b>Caution:</b> Make sure your system is able to send the data fast enough to prevent buffer underruns."
 msgstr ""
 
 #. +> trunk stable
 #: k3bwriterselectionwidget.cpp:187
-msgid ""
-"<p>K3b uses the command line tools cdrecord, growisofs, and cdrdao to "
-"actually write a CD or DVD.<p>Normally K3b chooses the best suited "
-"application for every task automatically but in some cases it may be possible "
-"that one of the applications does not work as intended with a certain writer. "
-"In this case one may select the application manually."
+msgid "<p>K3b uses the command line tools cdrecord, growisofs, and cdrdao to actually write a CD or DVD.<p>Normally K3b chooses the best suited application for every task automatically but in some cases it may be possible that one of the applications does not work as intended with a certain writer. In this case one may select the application manually."
 msgstr ""
 
@@ -3410 +3221 @@
 #. +> trunk stable
 #: k3bwriterselectionwidget.cpp:607
-msgid ""
-"<p>K3b is not able to perfectly determine the maximum writing speed of an "
-"optical writer. Writing speed is always reported subject to the inserted "
-"medium.<p>Please enter the writing speed here and K3b will remember it for "
-"future sessions (Example: 16x)."
+msgid "<p>K3b is not able to perfectly determine the maximum writing speed of an optical writer. Writing speed is always reported subject to the inserted medium.<p>Please enter the writing speed here and K3b will remember it for future sessions (Example: 16x)."
 msgstr ""
 
@@ -3429 +3236 @@
 #. +> trunk stable
 #: k3bwritingmodewidget.cpp:29
-msgid ""
-"<em>Disk At Once</em> or more properly <em>Session At Once</em>. The laser is "
-"never turned off while writing the CD or DVD. This is the preferred mode to "
-"write audio CDs since it allows pregaps other than 2 seconds. Not all writers "
-"support DAO.<br>DVD-R(W)s written in DAO provide the best DVD-Video "
-"compatibility."
+msgid "<em>Disk At Once</em> or more properly <em>Session At Once</em>. The laser is never turned off while writing the CD or DVD. This is the preferred mode to write audio CDs since it allows pregaps other than 2 seconds. Not all writers support DAO.<br>DVD-R(W)s written in DAO provide the best DVD-Video compatibility."
 msgstr ""
 
 #. +> trunk stable
 #: k3bwritingmodewidget.cpp:35
-msgid ""
-"<em>Track At Once</em> should be supported by every CD writer. The laser will "
-"be turned off after every track.<br>Most CD writers need this mode for "
-"writing multisession CDs."
+msgid "<em>Track At Once</em> should be supported by every CD writer. The laser will be turned off after every track.<br>Most CD writers need this mode for writing multisession CDs."
 msgstr ""
 
 #. +> trunk stable
 #: k3bwritingmodewidget.cpp:41
-msgid ""
-"RAW writing mode. The error correction data is created by the software "
-"instead of the writer device.<br>Try this if your CD writer fails to write in "
-"DAO and TAO."
+msgid "RAW writing mode. The error correction data is created by the software instead of the writer device.<br>Try this if your CD writer fails to write in DAO and TAO."
 msgstr ""
 
 #. +> trunk stable
 #: k3bwritingmodewidget.cpp:45
-msgid ""
-"Incremental sequential is the default writing mode for DVD-R(W). It allows "
-"multisession DVD-R(W)s. It only applies to DVD-R(W)."
+msgid "Incremental sequential is the default writing mode for DVD-R(W). It allows multisession DVD-R(W)s. It only applies to DVD-R(W)."
 msgstr ""
 
 #. +> trunk stable
 #: k3bwritingmodewidget.cpp:48
-msgid ""
-"Restricted Overwrite allows to use a DVD-RW just like a DVD-RAM or a DVD+RW. "
-"The media may just be overwritten. It is not possible to write multisession "
-"DVD-RWs in this mode but K3b uses growisofs to grow an ISO9660 filesystem "
-"within the first session, thus allowing new files to be added to an already "
-"burned disk."
+msgid "Restricted Overwrite allows to use a DVD-RW just like a DVD-RAM or a DVD+RW. The media may just be overwritten. It is not possible to write multisession DVD-RWs in this mode but K3b uses growisofs to grow an ISO9660 filesystem within the first session, thus allowing new files to be added to an already burned disk."
 msgstr ""
 
@@ -3482 +3271 @@
 #. +> trunk stable
 #: k3bwritingmodewidget.cpp:106
-msgid ""
-"Be aware that the writing mode is ignored when writing DVD+R(W) and BD-R(E) "
-"since there is only one way to write them."
+msgid "Be aware that the writing mode is ignored when writing DVD+R(W) and BD-R(E) since there is only one way to write them."
 msgstr ""
 
@@ -3521 +3308 @@
 #. +> trunk stable
 #: main.cpp:38
-msgid ""
-"<p>K3b is a full-featured CD/DVD/Blu-ray burning and ripping application.<br/>"
-"It supports a variety of project types as well as copying of optical media, "
-"burning of different types of images, and ripping Audio CDs, Video CDs, and "
-"Video DVDs.<br/>Its convenient user interface is targeted at all audiences, "
-"trying to be as simple as possible for novice users while also providing all "
-"features an advanced user might need."
+msgid "<p>K3b is a full-featured CD/DVD/Blu-ray burning and ripping application.<br/>It supports a variety of project types as well as copying of optical media, burning of different types of images, and ripping Audio CDs, Video CDs, and Video DVDs.<br/>Its convenient user interface is targeted at all audiences, trying to be as simple as possible for novice users while also providing all features an advanced user might need."
 msgstr ""
 
@@ -3711 +3492 @@
 #. +> trunk stable
 #: main.cpp:82
-msgid ""
-"For libsamplerate which is used for generic resampling in the audio decoder "
-"framework."
+msgid "For libsamplerate which is used for generic resampling in the audio decoder framework."
 msgstr ""
 
@@ -3784 +3563 @@
 #. +> trunk stable
 #: main.cpp:103
-msgid ""
-"Rob created a great theme and came up with the idea for transparent themes."
+msgid "Rob created a great theme and came up with the idea for transparent themes."
 msgstr ""
 
@@ -3890 +3668 @@
 #. +> trunk stable
 #: main.cpp:129
-msgid ""
-"Set the device to be used for new projects. (This option has no effect: its "
-"main purpose is to enable handling of empty media from the KDE Media Manager.)"
+msgid "Set the device to be used for new projects. (This option has no effect: its main purpose is to enable handling of empty media from the KDE Media Manager.)"
 msgstr ""
 
@@ -4069 +3845 @@
 #. +> trunk stable
 #: misc/k3bimagewritingdialog.cpp:607
-msgid ""
-"<p><b>Image types supported by K3b:</p><p><b>Plain image</b><br/>Plain images "
-"are written as is to the medium using a single data track. Typical plain "
-"images are iso images as created by K3b's data project.<p><b>Cue/bin images<"
-"/b><br/>Cue/bin images consist of a cue file describing the table of contents "
-"of the medium and an image file which contains the actual data. The data will "
-"be written to the medium according to the cue file.<p><b>Audio Cue image</b><"
-"br/>Audio cue images are a special kind of cue/bin image containing an image "
-"of an audio CD. The actual audio data can be encoded using any audio format "
-"supported by K3b. Audio cue files can also be imported into K3b audio "
-"projects which allows to change the order and add or remove tracks.<p><b>"
-"Cdrecord clone images</b><br/>K3b creates a cdrecord clone image of a "
-"single-session CD when copying a CD in clone mode. These images can be reused "
-"here.<p><b>Cdrdao TOC files</b><br/>K3b supports writing cdrdao's own image "
-"format, the toc files."
+msgid "<p><b>Image types supported by K3b:</p><p><b>Plain image</b><br/>Plain images are written as is to the medium using a single data track. Typical plain images are iso images as created by K3b's data project.<p><b>Cue/bin images</b><br/>Cue/bin images consist of a cue file describing the table of contents of the medium and an image file which contains the actual data. The data will be written to the medium according to the cue file.<p><b>Audio Cue image</b><br/>Audio cue images are a special kind of cue/bin image containing an image of an audio CD. The actual audio data can be encoded using any audio format supported by K3b. Audio cue files can also be imported into K3b audio projects which allows to change the order and add or remove tracks.<p><b>Cdrecord clone images</b><br/>K3b creates a cdrecord clone image of a single-session CD when copying a CD in clone mode. These images can be reused here.<p><b>Cdrdao TOC files</b><br/>K3b supports writing cdrdao's own image format, the toc files."
 msgstr ""
 
 #. +> trunk stable
 #: misc/k3bimagewritingdialog.cpp:707
-msgid ""
-"<p>The actual file size does not match the size declared in the file header. "
-"If it has been downloaded make sure the download is complete.</p><p>Only "
-"continue if you know what you are doing.</p>"
+msgid "<p>The actual file size does not match the size declared in the file header. If it has been downloaded make sure the download is complete.</p><p>Only continue if you know what you are doing.</p>"
 msgstr ""
 
@@ -4253 +4012 @@
 #. +> trunk stable
 #: misc/k3bmediacopydialog.cpp:218
-msgid ""
-"<p>If this option is checked K3b will disable the source drive's ECC/EDC "
-"error correction. This way sectors that are unreadable by intention can be "
-"read.<p>This may be useful for cloning CDs with copy protection based on "
-"corrupted sectors."
+msgid "<p>If this option is checked K3b will disable the source drive's ECC/EDC error correction. This way sectors that are unreadable by intention can be read.<p>This may be useful for cloning CDs with copy protection based on corrupted sectors."
 msgstr ""
 
 #. +> trunk stable
 #: misc/k3bmediacopydialog.cpp:223
-msgid ""
-"<p>If this option is checked K3b will search for CD-Text on the source CD. "
-"Disable it if your CD drive has problems with reading CD-Text or you want to "
-"stick to Cddb info."
+msgid "<p>If this option is checked K3b will search for CD-Text on the source CD. Disable it if your CD drive has problems with reading CD-Text or you want to stick to Cddb info."
 msgstr ""
 
 #. +> trunk stable
 #: misc/k3bmediacopydialog.cpp:226
-msgid ""
-"<p>If this option is checked and K3b is not able to read a data sector from "
-"the source medium it will be replaced with zeros on the resulting copy."
+msgid "<p>If this option is checked and K3b is not able to read a data sector from the source medium it will be replaced with zeros on the resulting copy."
 msgstr ""
 
 #. +> trunk
 #: misc/k3bmediacopydialog.cpp:231
-msgid ""
-"<p>This is the normal copy mode for DVD, Blu-ray, and most CD media types. It "
-"allows copying Audio CDs, multi and single session Data Media, and Enhanced "
-"Audio CDs (an Audio CD containing an additional data session).<p>For Video "
-"CDs please use the CD Cloning mode."
+msgid "<p>This is the normal copy mode for DVD, Blu-ray, and most CD media types. It allows copying Audio CDs, multi and single session Data Media, and Enhanced Audio CDs (an Audio CD containing an additional data session).<p>For Video CDs please use the CD Cloning mode."
 msgstr ""
 
 #. +> stable
 #: misc/k3bmediacopydialog.cpp:231
-msgid ""
-"<p>This is the normal copy mode for DVD, Blu-ray, and most CD media types. It "
-"allows copying Audio CDs, multi and single session Data Media, and Enhanced "
-"Audio CDs (an Audio CD containing an additional data session).<p>For VideoCDs "
-"please use the CD Cloning mode."
+msgid "<p>This is the normal copy mode for DVD, Blu-ray, and most CD media types. It allows copying Audio CDs, multi and single session Data Media, and Enhanced Audio CDs (an Audio CD containing an additional data session).<p>For VideoCDs please use the CD Cloning mode."
 msgstr ""
 
 #. +> trunk
 #: misc/k3bmediacopydialog.cpp:236
-msgid ""
-"<p>In CD Cloning mode K3b performs a raw copy of the CD. That means it does "
-"not care about the content but simply copies the CD bit by bit. It may be "
-"used to copy Video CDs or CDs which contain erroneous sectors.<p><b>Caution:<"
-"/b> Only single session CDs can be cloned."
+msgid "<p>In CD Cloning mode K3b performs a raw copy of the CD. That means it does not care about the content but simply copies the CD bit by bit. It may be used to copy Video CDs or CDs which contain erroneous sectors.<p><b>Caution:</b> Only single session CDs can be cloned."
 msgstr ""
 
 #. +> stable
 #: misc/k3bmediacopydialog.cpp:236
-msgid ""
-"<p>In CD Cloning mode K3b performs a raw copy of the CD. That means it does "
-"not care about the content but simply copies the CD bit by bit. It may be "
-"used to copy VideoCDs or CDs which contain erroneous sectors.<p><b>Caution:<"
-"/b> Only single session CDs can be cloned."
+msgid "<p>In CD Cloning mode K3b performs a raw copy of the CD. That means it does not care about the content but simply copies the CD bit by bit. It may be used to copy VideoCDs or CDs which contain erroneous sectors.<p><b>Caution:</b> Only single session CDs can be cloned."
 msgstr ""
 
 #. +> trunk stable
 #: misc/k3bmediacopydialog.cpp:273 projects/k3bprojectburndialog.cpp:213
-msgid ""
-"There does not seem to be enough free space in the temporary folder. Write "
-"anyway?"
+msgid "There does not seem to be enough free space in the temporary folder. Write anyway?"
 msgstr ""
 
@@ -4368 +4100 @@
 #. +> trunk stable
 #: misc/k3bmediaformattingdialog.cpp:88
-msgid ""
-"<p>If this option is checked K3b will format a DVD-RW even if it is empty. It "
-"may also be used to force K3b to format a DVD+RW, BD-RE or a DVD-RW in "
-"restricted overwrite mode.<p><b>Caution:</b> It is not recommended to format "
-"a DVD often as it may become unusable after only 10-20 reformat procedures.<p>"
-"DVD+RW and BD-RE media only needs to be formatted once. After that it just "
-"needs to be overwritten. The same applies to DVD-RW in restricted overwrite "
-"mode."
+msgid "<p>If this option is checked K3b will format a DVD-RW even if it is empty. It may also be used to force K3b to format a DVD+RW, BD-RE or a DVD-RW in restricted overwrite mode.<p><b>Caution:</b> It is not recommended to format a DVD often as it may become unusable after only 10-20 reformat procedures.<p>DVD+RW and BD-RE media only needs to be formatted once. After that it just needs to be overwritten. The same applies to DVD-RW in restricted overwrite mode."
 msgstr ""
 
@@ -4385 +4110 @@
 #. +> trunk stable
 #: misc/k3bmediaformattingdialog.cpp:99
-msgid ""
-"<p>If this option is checked K3b will tell the writer to perform a quick "
-"format.<p>Erasing a rewritable medium completely can take a very long time "
-"and some writers perform a full format even if quick format is enabled."
+msgid "<p>If this option is checked K3b will tell the writer to perform a quick format.<p>Erasing a rewritable medium completely can take a very long time and some writers perform a full format even if quick format is enabled."
 msgstr ""
 
@@ -4579 +4301 @@
 #. +> trunk stable
 #: option/base_k3bmiscoptiontab.ui:51
-msgid ""
-"<p>This is the default temporary directory. This is where K3b will store "
-"temporary files such as iso images or decoded audio files.<p>Be aware that "
-"the temporary directory may also be changed in every project burn dialog."
+msgid "<p>This is the default temporary directory. This is where K3b will store temporary files such as iso images or decoded audio files.<p>Be aware that the temporary directory may also be changed in every project burn dialog."
 msgstr ""
 
@@ -4601 +4320 @@
 #. +> trunk stable
 #: option/base_k3bmiscoptiontab.ui:72
-msgid ""
-"<p>If this option is checked K3b will check the system configuration for any "
-"problems on startup and when the user changes the settings."
+msgid "<p>If this option is checked K3b will check the system configuration for any problems on startup and when the user changes the settings."
 msgstr ""
 
@@ -4627 +4344 @@
 #. +> trunk
 #: option/base_k3bmiscoptiontab.ui:91
-msgid ""
-"<p>If this option is checked K3b will display the progress in KDE "
-"notification area. If K3b is run outside KDE environment a separate progress "
-"window may be shown instead.</p>"
+msgid "<p>If this option is checked K3b will display the progress in KDE notification area. If K3b is run outside KDE environment a separate progress window may be shown instead.</p>"
 msgstr ""
 
@@ -4649 +4363 @@
 #. +> trunk stable
 #: option/base_k3bmiscoptiontab.ui:104
-msgid ""
-"<p>If this option is checked K3b will hide the main window while displaying "
-"the progress dialog."
+msgid "<p>If this option is checked K3b will hide the main window while displaying the progress dialog."
 msgstr ""
 
@@ -4657 +4369 @@
 #. +> stable
 #: option/base_k3bmiscoptiontab.ui:83
-msgid ""
-"<p>If this option is checked K3b will display the progress in an OSD which "
-"always stays on top of all other windows."
+msgid "<p>If this option is checked K3b will display the progress in an OSD which always stays on top of all other windows."
 msgstr ""
 
@@ -4689 +4399 @@
 #. +> trunk stable
 #: option/base_k3bmiscoptiontab.ui:127
-msgid ""
-"<p>If this option is checked K3b will not close action dialogs such as the CD "
-"Copy dialog after the process has been finished. It will be kept open to "
-"start a new process, for instance, copying another CD."
+msgid "<p>If this option is checked K3b will not close action dialogs such as the CD Copy dialog after the process has been finished. It will be kept open to start a new process, for instance, copying another CD."
 msgstr ""
 
@@ -4723 +4430 @@
 #. +> trunk stable
 #: option/base_k3bpluginoptiontab.ui:47 option/k3bpluginoptiontab.cpp:40
-msgid ""
-"<p>Here all <em>K3b Plugins</em> may be configured. Be aware that this does "
-"not include the <em>KPart Plugins</em> which embed themselves in the K3b menu "
-"structure.</p>"
+msgid "<p>Here all <em>K3b Plugins</em> may be configured. Be aware that this does not include the <em>KPart Plugins</em> which embed themselves in the K3b menu structure.</p>"
 msgstr ""
 
@@ -4817 +4521 @@
 #. +> trunk stable
 #: option/k3badvancedoptiontab.cpp:100
-msgid ""
-"Show advanced GUI elements like allowing to choose between cdrecord and cdrdao"
+msgid "Show advanced GUI elements like allowing to choose between cdrecord and cdrdao"
 msgstr ""
 
@@ -4838 +4541 @@
 #. +> trunk stable
 #: option/k3badvancedoptiontab.cpp:105
-msgid ""
-"<p>If this option is checked additional GUI elements which allow to influence "
-"the behavior of K3b are shown. This includes the manual selection of the used "
-"burning tool. (Choose between cdrecord and cdrdao when writing a CD or "
-"between cdrecord and growisofs when writing a DVD/BD.)<p><b>Be aware that K3b "
-"does not support all possible tools in all project types and actions.</b>"
+msgid "<p>If this option is checked additional GUI elements which allow to influence the behavior of K3b are shown. This includes the manual selection of the used burning tool. (Choose between cdrecord and cdrdao when writing a CD or between cdrecord and growisofs when writing a DVD/BD.)<p><b>Be aware that K3b does not support all possible tools in all project types and actions.</b>"
 msgstr ""
 
 #. +> trunk stable
 #: option/k3badvancedoptiontab.cpp:113
-msgid ""
-"<p>Each medium has an official maximum capacity which is stored in a "
-"read-only area of the medium and is guaranteed by the vendor. However, this "
-"official maximum is not always the actual maximum. Many media have an actual "
-"total capacity that is slightly larger than the official amount.<p>If this "
-"option is checked K3b will disable a safety check that prevents burning "
-"beyond the official capacity.<p><b>Caution:</b> Enabling this option can "
-"cause failures in the end of the burning process if K3b attempts to write "
-"beyond the official capacity. It makes sense to first determine the actual "
-"maximum capacity of the media brand with a simulated burn."
+msgid "<p>Each medium has an official maximum capacity which is stored in a read-only area of the medium and is guaranteed by the vendor. However, this official maximum is not always the actual maximum. Many media have an actual total capacity that is slightly larger than the official amount.<p>If this option is checked K3b will disable a safety check that prevents burning beyond the official capacity.<p><b>Caution:</b> Enabling this option can cause failures in the end of the burning process if K3b attempts to write beyond the official capacity. It makes sense to first determine the actual maximum capacity of the media brand with a simulated burn."
 msgstr ""
 
 #. +> trunk stable
 #: option/k3badvancedoptiontab.cpp:124
-msgid ""
-"<p>If this option is checked K3b will automatically erase CD-RWs and format "
-"DVD-RWs if one is found instead of an empty media before writing."
+msgid "<p>If this option is checked K3b will automatically erase CD-RWs and format DVD-RWs if one is found instead of an empty media before writing."
 msgstr ""
 
@@ -4870 +4557 @@
 #: option/k3badvancedoptiontab.cpp:128
 #, kde-format
-msgid ""
-"<p>K3b uses a software buffer during the burning process to avoid gaps in the "
-"data stream due to high system load. The default sizes used are %1 MB for CD "
-"and %2 MB for DVD burning.<p>If this option is checked the value specified "
-"will be used for both CD and DVD burning."
+msgid "<p>K3b uses a software buffer during the burning process to avoid gaps in the data stream due to high system load. The default sizes used are %1 MB for CD and %2 MB for DVD burning.<p>If this option is checked the value specified will be used for both CD and DVD burning."
 msgstr ""
 
 #. +> trunk stable
 #: option/k3badvancedoptiontab.cpp:134
-msgid ""
-"<p>If this option is checked K3b will not eject the medium once the burn "
-"process finishes. This can be helpful in case one leaves the computer after "
-"starting the burning and does not want the tray to be open all the time.<p>"
-"However, on Linux systems a freshly burned medium has to be reloaded. "
-"Otherwise the system will not detect the changes and still treat it as an "
-"empty medium."
+msgid "<p>If this option is checked K3b will not eject the medium once the burn process finishes. This can be helpful in case one leaves the computer after starting the burning and does not want the tray to be open all the time.<p>However, on Linux systems a freshly burned medium has to be reloaded. Otherwise the system will not detect the changes and still treat it as an empty medium."
 msgstr ""
 
 #. +> trunk stable
 #: option/k3badvancedoptiontab.cpp:140
-msgid ""
-"<p>If this option is checked K3b will continue in some situations which would "
-"otherwise be deemed as unsafe.<p>This setting for example disables the check "
-"for medium speed verification. Thus, one can force K3b to burn a high speed "
-"medium on a low speed writer.<p><b>Caution:</b> Enabling this option may "
-"result in damaged media."
+msgid "<p>If this option is checked K3b will continue in some situations which would otherwise be deemed as unsafe.<p>This setting for example disables the check for medium speed verification. Thus, one can force K3b to burn a high speed medium on a low speed writer.<p><b>Caution:</b> Enabling this option may result in damaged media."
 msgstr ""
 
@@ -4905 +4577 @@
 #. +> trunk stable
 #: option/k3bdeviceoptiontab.cpp:45
-msgid ""
-"K3b tries to detect all your devices properly. If K3b is unable to detect "
-"your drive, you need to modify their permissions to give K3b write access to "
-"all devices."
+msgid "K3b tries to detect all your devices properly. If K3b is unable to detect your drive, you need to modify their permissions to give K3b write access to all devices."
 msgstr ""
 
@@ -5022 +4691 @@
 #. +> trunk stable
 #: option/k3bexternalbinoptiontab.cpp:37
-msgid ""
-"Specify the paths to the external programs that K3b needs to work properly, "
-"or press \"Search\" to let K3b search for the programs."
+msgid "Specify the paths to the external programs that K3b needs to work properly, or press \"Search\" to let K3b search for the programs."
 msgstr ""
 
@@ -5047 +4714 @@
 #. +> trunk
 #: option/k3bexternalbinwidget.cpp:80
-msgid ""
-"<p>If K3b finds more than one installed version of a program it will choose "
-"one as the <em>default</em>, which will be used to do the work. If you want "
-"to change the default, check desired version on the list."
+msgid "<p>If K3b finds more than one installed version of a program it will choose one as the <em>default</em>, which will be used to do the work. If you want to change the default, check desired version on the list."
 msgstr ""
 
 #. +> stable
 #: option/k3bexternalbinwidget.cpp:121
-msgid ""
-"<p>If K3b finds more than one installed version of a program it will choose "
-"one as the <em>default</em>, which will be used to do the work. If you want "
-"to change the default, select the desired version and press this button."
+msgid "<p>If K3b finds more than one installed version of a program it will choose one as the <em>default</em>, which will be used to do the work. If you want to change the default, select the desired version and press this button."
 msgstr ""
 
@@ -5079 +4740 @@
 #. +> trunk stable
 #: option/k3bexternalbinwidget.cpp:113 option/k3bexternalbinwidget.cpp:123
+#, fuzzy
 msgid "Search Path"
-msgstr ""
+msgstr "Putanja pretraÅŸivanja"
 
 #. +> trunk stable
 #: option/k3bexternalbinwidget.cpp:115
-msgid ""
-"<qt><b>Hint:</b> to force K3b to use another than the default name for the "
-"executable specify it in the search path.</qt>"
-msgstr ""
+#, fuzzy
+msgid "<qt><b>Hint:</b> to force K3b to use another than the default name for the executable specify it in the search path.</qt>"
+msgstr "<qt><b>Savjet:</b> kako biste prisilili K3b na korištenje posebnog naziva izvršnog programa, navedite ga u putanji pretraşivanja.</qt>"
 
 #. +> stable
@@ -5144 +4805 @@
 #. +> trunk stable
 #: option/k3bmiscoptiontab.cpp:56
-msgid ""
-"K3b handles three sets of settings in action dialogs (action dialogs include "
-"the CD Copy dialog or the Audio CD project dialog):"
+msgid "K3b handles three sets of settings in action dialogs (action dialogs include the CD Copy dialog or the Audio CD project dialog):"
 msgstr ""
 
 #. +> trunk stable
 #: option/k3bmiscoptiontab.cpp:59
-msgid ""
-"One of these sets is loaded once an action dialog is opened. This setting "
-"defines which set it will be."
+msgid "One of these sets is loaded once an action dialog is opened. This setting defines which set it will be."
 msgstr ""
 
@@ -5183 +4840 @@
 #. +> trunk stable
 #: option/k3bmiscoptiontab.cpp:128
-msgid ""
-"You specified a file for the temporary folder. K3b will use its base path as "
-"the temporary folder."
+msgid "You specified a file for the temporary folder. K3b will use its base path as the temporary folder."
 msgstr ""
 
@@ -5328 +4983 @@
 #: option/k3bthemeoptiontab.cpp:186
 #, kde-format
-msgid ""
-"<qt>Are you sure you want to remove the <strong>%1</strong> theme?<br><br>"
-"This will delete the files installed by this theme.</qt>"
+msgid "<qt>Are you sure you want to remove the <strong>%1</strong> theme?<br><br>This will delete the files installed by this theme.</qt>"
 msgstr ""
 
@@ -5430 +5083 @@
 "<p>Set the ISO-9660 conformance level.\n"
 "<ul>\n"
-"<li>Level 1: Files may only consist of one section and filenames are "
-"restricted to 8.3 characters.</li>\n"
+"<li>Level 1: Files may only consist of one section and filenames are restricted to 8.3 characters.</li>\n"
 "<li>Level 2: Files may only consist of one section.</li>\n"
 "<li>Level 3: No restrictions.</li>\n"
 "</ul>\n"
-"<p>With all ISO-9660 levels, all filenames are restricted to upper case "
-"letters, numbers and the underscore (_). The maximum filename length is 31 "
-"characters, the directory nesting level is restricted to 8 and the maximum "
-"path length is limited to 255 characters. (These restrictions may be violated "
-"with the additional ISO-9660 features K3b offers.)"
+"<p>With all ISO-9660 levels, all filenames are restricted to upper case letters, numbers and the underscore (_). The maximum filename length is 31 characters, the directory nesting level is restricted to 8 and the maximum path length is limited to 255 characters. (These restrictions may be violated with the additional ISO-9660 features K3b offers.)"
 msgstr ""
 
@@ -5549 +5197 @@
 #: projects/base_k3badvanceddataimagesettings.ui:239
 msgid ""
-"<p>If this option is checked, K3b will generate the System Use Sharing "
-"Protocol records (SUSP) specified by the Rock Ridge Interchange Protocol "
-"(IEEE-P1282).\n"
-"<p>Rock Ridge extends the ISO-9660 filesystem by features equal to the UNIX "
-"filesystems (permissions, symbolic links, very long filenames, ...). It uses "
-"ISO-8859 or UTF-16 based characters and allows 255 octets.\n"
-"<p>Rock Ridge extensions are located at the end of each ISO-9660 directory "
-"record. This makes the Rock Ridge tree closely coupled to the ISO-9660 tree.\n"
-"<p><b>It is highly recommended to use Rock Ridge extensions on every data CD "
-"or DVD.</b>"
+"<p>If this option is checked, K3b will generate the System Use Sharing Protocol records (SUSP) specified by the Rock Ridge Interchange Protocol (IEEE-P1282).\n"
+"<p>Rock Ridge extends the ISO-9660 filesystem by features equal to the UNIX filesystems (permissions, symbolic links, very long filenames, ...). It uses ISO-8859 or UTF-16 based characters and allows 255 octets.\n"
+"<p>Rock Ridge extensions are located at the end of each ISO-9660 directory record. This makes the Rock Ridge tree closely coupled to the ISO-9660 tree.\n"
+"<p><b>It is highly recommended to use Rock Ridge extensions on every data CD or DVD.</b>"
 msgstr ""
 
@@ -5577 +5219 @@
 #: projects/base_k3badvanceddataimagesettings.ui:259
 msgid ""
-"<p>If this option is checked, K3b will add additional Joliet extensions to "
-"the ISO-9660 file system.\n"
-"<p>Joliet is not an accepted independent international standard like ISO-9660 "
-"or Rock Ridge. It is mainly used on Windows systems.\n"
-"<p>Joliet does not allow all characters, so the Joliet filenames are not "
-"identical to the filenames on disk (as compared to Rock Ridge). Joliet has a "
-"filename length limitation of 64 chars (independent from the character coding "
-"and type e.g. European vs. Japanese). This is inconvenient, as modern file "
-"systems all allow 255 characters per path name component.\n"
+"<p>If this option is checked, K3b will add additional Joliet extensions to the ISO-9660 file system.\n"
+"<p>Joliet is not an accepted independent international standard like ISO-9660 or Rock Ridge. It is mainly used on Windows systems.\n"
+"<p>Joliet does not allow all characters, so the Joliet filenames are not identical to the filenames on disk (as compared to Rock Ridge). Joliet has a filename length limitation of 64 chars (independent from the character coding and type e.g. European vs. Japanese). This is inconvenient, as modern file systems all allow 255 characters per path name component.\n"
 "<p>Joliet uses UTF-16 coding.\n"
-"<p><b>Caution:</b> With the exception of Linux and FreeBSD, there is no "
-"POSIX-like OS that supports Joliet. So <b>never create Joliet-only CDs or "
-"DVDs</b> for that reason."
+"<p><b>Caution:</b> With the exception of Linux and FreeBSD, there is no POSIX-like OS that supports Joliet. So <b>never create Joliet-only CDs or DVDs</b> for that reason."
 msgstr ""
 
@@ -5608 +5242 @@
 #: projects/base_k3badvanceddataimagesettings.ui:273
 msgid ""
-"<p>If this option is checked K3b will create UDF filesystem structures in "
-"addition to the ISO9660 filesystem.\n"
-"<p>The UDF (<em><b>U</b>niversal <b>D</b>isk <b>F</b>ormat</em>) is mainly "
-"used for DVDs."
+"<p>If this option is checked K3b will create UDF filesystem structures in addition to the ISO9660 filesystem.\n"
+"<p>The UDF (<em><b>U</b>niversal <b>D</b>isk <b>F</b>ormat</em>) is mainly used for DVDs."
 msgstr ""
 
@@ -5631 +5263 @@
 #: projects/base_k3badvanceddataimagesettings.ui:293
 msgid ""
-"<p>If this option is checked, all files in the resulting file system will "
-"have exactly the same permissions as the source files. (Otherwise, all files "
-"will have equal permissions and be owned by root).\n"
-"<p>This is mainly useful for backups.<p><b>Caution:</b> The permissions may "
-"not make much sense on other file systems; for example, if a user that owns a "
-"file on the CD or DVD does not exist."
+"<p>If this option is checked, all files in the resulting file system will have exactly the same permissions as the source files. (Otherwise, all files will have equal permissions and be owned by root).\n"
+"<p>This is mainly useful for backups.<p><b>Caution:</b> The permissions may not make much sense on other file systems; for example, if a user that owns a file on the CD or DVD does not exist."
 msgstr ""
 
@@ -5759 +5387 @@
 msgid ""
 "<p><b>CD-Text</b>\n"
-"<p>If this option is checked K3b uses some otherwise unused space on the "
-"Audio CD to store additional information, such as the artist's name or the CD "
-"title.\n"
+"<p>If this option is checked K3b uses some otherwise unused space on the Audio CD to store additional information, such as the artist's name or the CD title.\n"
 "<p>CD-Text is an extension to the audio CD standard introduced by Sony.\n"
-"<p>CD-Text will only be usable on CD players that support this extension "
-"(mostly car CD players) and software like K3b, of course.\n"
-"<p>Since a CD-Text-enhanced Audio CD will work in any Hifi CD or DVD player "
-"even if the player does not support CD-Text explicitly, enabling it is never "
-"a bad idea (just remember to fill in the CD-Text information)."
+"<p>CD-Text will only be usable on CD players that support this extension (mostly car CD players) and software like K3b, of course.\n"
+"<p>Since a CD-Text-enhanced Audio CD will work in any Hifi CD or DVD player even if the player does not support CD-Text explicitly, enabling it is never a bad idea (just remember to fill in the CD-Text information)."
 msgstr ""
 
@@ -5815 +5438 @@
 #. +> trunk stable
 #: projects/base_k3baudiotrackwidget.ui:176
-msgid ""
-"<p>Preemphasis is mainly used in audio processing. Higher frequencies in "
-"audio signals usually have lower amplitudes. This can lead to bad signal "
-"quality on noisy transmission because the high frequencies might become too "
-"weak. To avoid this effect, high frequencies are amplified before "
-"transmission (preemphasis); the receiver will then weaken them accordingly "
-"for playback."
+msgid "<p>Preemphasis is mainly used in audio processing. Higher frequencies in audio signals usually have lower amplitudes. This can lead to bad signal quality on noisy transmission because the high frequencies might become too weak. To avoid this effect, high frequencies are amplified before transmission (preemphasis); the receiver will then weaken them accordingly for playback."
 msgstr ""
 
@@ -5847 +5464 @@
 msgid ""
 "<p>On an audio CD each track (except for the last) can have a post-gap.\n"
-"This does not mean that K3b adds an additional gap of silence to the track. "
-"This setting simply influences the display on a Hifi audio CD player. The "
-"part of an audio track that is marked as post-gap is counted backwards.\n"
-"<p>This setting is irrelevant for most users as modern CD burners can put "
-"arbitrary audio data in the post-gap when burning in DAO mode.\n"
-"<p><i>In other CD-burning applications the post-gap might be called the "
-"pre-gap. The pre-gap of track 2 is the same as the post-gap of track 1.\n"
+"This does not mean that K3b adds an additional gap of silence to the track. This setting simply influences the display on a Hifi audio CD player. The part of an audio track that is marked as post-gap is counted backwards.\n"
+"<p>This setting is irrelevant for most users as modern CD burners can put arbitrary audio data in the post-gap when burning in DAO mode.\n"
+"<p><i>In other CD-burning applications the post-gap might be called the pre-gap. The pre-gap of track 2 is the same as the post-gap of track 1.\n"
 "<p><b>Changing the post-gap does not change the length of the track.</b>\n"
-"<p><b>When writing in TAO writing mode (not recommended for Audio CDs) the "
-"post-gap will most likely be muted and on some burners forced to 2 seconds.<"
-"/b>"
+"<p><b>When writing in TAO writing mode (not recommended for Audio CDs) the post-gap will most likely be muted and on some burners forced to 2 seconds.</b>"
 msgstr ""
 
@@ -6040 +5651 @@
 #: projects/base_k3bdataimagesettings.ui:105
 msgid ""
-"<p>K3b can create ISO9660 filesystems that contain symlinks if the Rock Ridge "
-"extensions are enabled (they are by default). You can change the way symlinks "
-"are handled in a K3b project.\n"
+"<p>K3b can create ISO9660 filesystems that contain symlinks if the Rock Ridge extensions are enabled (they are by default). You can change the way symlinks are handled in a K3b project.\n"
 "\n"
 "<p><b>No Change</b><br>\n"
@@ -6048 +5657 @@
 "\n"
 "<p><b>Discard broken symlinks</b><br>\n"
-"K3b will discard all symbolic links that do not point to a file inside the "
-"project. That includes all links to absolute paths like "
-"'/home/myhome/testfile'.\n"
+"K3b will discard all symbolic links that do not point to a file inside the project. That includes all links to absolute paths like '/home/myhome/testfile'.\n"
 "\n"
 "<p><b>Discard all symlinks</b><br>\n"
-"K3b will discard all symbolic links that have been added to the project; "
-"meaning that the resulting file system will have no links at all.\n"
+"K3b will discard all symbolic links that have been added to the project; meaning that the resulting file system will have no links at all.\n"
 "\n"
 "<p><b>Follow symlinks</b><br>\n"
-"Each symbolic link in the project will be replaced with the contents of the "
-"file it is pointing to. Thus, the resulting filesystem will not contain any "
-"symbolic links.<br>\n"
-"Be aware that in case Rock Ridge extensions are disabled (which is not "
-"recommended) symbolic links are always followed because ISO9660 does not "
-"support symbolic links.\n"
+"Each symbolic link in the project will be replaced with the contents of the file it is pointing to. Thus, the resulting filesystem will not contain any symbolic links.<br>\n"
+"Be aware that in case Rock Ridge extensions are disabled (which is not recommended) symbolic links are always followed because ISO9660 does not support symbolic links.\n"
 "\n"
 "<p><b>Caution:</b> Symbolic links require Rock Ridge extensions."
@@ -6111 +5713 @@
 msgid ""
 "<p><b>No Change</b><br>\n"
-"If this option is checked, K3b will leave all spaces in filenames as they are."
-"\n"
+"If this option is checked, K3b will leave all spaces in filenames as they are.\n"
 "<p><b>Strip</b><br>\n"
-"If this option is checked, K3b will remove all spaces from all filenames.<br>"
-"\n"
+"If this option is checked, K3b will remove all spaces from all filenames.<br>\n"
 "Example: 'my good file.ext' becomes 'mygoodfile.ext'\n"
 "<p><b>Extended Strip</b><br>\n"
-"If this option is checked K3b will remove all spaces in all filenames and "
-"capitalize all letters following a space.<br>\n"
+"If this option is checked K3b will remove all spaces in all filenames and capitalize all letters following a space.<br>\n"
 "Example: 'my good file.ext' becomes 'myGoodFile.ext'\n"
 "<p><b>Replace</b><br>\n"
-"If this option is checked, K3b will replace all spaces in all filenames with "
-"the specified characters.<br>\n"
+"If this option is checked, K3b will replace all spaces in all filenames with the specified characters.<br>\n"
 "Example: 'my good file.ext' becomes 'my_good_file.ext'"
 msgstr ""
@@ -6291 +5889 @@
 #. +> trunk stable
 #: projects/base_k3bmovixoptionswidget.ui:59
-msgid ""
-"<p>If this option is checked the order in which the files are played is "
-"determined randomly every time it is played."
+msgid "<p>If this option is checked the order in which the files are played is determined randomly every time it is played."
 msgstr ""
 
@@ -6311 +5907 @@
 #. +> trunk stable
 #: projects/base_k3bmovixoptionswidget.ui:72
-msgid ""
-"<p>If this option is checked the resulting eMovix CD/DVD will not use DMA for "
-"accessing the drive. This will slow down reading from the CD/DVD but may be "
-"necessary on some systems that do not support DMA.</p>"
+msgid "<p>If this option is checked the resulting eMovix CD/DVD will not use DMA for accessing the drive. This will slow down reading from the CD/DVD but may be necessary on some systems that do not support DMA.</p>"
 msgstr ""
 
@@ -6402 +5995 @@
 msgid ""
 "<p><b>Audio Player Background</b>\n"
-"<p>During audio playback normally the screen would be black. However, if a "
-"background movie has been selected, eMovix will display it during playback.\n"
-"<p>Additional background movies can be installed. However, this is not as "
-"simple as a few mouse clicks. The background movies are stored in the emovix "
-"shared data folder (mostly <i>/usr/share/emovix</i> or <i>"
-"/usr/local/share/emovix</i>) under <em>backgrounds</em>. So to add a "
-"background one has to copy the file to that folder."
+"<p>During audio playback normally the screen would be black. However, if a background movie has been selected, eMovix will display it during playback.\n"
+"<p>Additional background movies can be installed. However, this is not as simple as a few mouse clicks. The background movies are stored in the emovix shared data folder (mostly <i>/usr/share/emovix</i> or <i>/usr/local/share/emovix</i>) under <em>backgrounds</em>. So to add a background one has to copy the file to that folder."
 msgstr ""
 
@@ -6452 +6040 @@
 msgid ""
 "<p><b>eMovix Boot Labels</b>\n"
-"<p>eMovix provides a variety of different boot configurations which can be "
-"selected at boot time via a boot label (comparable to Lilo or Grub). The many "
-"different boot configurations mainly influence the Video output.\n"
-"<p>The <b>default</b>, <b>movix</b>, or <b>MoviX</b> labels start a general "
-"Vesa video driver.\n"
-"<p>The <b>TV</b> labels can be used to direct video to the TV output of the "
-"graphic board. eMovix provides TVout drivers for different brands of graphic "
-"boards.\n"
-"<p>The <b>FB</b> labels refer to configurations that start a Frame Buffer "
-"driver in different screen resolutions.\n"
-"<p>The <b>AA</b> labels make eMovix output the video through the ASCII-Art "
-"library which displays the picture in text mode through the usage of simple "
-"ASCII characters.\n"
-"<p>The <b>hd</b> label makes eMovix boot from the local harddisk instead of "
-"the medium. This can be used to prevent accidental starting of an eMovix "
-"medium.\n"
-"<p>The <b>floppy</b> label makes eMovix boot from the local floppy drive "
-"instead of the medium."
+"<p>eMovix provides a variety of different boot configurations which can be selected at boot time via a boot label (comparable to Lilo or Grub). The many different boot configurations mainly influence the Video output.\n"
+"<p>The <b>default</b>, <b>movix</b>, or <b>MoviX</b> labels start a general Vesa video driver.\n"
+"<p>The <b>TV</b> labels can be used to direct video to the TV output of the graphic board. eMovix provides TVout drivers for different brands of graphic boards.\n"
+"<p>The <b>FB</b> labels refer to configurations that start a Frame Buffer driver in different screen resolutions.\n"
+"<p>The <b>AA</b> labels make eMovix output the video through the ASCII-Art library which displays the picture in text mode through the usage of simple ASCII characters.\n"
+"<p>The <b>hd</b> label makes eMovix boot from the local harddisk instead of the medium. This can be used to prevent accidental starting of an eMovix medium.\n"
+"<p>The <b>floppy</b> label makes eMovix boot from the local floppy drive instead of the medium."
 msgstr ""
 
@@ -6481 +6058 @@
 #. +> trunk stable
 #: projects/base_k3bmovixoptionswidget.ui:232
-msgid ""
-"<p>The keyboard layout selected here will be used for eMovix commands such as "
-"controlling the media player."
+msgid "<p>The keyboard layout selected here will be used for eMovix commands such as controlling the media player."
 msgstr ""
 
@@ -6501 +6076 @@
 #. +> trunk stable
 #: projects/base_k3bmovixoptionswidget.ui:257
-msgid ""
-"<p>If this option is checked the disk will be ejected after MPlayer has "
-"finished."
+msgid "<p>If this option is checked the disk will be ejected after MPlayer has finished."
 msgstr ""
 
@@ -6521 +6094 @@
 #. +> trunk stable
 #: projects/base_k3bmovixoptionswidget.ui:270
-msgid ""
-"<p>If this option is checked the PC will be shut down after MPlayer has "
-"finished playing."
+msgid "<p>If this option is checked the PC will be shut down after MPlayer has finished playing."
 msgstr ""
 
@@ -6541 +6112 @@
 #. +> trunk stable
 #: projects/base_k3bmovixoptionswidget.ui:283
-msgid ""
-"<p>If this option is checked the PC will be rebooted after MPlayer has "
-"finished playing."
+msgid "<p>If this option is checked the PC will be rebooted after MPlayer has finished playing."
 msgstr ""
 
@@ -6588 +6157 @@
 #. +> trunk stable
 #: projects/k3baudioburndialog.cpp:119
-msgid ""
-"<p>If this option is checked K3b will <em>hide</em> the first track.<p>The "
-"audio CD standard uses pregaps before every track on the CD. By default these "
-"last for 2 seconds and are silent. In DAO mode it is possible to have longer "
-"pregaps that contain some audio. In this case the first pregap will contain "
-"the complete first track.<p>You will need to seek back from the beginning of "
-"the CD to listen to the first track. Try it, it is quite amusing.<p><b>This "
-"feature is only available in DAO mode when writing with cdrdao."
+msgid "<p>If this option is checked K3b will <em>hide</em> the first track.<p>The audio CD standard uses pregaps before every track on the CD. By default these last for 2 seconds and are silent. In DAO mode it is possible to have longer pregaps that contain some audio. In this case the first pregap will contain the complete first track.<p>You will need to seek back from the beginning of the CD to listen to the first track. Try it, it is quite amusing.<p><b>This feature is only available in DAO mode when writing with cdrdao."
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3baudioburndialog.cpp:286 projects/k3bmixedburndialog.cpp:288
-msgid ""
-"<p><b>External program <em>normalize</em> is not installed.</b><p>K3b uses <"
-"em>normalize</em> (http://normalize.nongnu.org/) to normalize audio tracks. "
-"In order to use this functionality, please install it first."
+msgid "<p><b>External program <em>normalize</em> is not installed.</b><p>K3b uses <em>normalize</em> (http://normalize.nongnu.org/) to normalize audio tracks. In order to use this functionality, please install it first."
 msgstr ""
 
@@ -6609 +6168 @@
 #: projects/k3baudioburndialog.cpp:293 projects/k3baudioburndialog.cpp:312
 #: projects/k3bmixedburndialog.cpp:295 projects/k3bmixedburndialog.cpp:314
-msgid ""
-"<p>K3b is not able to normalize audio tracks when burning on-the-fly. The "
-"external program used for this task only supports normalizing a set of audio "
-"files."
+msgid "<p>K3b is not able to normalize audio tracks when burning on-the-fly. The external program used for this task only supports normalizing a set of audio files."
 msgstr ""
 
@@ -6627 +6183 @@
 msgstr ""
 
-#. +> trunk stable
+#. +> trunk
+#: projects/k3baudiodatasourceeditwidget.cpp:38
+#, fuzzy
+#| msgid "Shadow:"
+msgid "Start Offset:"
+msgstr "Rubovi strane"
+
+#. +> stable
 #: projects/k3baudiodatasourceeditwidget.cpp:38
 msgid "Start Offset"
 msgstr ""
 
-#. +> trunk stable
+#. +> trunk
+#: projects/k3baudiodatasourceeditwidget.cpp:39
+#, fuzzy
+msgid "End Offset:"
+msgstr "Pomak:"
+
+#. +> stable
 #: projects/k3baudiodatasourceeditwidget.cpp:39
 msgid "End Offset"
@@ -6639 +6208 @@
 #. +> trunk stable
 #: projects/k3baudiodatasourceeditwidget.cpp:62
-msgid ""
-"Drag the edges of the highlighted area to define the portion of the audio "
-"source you want to include in the Audio CD track. You can also use the input "
-"windows to fine-tune your selection."
+msgid "Drag the edges of the highlighted area to define the portion of the audio source you want to include in the Audio CD track. You can also use the input windows to fine-tune your selection."
 msgstr ""
 
@@ -6721 +6287 @@
 #. +> trunk stable
 #: projects/k3baudiotrackaddingdialog.cpp:93
-msgid ""
-"You may manually convert these audio files to wave using another application "
-"supporting the audio format and then add the wave files to the K3b project."
+msgid "You may manually convert these audio files to wave using another application supporting the audio format and then add the wave files to the K3b project."
 msgstr ""
 
@@ -6956 +6520 @@
 #. +> trunk stable
 #: projects/k3bbootimageview.cpp:108
-msgid ""
-"<p>The file you selected is not a floppy image (floppy images are of size "
-"1200 KB, 1440 KB, or 2880 KB). You may still use boot images of other sizes "
-"by emulating a harddisk or disabling emulation completely. <p>If you are not "
-"familiar with terms like 'harddisk emulation' you most likely want to use a "
-"floppy image here. Floppy images can be created by directly extracting them "
-"from a real floppy disk:<pre>dd if=/dev/floppy of=/tmp/floppy.img</pre>or by "
-"using one of the many boot floppy generators that can be found on <a "
-"href=\"http://www.google.com/search?q=linux+boot+floppy&ie=UTF-8&oe=UTF-8\">"
-"the Internet</a>."
+msgid "<p>The file you selected is not a floppy image (floppy images are of size 1200 KB, 1440 KB, or 2880 KB). You may still use boot images of other sizes by emulating a harddisk or disabling emulation completely. <p>If you are not familiar with terms like 'harddisk emulation' you most likely want to use a floppy image here. Floppy images can be created by directly extracting them from a real floppy disk:<pre>dd if=/dev/floppy of=/tmp/floppy.img</pre>or by using one of the many boot floppy generators that can be found on <a href=\"http://www.google.com/search?q=linux+boot+floppy&ie=UTF-8&oe=UTF-8\">the Internet</a>."
 msgstr ""
 
@@ -7043 +6598 @@
 #. +> trunk stable
 #: projects/k3bdataburndialog.cpp:262
-msgid ""
-"It is not possible to write multisession media in DAO mode. Multisession has "
-"been disabled."
+msgid "It is not possible to write multisession media in DAO mode. Multisession has been disabled."
 msgstr ""
 
@@ -7083 +6636 @@
 #: projects/k3bdataimagesettingswidget.cpp:98
 #, fuzzy
-msgctxt ""
-"This is the default volume identifier of a data project created by K3b. The "
-"string should not be longer than 16 characters to avoid warnings regarding "
-"Joiliet extensions which induce this restriction."
+msgctxt "This is the default volume identifier of a data project created by K3b. The string should not be longer than 16 characters to avoid warnings regarding Joiliet extensions which induce this restriction."
 msgid "K3b data project"
 msgstr "Quanta projekt"
@@ -7092 +6642 @@
 #. +> trunk stable
 #: projects/k3bdataimagesettingswidget.cpp:152
-msgid ""
-"<p><b>File System Presets</b><p>K3b provides the following file system "
-"Presets which allow for a quick selection of the most frequently used "
-"settings."
+msgid "<p><b>File System Presets</b><p>K3b provides the following file system Presets which allow for a quick selection of the most frequently used settings."
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bdataimagesettingswidget.cpp:156
-msgid ""
-"The file system is optimized for usage on Linux/Unix systems. This mainly "
-"means that it uses the Rock Ridge extensions to provide long filenames, "
-"symbolic links, and POSIX compatible file permissions."
+msgid "The file system is optimized for usage on Linux/Unix systems. This mainly means that it uses the Rock Ridge extensions to provide long filenames, symbolic links, and POSIX compatible file permissions."
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bdataimagesettingswidget.cpp:160
-msgid ""
-"In addition to the settings for Linux/Unix the file system contains a Joliet "
-"tree which allows for long file names on Windows which does not support the "
-"Rock Ridge extensions. Be aware that the file name length is restricted to "
-"103 characters."
+msgid "In addition to the settings for Linux/Unix the file system contains a Joliet tree which allows for long file names on Windows which does not support the Rock Ridge extensions. Be aware that the file name length is restricted to 103 characters."
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bdataimagesettingswidget.cpp:164
-msgid ""
-"The file system has additional UDF entries attached to it. This raises the "
-"maximal file size to 4 GB. Be aware that the UDF support in K3b is limited."
+msgid "The file system has additional UDF entries attached to it. This raises the maximal file size to 4 GB. Be aware that the UDF support in K3b is limited."
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bdataimagesettingswidget.cpp:167
-msgid ""
-"The file system is optimized for compatibility with old systems. That means "
-"file names are restricted to 8.3 characters and no symbolic links or file "
-"permissions are supported."
+msgid "The file system is optimized for compatibility with old systems. That means file names are restricted to 8.3 characters and no symbolic links or file permissions are supported."
 msgstr ""
 
@@ -7158 +6693 @@
 #. +> trunk stable
 #: projects/k3bdataimagesettingswidget.cpp:247
-msgid ""
-"<p>Be aware that it is not recommended to disable the Rock Ridge Extensions. "
-"There is no disadvantage in enabling Rock Ridge (except for a very small "
-"space overhead) but a lot of advantages.<p>Without Rock Ridge Extensions "
-"symbolic links are not supported and will always be followed as if the "
-"\"Follow Symbolic Links\" option was enabled."
+msgid "<p>Be aware that it is not recommended to disable the Rock Ridge Extensions. There is no disadvantage in enabling Rock Ridge (except for a very small space overhead) but a lot of advantages.<p>Without Rock Ridge Extensions symbolic links are not supported and will always be followed as if the \"Follow Symbolic Links\" option was enabled."
 msgstr ""
 
@@ -7173 +6703 @@
 #. +> trunk stable
 #: projects/k3bdataimagesettingswidget.cpp:259
-msgid ""
-"<p>Be aware that without the Joliet extensions Windows systems will not be "
-"able to display long filenames. You will only see the ISO9660 filenames.<p>If "
-"you do not intend to use the CD/DVD on a Windows system it is safe to disable "
-"Joliet."
+msgid "<p>Be aware that without the Joliet extensions Windows systems will not be able to display long filenames. You will only see the ISO9660 filenames.<p>If you do not intend to use the CD/DVD on a Windows system it is safe to disable Joliet."
 msgstr ""
 
@@ -7192 +6718 @@
 #. +> trunk stable
 #: projects/k3bdatamultisessioncombobox.cpp:37
-msgid ""
-"<p><b>Multisession Mode</b><p><b>Auto</b><br>Let K3b decide which mode to use."
-" The decision will be based on the size of the project (does it fill the "
-"whole media) and the state of the inserted media (appendable or not).<p><b>No "
-"Multisession</b><br>Create a single-session CD or DVD and close the disk.<p><"
-"b>Start Multisession</b><br>Start a multisession CD or DVD, not closing the "
-"disk to allow further sessions to be appended.<p><b>Continue Multisession</b>"
-"<br>Continue an appendable data CD (as for example created in <em>Start "
-"Multisession</em> mode) and add another session without closing the disk to "
-"allow further sessions to be appended.<p><b>Finish Multisession</b><br>"
-"Continue an appendable data CD (as for example created in <em>Start "
-"Multisession</em> mode), add another session, and close the disk.<p><em>In "
-"the case of DVD+RW and DVD-RW restricted overwrite media K3b will not "
-"actually create multiple sessions but grow the file system to include the new "
-"data.</em>"
+msgid "<p><b>Multisession Mode</b><p><b>Auto</b><br>Let K3b decide which mode to use. The decision will be based on the size of the project (does it fill the whole media) and the state of the inserted media (appendable or not).<p><b>No Multisession</b><br>Create a single-session CD or DVD and close the disk.<p><b>Start Multisession</b><br>Start a multisession CD or DVD, not closing the disk to allow further sessions to be appended.<p><b>Continue Multisession</b><br>Continue an appendable data CD (as for example created in <em>Start Multisession</em> mode) and add another session without closing the disk to allow further sessions to be appended.<p><b>Finish Multisession</b><br>Continue an appendable data CD (as for example created in <em>Start Multisession</em> mode), add another session, and close the disk.<p><em>In the case of DVD+RW and DVD-RW restricted overwrite media K3b will not actually create multiple sessions but grow the file system to include the new data.</em>"
 msgstr ""
 
@@ -7231 +6743 @@
 #. +> trunk stable
 #: projects/k3bdatamultisessionimportdialog.cpp:98
-msgid ""
-"<p>K3b found session containing Joliet information for long filenames but no "
-"Rock Ridge extensions.<p>The filenames in the imported session will be "
-"converted to a restricted character set in the new session. This character "
-"set is based on the ISO9660 settings in the K3b project. K3b is not able to "
-"display these converted filenames yet."
+msgid "<p>K3b found session containing Joliet information for long filenames but no Rock Ridge extensions.<p>The filenames in the imported session will be converted to a restricted character set in the new session. This character set is based on the ISO9660 settings in the K3b project. K3b is not able to display these converted filenames yet."
 msgstr ""
 
@@ -7382 +6889 @@
 #. +> trunk stable
 #: projects/k3bdatapropertiesdialog.cpp:165
-msgid ""
-"<p>If this option is checked, the file or folder (and its entire contents) "
-"will be hidden on the ISO9660 and RockRidge filesystem.</p><p>This is useful, "
-"for example, for having different README files for RockRidge and Joliet, "
-"which can be managed by hiding README.joliet on RockRidge and README.rr on "
-"the Joliet filesystem.</p>"
+msgid "<p>If this option is checked, the file or folder (and its entire contents) will be hidden on the ISO9660 and RockRidge filesystem.</p><p>This is useful, for example, for having different README files for RockRidge and Joliet, which can be managed by hiding README.joliet on RockRidge and README.rr on the Joliet filesystem.</p>"
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bdatapropertiesdialog.cpp:172
-msgid ""
-"<p>If this option is checked, the file or folder (and its entire contents) "
-"will be hidden on the Joliet filesystem.</p><p>This is useful, for example, "
-"for having different README files for RockRidge and Joliet, which can be "
-"managed by hiding README.joliet on RockRidge and README.rr on the Joliet "
-"filesystem.</p>"
+msgid "<p>If this option is checked, the file or folder (and its entire contents) will be hidden on the Joliet filesystem.</p><p>This is useful, for example, for having different README files for RockRidge and Joliet, which can be managed by hiding README.joliet on RockRidge and README.rr on the Joliet filesystem.</p>"
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bdatapropertiesdialog.cpp:179
-msgid ""
-"<p>This value modifies the physical sort order of the files in the ISO9660 "
-"filesystem. A higher weighting means that the file will be located closer to "
-"the beginning of the image (and the disk).<p>This option is useful in order "
-"to optimize the data layout on a medium.<p><b>Caution:</b> This does not sort "
-"the order of the file names that appear in the ISO9660 folder. It sorts the "
-"order in which the file data is written to the image."
+msgid "<p>This value modifies the physical sort order of the files in the ISO9660 filesystem. A higher weighting means that the file will be located closer to the beginning of the image (and the disk).<p>This option is useful in order to optimize the data layout on a medium.<p><b>Caution:</b> This does not sort the order of the file names that appear in the ISO9660 folder. It sorts the order in which the file data is written to the image."
 msgstr ""
 
@@ -7501 +6992 @@
 msgstr[2] "Otvori datoteku"
 
+#. +> trunk
+#: projects/k3bdatapropertiesdialog.cpp:305
+#, fuzzy
+msgid "No Files"
+msgstr "INI datoteke"
+
 #. +> stable
 #: projects/k3bdatapropertiesdialog.cpp:293
@@ -7519 +7016 @@
 msgstr[2] "%1 mapa"
 
+#. +> trunk
+#: projects/k3bdatapropertiesdialog.cpp:310
+#, fuzzy
+#| msgid "Folders"
+msgid "No Folders"
+msgstr "Mape"
+
 #. +> trunk stable
 #: projects/k3bdataurladdingdialog.cpp:95
@@ -7527 +7031 @@
 #. +> trunk stable
 #: projects/k3bdataurladdingdialog.cpp:117
+#, kde-format
+msgid "Adding files to project '%1'"
+msgstr ""
+
+#. +> trunk
 #: projects/k3bdataurladdingdialog.cpp:123
-#, kde-format
-msgid "Adding files to project '%1'"
-msgstr ""
+#, fuzzy, kde-format
+msgid "Adding files to project '%1'..."
+msgstr "Dodavanje datoteka u SVN repozitorij
"
 
 #. +> trunk stable
 #: projects/k3bdataurladdingdialog.cpp:197
-msgid ""
-"<p>The file you are about to add to the project is an ISO9660 image. As such "
-"it can be burned to a medium directly since it already contains a file system."
-"<br>Are you sure you want to add this file to the project?"
+msgid "<p>The file you are about to add to the project is an ISO9660 image. As such it can be burned to a medium directly since it already contains a file system.<br>Are you sure you want to add this file to the project?"
 msgstr ""
 
@@ -7627 +7133 @@
 #: projects/k3bdataurladdingdialog.cpp:462
 #, kde-format
-msgid ""
-"<p>'%1' is a symbolic link to folder '%2'.<p>If you intend to make K3b follow "
-"symbolic links you should consider letting K3b do this now since K3b will not "
-"be able to do so afterwards because symbolic links to folders inside a K3b "
-"project cannot be resolved.<p><b>If you do not intend to enable the option <"
-"em>follow symbolic links</em> you may safely ignore this warning and choose "
-"to add the link to the project.</b>"
+msgid "<p>'%1' is a symbolic link to folder '%2'.<p>If you intend to make K3b follow symbolic links you should consider letting K3b do this now since K3b will not be able to do so afterwards because symbolic links to folders inside a K3b project cannot be resolved.<p><b>If you do not intend to enable the option <em>follow symbolic links</em> you may safely ignore this warning and choose to add the link to the project.</b>"
 msgstr ""
 
@@ -7692 +7192 @@
 #. +> trunk stable
 #: projects/k3bdataurladdingdialog.cpp:786
-msgid ""
-"Do you also want to add system files (FIFOs, sockets, device files, and "
-"broken symlinks)?"
+msgid "Do you also want to add system files (FIFOs, sockets, device files, and broken symlinks)?"
 msgstr ""
 
@@ -7715 +7213 @@
 #. +> trunk stable
 #: projects/k3bdataurladdingdialog.cpp:824
-msgid ""
-"The following filenames have an invalid encoding. You may fix this with the "
-"convmv tool"
+msgid "The following filenames have an invalid encoding. You may fix this with the convmv tool"
 msgstr ""
 
@@ -7788 +7284 @@
 #. +> trunk stable
 #: projects/k3bdataviewimpl.cpp:221
-msgid ""
-"A file with that name already exists. Please insert the name for the new "
-"folder:"
+msgid "A file with that name already exists. Please insert the name for the new folder:"
 msgstr ""
 
@@ -7797 +7291 @@
 msgid "Edit Boot Images"
 msgstr ""
-
-#. +> trunk stable
-#: projects/k3bfillstatusdisplay.cpp:180 projects/k3bfillstatusdisplay.cpp:586
-#: projects/k3bfillstatusdisplay.cpp:849
-#, fuzzy
-msgid "min"
-msgstr " min"
 
 #. +> trunk stable
@@ -7906 +7393 @@
 #. +> trunk stable
 #: projects/k3bfillstatusdisplay.cpp:571
-msgid ""
-"<p><b>Why does K3b offer 4.4 GB and 8.0 GB instead of 4.7 and 8.5 like it "
-"says on the media?</b><p>A single layer DVD media has a capacity of "
-"approximately 4.4 GB which equals 4.4*1024<sup>3</sup> bytes. Media producers "
-"just calculate with 1000 instead of 1024 for advertising reasons.<br>This "
-"results in 4.4*1024<sup>3</sup>/1000<sup>3</sup> = 4.7 GB."
+msgid "<p><b>Why does K3b offer 4.4 GB and 8.0 GB instead of 4.7 and 8.5 like it says on the media?</b><p>A single layer DVD media has a capacity of approximately 4.4 GB which equals 4.4*1024<sup>3</sup> bytes. Media producers just calculate with 1000 instead of 1024 for advertising reasons.<br>This results in 4.4*1024<sup>3</sup>/1000<sup>3</sup> = 4.7 GB."
 msgstr ""
 
@@ -7921 +7403 @@
 
 #. +> trunk stable
+#: projects/k3bfillstatusdisplay.cpp:586
+#, fuzzy
+msgid "min"
+msgstr " min"
+
+#. +> trunk stable
 #: projects/k3bfillstatusdisplay.cpp:599
 msgid "Custom Size"
@@ -7927 +7415 @@
 #. +> trunk stable
 #: projects/k3bfillstatusdisplay.cpp:600
-msgid ""
-"<p>Please specify the size of the medium. Use suffixes <b>GB</b>,<b>MB</b>, "
-"and <b>min</b> for <em>gigabytes</em>, <em>megabytes</em>, and <em>minutes<"
-"/em> respectively."
+msgid "<p>Please specify the size of the medium. Use suffixes <b>GB</b>,<b>MB</b>, and <b>min</b> for <em>gigabytes</em>, <em>megabytes</em>, and <em>minutes</em> respectively."
 msgstr ""
 
@@ -7965 +7450 @@
 #. +> trunk stable
 #: projects/k3bmixedburndialog.cpp:104
-msgid ""
-"<em>Blue book CD</em><br>K3b will create a multisession CD with 2 sessions. "
-"The first session will contain all audio tracks and the second session will "
-"contain a mode 2 form 1 data track.<br>This mode is based on the <em>Blue "
-"book</em> standard (also known as <em>Extended Audio CD</em>, <em>CD-Extra<"
-"/em>, or <em>CD Plus</em>) and has the advantage that a hifi audio CD player "
-"will only recognize the first session and ignore the second session with the "
-"data track.<br>If the CD is intended to be used in a hifi audio CD player "
-"this is the recommended mode.<br>Some older CD-ROMs may have problems reading "
-"a blue book CD since it is a multisession CD."
+msgid "<em>Blue book CD</em><br>K3b will create a multisession CD with 2 sessions. The first session will contain all audio tracks and the second session will contain a mode 2 form 1 data track.<br>This mode is based on the <em>Blue book</em> standard (also known as <em>Extended Audio CD</em>, <em>CD-Extra</em>, or <em>CD Plus</em>) and has the advantage that a hifi audio CD player will only recognize the first session and ignore the second session with the data track.<br>If the CD is intended to be used in a hifi audio CD player this is the recommended mode.<br>Some older CD-ROMs may have problems reading a blue book CD since it is a multisession CD."
 msgstr ""
 
@@ -7999 +7475 @@
 #. +> trunk stable
 #: projects/k3bmixedburndialog.cpp:128
-msgid ""
-"<b>Caution:</b> The last two modes should only be used for CDs that are "
-"unlikely to be played on a hifi audio CD player.<br>It could lead to problems "
-"with some older hifi audio CD players that try to play the data track."
+msgid "<b>Caution:</b> The last two modes should only be used for CDs that are unlikely to be played on a hifi audio CD player.<br>It could lead to problems with some older hifi audio CD players that try to play the data track."
 msgstr ""
 
@@ -8064 +7537 @@
 msgstr "zadano"
 
-#. +> trunk stable
+#. +> trunk
+#: projects/k3bmovixprojectmodel.cpp:296
+#, fuzzy, kde-format
+msgid "%1 (broken)"
+msgstr "%1 (trenutno)"
+
+#. +> stable
 #: projects/k3bmovixprojectmodel.cpp:296
 msgid " (broken)"
@@ -8327 +7806 @@
 #. +> trunk stable
 #: projects/k3bvcdburndialog.cpp:117 projects/k3bvcdtrackdialog.cpp:258
-msgid ""
-"Playback control, PBC, is available for Video CD 2.0 and Super Video CD 1.0 "
-"disc formats."
+msgid "Playback control, PBC, is available for Video CD 2.0 and Super Video CD 1.0 disc formats."
 msgstr ""
 
@@ -8344 +7821 @@
 #. +> trunk stable
 #: projects/k3bvcdburndialog.cpp:120
-msgid ""
-"This controls whether to update the scan data information contained in the "
-"MPEG-2 video streams."
+msgid "This controls whether to update the scan data information contained in the MPEG-2 video streams."
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bvcdburndialog.cpp:121
-msgid ""
-"This element allows to set viewing restrictions which may be interpreted by "
-"the playing device."
+msgid "This element allows to set viewing restrictions which may be interpreted by the playing device."
 msgstr ""
 
@@ -8363 +7836 @@
 #. +> trunk stable
 #: projects/k3bvcdburndialog.cpp:124
-msgid ""
-"Used to set the number of empty sectors added before the lead-out area begins."
+msgid "Used to set the number of empty sectors added before the lead-out area begins."
 msgstr ""
 
@@ -8384 +7856 @@
 #. +> trunk stable
 #: projects/k3bvcdburndialog.cpp:131
-msgid ""
-"<p>This is the most basic <b>Video CD</b> specification dating back to 1993, "
-"which has the following characteristics:<ul><li>One mode2 mixed form ISO-9660 "
-"track containing file pointers to the information areas.</li><li>Up to 98 "
-"multiplex-ed MPEG-1 audio/video streams or CD-DA audio tracks.</li><li>Up to "
-"500 MPEG sequence entry points used as chapter divisions.</li></ul><p>The "
-"Video CD specification requires the multiplex-ed MPEG-1 stream to have a CBR "
-"of less than 174300 bytes (1394400 bits) per second in order to accommodate "
-"single speed CD-ROM drives.<br>The specification allows for the following two "
-"resolutions:<ul><li>352 x 240 @ 29.97 Hz (NTSC SIF).</li><li>352 x 240 @ 23."
-"976 Hz (FILM SIF).</li></ul><p>The CBR MPEG-1, layer II audio stream is fixed "
-"at 224 kbps with 1 stereo or 2 mono channels.<p><b>It is recommended to keep "
-"the video bit-rate under 1151929.1 bps.</b>"
+msgid "<p>This is the most basic <b>Video CD</b> specification dating back to 1993, which has the following characteristics:<ul><li>One mode2 mixed form ISO-9660 track containing file pointers to the information areas.</li><li>Up to 98 multiplex-ed MPEG-1 audio/video streams or CD-DA audio tracks.</li><li>Up to 500 MPEG sequence entry points used as chapter divisions.</li></ul><p>The Video CD specification requires the multiplex-ed MPEG-1 stream to have a CBR of less than 174300 bytes (1394400 bits) per second in order to accommodate single speed CD-ROM drives.<br>The specification allows for the following two resolutions:<ul><li>352 x 240 @ 29.97 Hz (NTSC SIF).</li><li>352 x 240 @ 23.976 Hz (FILM SIF).</li></ul><p>The CBR MPEG-1, layer II audio stream is fixed at 224 kbps with 1 stereo or 2 mono channels.<p><b>It is recommended to keep the video bit-rate under 1151929.1 bps.</b>"
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bvcdburndialog.cpp:142
-msgid ""
-"<p>About two years after the Video CD 1.1 specification came out, an improved "
-"<b>Video CD 2.0</b> standard was published in 1995.<p>This one added the "
-"following items to the features already available in the Video CD 1.1 "
-"specification:<ul><li>Support for MPEG segment play items (<b>\"SPI\"</b>), "
-"consisting of still pictures, motion pictures and/or audio (only) streams was "
-"added.</li><li>Note Segment Items::.</li><li>Support for interactive playback "
-"control (<b>\"PBC\"</b>) was added.</li><li>Support for playing related "
-"access by providing a scan point index file was added. (<b>\"/EXT/SCANDATA."
-"DAT\"</b>)</li><li>Support for closed captions.</li><li>Support for mixing "
-"NTSC and PAL content.</li></ul><p>By adding PAL support to the Video CD 1.1 "
-"specification, the following resolutions became available:<ul><li>352 x 240 @ "
-"29.97 Hz (NTSC SIF).</li><li>352 x 240 @ 23.976 Hz (FILM SIF).</li><li>352 x "
-"288 @ 25 Hz (PAL SIF).</li></ul><p>For segment play items the following audio "
-"encodings became available:<ul><li>Joint stereo, stereo or dual channel audio "
-"streams at 128, 192, 224 or 384 kbit/sec bit-rate.</li><li>Mono audio streams "
-"at 64, 96 or 192 kbit/sec bit-rate.</li></ul><p>Also the possibility to have "
-"audio only streams and still pictures was provided.<p><b>The bit-rate of "
-"multiplex-ed streams should be kept under 174300 bytes/sec (except for single "
-"still picture items) in order to accommodate single speed drives.</b>"
+msgid "<p>About two years after the Video CD 1.1 specification came out, an improved <b>Video CD 2.0</b> standard was published in 1995.<p>This one added the following items to the features already available in the Video CD 1.1 specification:<ul><li>Support for MPEG segment play items (<b>\"SPI\"</b>), consisting of still pictures, motion pictures and/or audio (only) streams was added.</li><li>Note Segment Items::.</li><li>Support for interactive playback control (<b>\"PBC\"</b>) was added.</li><li>Support for playing related access by providing a scan point index file was added. (<b>\"/EXT/SCANDATA.DAT\"</b>)</li><li>Support for closed captions.</li><li>Support for mixing NTSC and PAL content.</li></ul><p>By adding PAL support to the Video CD 1.1 specification, the following resolutions became available:<ul><li>352 x 240 @ 29.97 Hz (NTSC SIF).</li><li>352 x 240 @ 23.976 Hz (FILM SIF).</li><li>352 x 288 @ 25 Hz (PAL SIF).</li></ul><p>For segment play items the following audio encodings became available:<ul><li>Joint stereo, stereo or dual channel audio streams at 128, 192, 224 or 384 kbit/sec bit-rate.</li><li>Mono audio streams at 64, 96 or 192 kbit/sec bit-rate.</li></ul><p>Also the possibility to have audio only streams and still pictures was provided.<p><b>The bit-rate of multiplex-ed streams should be kept under 174300 bytes/sec (except for single still picture items) in order to accommodate single speed drives.</b>"
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bvcdburndialog.cpp:160
-msgid ""
-"<p>With the upcoming of the DVD-V media, a new VCD standard had to be "
-"published in order to be able to keep up with technology, so the Super Video "
-"CD specification was called into life 1999.<p>In the midst of 2000 a full "
-"subset of this <b>Super Video CD</b> specification was published as <b>"
-"IEC-62107</b>.<p>As the most notable change over Video CD 2.0 is a switch "
-"from MPEG-1 CBR to MPEG-2 VBR encoding for the video stream was performed.<p>"
-"The following new features--building upon the Video CD 2.0 "
-"specification--are:<ul><li>Use of MPEG-2 encoding instead of MPEG-1 for the "
-"video stream.</li><li>Allowed VBR encoding of MPEG-1 audio stream.</li><li>"
-"Higher resolutions (see below) for video stream resolution.</li><li>Up to 4 "
-"overlay graphics and text (<b>\"OGT\"</b>) sub-channels for user switchable "
-"subtitle displaying in addition to the already existing closed caption "
-"facility.</li><li>Command lists for controlling the SVCD virtual machine.</li>"
-"</ul><p>For the <b>Super Video CD</b>, only the following two resolutions are "
-"supported for motion video and (low resolution) still pictures:<ul><li>480 x "
-"480 @ 29.97 Hz (NTSC 2/3 D-2).</li><li>480 x 576 @ 25 Hz (PAL 2/3 D-2).</li><"
-"/ul>"
+msgid "<p>With the upcoming of the DVD-V media, a new VCD standard had to be published in order to be able to keep up with technology, so the Super Video CD specification was called into life 1999.<p>In the midst of 2000 a full subset of this <b>Super Video CD</b> specification was published as <b>IEC-62107</b>.<p>As the most notable change over Video CD 2.0 is a switch from MPEG-1 CBR to MPEG-2 VBR encoding for the video stream was performed.<p>The following new features--building upon the Video CD 2.0 specification--are:<ul><li>Use of MPEG-2 encoding instead of MPEG-1 for the video stream.</li><li>Allowed VBR encoding of MPEG-1 audio stream.</li><li>Higher resolutions (see below) for video stream resolution.</li><li>Up to 4 overlay graphics and text (<b>\"OGT\"</b>) sub-channels for user switchable subtitle displaying in addition to the already existing closed caption facility.</li><li>Command lists for controlling the SVCD virtual machine.</li></ul><p>For the <b>Super Video CD</b>, only the following two resolutions are supported for motion video and (low resolution) still pictures:<ul><li>480 x 480 @ 29.97 Hz (NTSC 2/3 D-2).</li><li>480 x 576 @ 25 Hz (PAL 2/3 D-2).</li></ul>"
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bvcdburndialog.cpp:173
-msgid ""
-"<p>This is actually just a minor variation defined in IEC-62107 on the Super "
-"Video CD 1.0 format for compatibility with current products in the market.<p>"
-"It differs from the Super Video CD 1.0 format in the following items:<ul><li>"
-"The system profile tag field in <b>/SVCD/INFO.SVD</b> is set to <b>1</b> "
-"instead of <b>0</b>.</li><li>The system identification field value in <b>"
-"/SVCD/INFO.SVD</b> is set to <b>HQ-VCD</b> instead of <b>SUPERVCD</b>.</li><"
-"li><b>/EXT/SCANDATA.DAT</b> is mandatory instead of being optional.</li><li><"
-"b>/SVCD/SEARCH.DAT</b> is optional instead of being mandatory.</li></ul>"
+msgid "<p>This is actually just a minor variation defined in IEC-62107 on the Super Video CD 1.0 format for compatibility with current products in the market.<p>It differs from the Super Video CD 1.0 format in the following items:<ul><li>The system profile tag field in <b>/SVCD/INFO.SVD</b> is set to <b>1</b> instead of <b>0</b>.</li><li>The system identification field value in <b>/SVCD/INFO.SVD</b> is set to <b>HQ-VCD</b> instead of <b>SUPERVCD</b>.</li><li><b>/EXT/SCANDATA.DAT</b> is mandatory instead of being optional.</li><li><b>/SVCD/SEARCH.DAT</b> is optional instead of being mandatory.</li></ul>"
 msgstr ""
 
 #. +> trunk
 #: projects/k3bvcdburndialog.cpp:180
-msgid ""
-"<p>If Autodetect is:</p><ul><li>ON then K3b will set the correct Video CD "
-"type.</li><li>OFF then the correct Video CD type needs to be set by the user."
-"</li></ul><p>If you are not sure about the correct Video CD type, it is best "
-"to turn Autodetect ON.</p><p>If you want to force the Video CD type, you must "
-"turn Autodetect OFF. This is useful for some standalone DVD players without "
-"SVCD support.</p>"
+msgid "<p>If Autodetect is:</p><ul><li>ON then K3b will set the correct Video CD type.</li><li>OFF then the correct Video CD type needs to be set by the user.</li></ul><p>If you are not sure about the correct Video CD type, it is best to turn Autodetect ON.</p><p>If you want to force the Video CD type, you must turn Autodetect OFF. This is useful for some standalone DVD players without SVCD support.</p>"
 msgstr ""
 
 #. +> stable
 #: projects/k3bvcdburndialog.cpp:180
-msgid ""
-"<p>If Autodetect is:</p><ul><li>ON then K3b will set the correct VideoCD type."
-"</li><li>OFF then the correct VideoCD type needs to be set by the user.</li><"
-"/ul><p>If you are not sure about the correct VideoCD type, it is best to turn "
-"Autodetect ON.</p><p>If you want to force the VideoCD type, you must turn "
-"Autodetect OFF. This is useful for some standalone DVD players without SVCD "
-"support.</p>"
+msgid "<p>If Autodetect is:</p><ul><li>ON then K3b will set the correct VideoCD type.</li><li>OFF then the correct VideoCD type needs to be set by the user.</li></ul><p>If you are not sure about the correct VideoCD type, it is best to turn Autodetect ON.</p><p>If you want to force the VideoCD type, you must turn Autodetect OFF. This is useful for some standalone DVD players without SVCD support.</p>"
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bvcdburndialog.cpp:186
-msgid ""
-"<ul><li>Rename <b>\"/MPEG2\"</b> folder on SVCDs to (non-compliant) "
-"\"/MPEGAV\".</li><li>Enables the use of the (deprecated) signature <b>"
-"\"ENTRYSVD\"</b> instead of <b>\"ENTRYVCD\"</b> for the file <b>\"/SVCD/ENTRY."
-"SVD\"</b>.</li></ul>"
+msgid "<ul><li>Rename <b>\"/MPEG2\"</b> folder on SVCDs to (non-compliant) \"/MPEGAV\".</li><li>Enables the use of the (deprecated) signature <b>\"ENTRYSVD\"</b> instead of <b>\"ENTRYVCD\"</b> for the file <b>\"/SVCD/ENTRY.SVD\"</b>.</li></ul>"
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bvcdburndialog.cpp:188
-msgid ""
-"<ul><li>Enables the use of the (deprecated) Chinese <b>\"/SVCD/TRACKS.SVD\"<"
-"/b> format which differs from the format defined in the <b>IEC-62107</b> "
-"specification.</li></ul><p><b>The differences are most exposed on SVCDs "
-"containing more than one video track.</b>"
+msgid "<ul><li>Enables the use of the (deprecated) Chinese <b>\"/SVCD/TRACKS.SVD\"</b> format which differs from the format defined in the <b>IEC-62107</b> specification.</li></ul><p><b>The differences are most exposed on SVCDs containing more than one video track.</b>"
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bvcdburndialog.cpp:191
-msgid ""
-"<p>though most devices will have problems with such an out-of-specification "
-"media.<p><b>You may want use this option for images longer than 80 minutes</b>"
+msgid "<p>though most devices will have problems with such an out-of-specification media.<p><b>You may want use this option for images longer than 80 minutes</b>"
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bvcdburndialog.cpp:194
-msgid ""
-"<p>To allow the play of Video-CDs on a CD-i player, the Video-CD standard "
-"requires that a CD-i application program must be present.<p>This program is "
-"designed to:<ul><li>provide full play back control as defined in the PSD of "
-"the standard</li><li>be extremely simple to use and easy-to-learn for the "
-"end-user</li></ul><p>The program runs on CD-i players equipped with the "
-"CDRTOS 1.1(.1) operating system and a Digital Video extension cartridge."
+msgid "<p>To allow the play of Video-CDs on a CD-i player, the Video-CD standard requires that a CD-i application program must be present.<p>This program is designed to:<ul><li>provide full play back control as defined in the PSD of the standard</li><li>be extremely simple to use and easy-to-learn for the end-user</li></ul><p>The program runs on CD-i players equipped with the CDRTOS 1.1(.1) operating system and a Digital Video extension cartridge."
 msgstr ""
 
 #. +> trunk
 #: projects/k3bvcdburndialog.cpp:200
-msgid ""
-"<p>Configuration parameters only available for Video CD 2.0<p>The engine "
-"works perfectly well when used as-is.<p>You have the option to configure the "
-"VCD application.<p>You can adapt the color and/or the shape of the cursor and "
-"lots more."
+msgid "<p>Configuration parameters only available for Video CD 2.0<p>The engine works perfectly well when used as-is.<p>You have the option to configure the VCD application.<p>You can adapt the color and/or the shape of the cursor and lots more."
 msgstr ""
 
 #. +> stable
 #: projects/k3bvcdburndialog.cpp:200
-msgid ""
-"<p>Configuration parameters only available for VideoCD 2.0<p>The engine works "
-"perfectly well when used as-is.<p>You have the option to configure the VCD "
-"application.<p>You can adapt the color and/or the shape of the cursor and "
-"lots more."
+msgid "<p>Configuration parameters only available for VideoCD 2.0<p>The engine works perfectly well when used as-is.<p>You have the option to configure the VCD application.<p>You can adapt the color and/or the shape of the cursor and lots more."
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bvcdburndialog.cpp:206 projects/k3bvcdtrackdialog.cpp:269
-msgid ""
-"<p>Playback control, PBC, is available for Video CD 2.0 and Super Video CD 1."
-"0 disc formats.<p>PBC allows control of the playback of play items and the "
-"possibility of interaction with the user through the remote control or some "
-"other input device available."
+msgid "<p>Playback control, PBC, is available for Video CD 2.0 and Super Video CD 1.0 disc formats.<p>PBC allows control of the playback of play items and the possibility of interaction with the user through the remote control or some other input device available."
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bvcdburndialog.cpp:209
-msgid ""
-"<p>Here you can specify that the folder <b>SEGMENT</b> should always be "
-"present.<p>Some DVD players need the folder to give a faultless rendition."
+msgid "<p>Here you can specify that the folder <b>SEGMENT</b> should always be present.<p>Some DVD players need the folder to give a faultless rendition."
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bvcdburndialog.cpp:212
-msgid ""
-"<p>An Access Point Sector, APS, is an MPEG video sector on the VCD/SVCD which "
-"is suitable to be jumped to directly.<p>APS are required for entry points and "
-"scantables. APS have to fulfil the requirement to precede every I-frame by a "
-"GOP header which shall be preceded by a sequence header in its turn.<p>The "
-"start codes of these 3 items are required to be contained all in the same "
-"MPEG pack/sector, thus forming a so-called access point sector.<p>This "
-"requirement can be relaxed by enabling the relaxed aps option, i.e. every "
-"sector containing an I-frame will be regarded as an APS.<p><b>Warning:</b> "
-"The sequence header is needed for a playing device to figure out display "
-"parameters, such as display resolution and frame rate, relaxing the aps "
-"requirement may lead to non-working entry points."
+msgid "<p>An Access Point Sector, APS, is an MPEG video sector on the VCD/SVCD which is suitable to be jumped to directly.<p>APS are required for entry points and scantables. APS have to fulfil the requirement to precede every I-frame by a GOP header which shall be preceded by a sequence header in its turn.<p>The start codes of these 3 items are required to be contained all in the same MPEG pack/sector, thus forming a so-called access point sector.<p>This requirement can be relaxed by enabling the relaxed aps option, i.e. every sector containing an I-frame will be regarded as an APS.<p><b>Warning:</b> The sequence header is needed for a playing device to figure out display parameters, such as display resolution and frame rate, relaxing the aps requirement may lead to non-working entry points."
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bvcdburndialog.cpp:218
-msgid ""
-"<p>According to the specification, it is mandatory for Super Video CDs to "
-"encode scan information data into user data blocks in the picture layer of "
-"all intra coded picture.<p>It can be used by playing devices for implementing "
-"fast forward & fast reverse scanning.<p>The already existing scan information "
-"data can be updated by enabling the update scan offsets option."
+msgid "<p>According to the specification, it is mandatory for Super Video CDs to encode scan information data into user data blocks in the picture layer of all intra coded picture.<p>It can be used by playing devices for implementing fast forward & fast reverse scanning.<p>The already existing scan information data can be updated by enabling the update scan offsets option."
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bvcdburndialog.cpp:222
-msgid ""
-"<p>Viewing Restriction may be interpreted by the playing device.<p>The "
-"allowed range goes from 0 to 3.<ul><li>0 = unrestricted, free to view for "
-"all</li><li>3 = restricted, content not suitable for ages under 18</li></ul><"
-"p>Actually, the exact meaning is not defined and is player dependant.<p><b>"
-"Most players ignore that value.<b>"
+msgid "<p>Viewing Restriction may be interpreted by the playing device.<p>The allowed range goes from 0 to 3.<ul><li>0 = unrestricted, free to view for all</li><li>3 = restricted, content not suitable for ages under 18</li></ul><p>Actually, the exact meaning is not defined and is player dependant.<p><b>Most players ignore that value.<b>"
 msgstr ""
 
@@ -8593 +7946 @@
 #. +> trunk stable
 #: projects/k3bvcdburndialog.cpp:230
-msgid ""
-"<p>This option allows to set the number of empty sectors added before the "
-"lead-out area begins, i.e. the number of post-gap sectors.<p>The ECMA-130 "
-"specification requires the last data track before the lead-out to carry a "
-"post-gap of at least 150 sectors, which is used as default for this parameter."
-"<p>Some operating systems may encounter I/O errors due to read-ahead issues "
-"when reading the last MPEG track if this parameter is set too low.<p>Allowed "
-"value content: [0..300]. Default: 150."
+msgid "<p>This option allows to set the number of empty sectors added before the lead-out area begins, i.e. the number of post-gap sectors.<p>The ECMA-130 specification requires the last data track before the lead-out to carry a post-gap of at least 150 sectors, which is used as default for this parameter.<p>Some operating systems may encounter I/O errors due to read-ahead issues when reading the last MPEG track if this parameter is set too low.<p>Allowed value content: [0..300]. Default: 150."
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bvcdburndialog.cpp:235
-msgid ""
-"<p>Used to set the track pre-gap for all tracks in sectors globally.<p>The "
-"specification requires the pre-gaps to be at least 150 sectors long.<p>"
-"Allowed value content: [0..300]. Default: 150."
+msgid "<p>Used to set the track pre-gap for all tracks in sectors globally.<p>The specification requires the pre-gaps to be at least 150 sectors long.<p>Allowed value content: [0..300]. Default: 150."
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bvcdburndialog.cpp:239
-msgid ""
-"Margins are used to compensate for inaccurate sector-addressing issues on "
-"CD-ROM media. Interestingly, they have been abandoned for Super Video CDs.<p>"
-"For Video CD 1.0/1.1/2.0 this margin should be at least 15 sectors long.<p>"
-"Allowed value content: [0..150]. Default: 30 for Video CD 1.0/1.1/2.0, "
-"otherwise (i.e. Super Video CD 1.0 and HQ-VCD 1.0) 0."
+msgid "Margins are used to compensate for inaccurate sector-addressing issues on CD-ROM media. Interestingly, they have been abandoned for Super Video CDs.<p>For Video CD 1.0/1.1/2.0 this margin should be at least 15 sectors long.<p>Allowed value content: [0..150]. Default: 30 for Video CD 1.0/1.1/2.0, otherwise (i.e. Super Video CD 1.0 and HQ-VCD 1.0) 0."
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bvcdburndialog.cpp:243
-msgid ""
-"<p>Margins are used to compensate for inaccurate sector-addressing issues on "
-"CD-ROM media. Interestingly, they have been abandoned for Super Video CDs.<p>"
-"For Video CD 1.0/1.1/2.0 this margin should be at least 15 sectors long.<p>"
-"Allowed value content: [0..150]. Default: 45 for Video CD 1.0/1.1/2.0, "
-"otherwise 0."
+msgid "<p>Margins are used to compensate for inaccurate sector-addressing issues on CD-ROM media. Interestingly, they have been abandoned for Super Video CDs.<p>For Video CD 1.0/1.1/2.0 this margin should be at least 15 sectors long.<p>Allowed value content: [0..150]. Default: 45 for Video CD 1.0/1.1/2.0, otherwise 0."
 msgstr ""
 
@@ -9020 +8353 @@
 #. +> trunk stable
 #: projects/k3bvcdtrackdialog.cpp:265
-msgid ""
-"<p>Target to be jumped to on time-out of <wait>.<p>If omitted (and <wait> is "
-"not set to an infinite time) one of the targets is selected at random."
+msgid "<p>Target to be jumped to on time-out of <wait>.<p>If omitted (and <wait> is not set to an infinite time) one of the targets is selected at random."
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bvcdtrackdialog.cpp:267
-msgid ""
-"<p>When reactivity is set to delayed, it is recommended that the length of "
-"the referenced 'play track' is not more than 5 seconds.<p>The recommended "
-"setting for a play item consisting of one still picture and no audio is to "
-"loop once and have a delayed reactivity."
+msgid "<p>When reactivity is set to delayed, it is recommended that the length of the referenced 'play track' is not more than 5 seconds.<p>The recommended setting for a play item consisting of one still picture and no audio is to loop once and have a delayed reactivity."
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bvcdtrackdialog.cpp:271
-msgid ""
-"These are actually pseudo keys, representing the numeric keys 0, 1, ..., 9."
+msgid "These are actually pseudo keys, representing the numeric keys 0, 1, ..., 9."
 msgstr ""
 
@@ -9047 +8373 @@
 #. +> trunk stable
 #: projects/k3bvcdtrackdialog.cpp:273
-msgid ""
-"<p>Times to repeat the playback of 'play track'.<p>The reactivity attribute "
-"controls whether the playback of 'play track' is finished, thus delayed, "
-"before executing user triggered action or an immediate jump is performed.<p>"
-"After the specified number of repetitions have completed, the <wait> time "
-"begins to count down, unless set to an infinite wait time.<p>If this element "
-"is omitted, a default of `1' is used, i.e. the 'play track' will be displayed "
-"once."
+msgid "<p>Times to repeat the playback of 'play track'.<p>The reactivity attribute controls whether the playback of 'play track' is finished, thus delayed, before executing user triggered action or an immediate jump is performed.<p>After the specified number of repetitions have completed, the <wait> time begins to count down, unless set to an infinite wait time.<p>If this element is omitted, a default of `1' is used, i.e. the 'play track' will be displayed once."
 msgstr ""
 
 #. +> trunk stable
 #: projects/k3bvcdtrackdialog.cpp:277
-msgid ""
-"Time in seconds to wait after playback of 'play track' before triggering the "
-"<timeout> action (unless the user triggers some action before time ran up)."
+msgid "Time in seconds to wait after playback of 'play track' before triggering the <timeout> action (unless the user triggers some action before time ran up)."
 msgstr ""
 
@@ -9267 +8584 @@
 #. +> trunk
 #: projects/k3bvcdview.cpp:101
-msgid ""
-"Could not find VcdImager executable. To create Video CDs you have to install "
-"VcdImager >= 0.7.12. You can find this on your distribution’s software "
-"repository or download it from http://www.vcdimager.org"
+msgid "Could not find VcdImager executable. To create Video CDs you have to install VcdImager >= 0.7.12. You can find this on your distribution’s software repository or download it from http://www.vcdimager.org"
 msgstr ""
 
 #. +> stable
 #: projects/k3bvcdview.cpp:85
-msgid ""
-"Could not find VcdImager executable. To create VideoCD's you must install "
-"VcdImager >= 0.7.12. You can find this on your distribution disks or download "
-"it from http://www.vcdimager.org"
+msgid "Could not find VcdImager executable. To create VideoCD's you must install VcdImager >= 0.7.12. You can find this on your distribution disks or download it from http://www.vcdimager.org"
 msgstr ""
 
@@ -9288 +8599 @@
 #. +> trunk stable
 #: projects/k3bvideodvdview.cpp:58
-msgid ""
-"Be aware that you need to provide the complete Video DVD filestructure. K3b "
-"does not support video transcoding and preparation of video object files yet. "
-"That means you need to already have the VTS_X_YY.VOB and VTS_X_YY.IFO files."
+msgid "Be aware that you need to provide the complete Video DVD filestructure. K3b does not support video transcoding and preparation of video object files yet. That means you need to already have the VTS_X_YY.VOB and VTS_X_YY.IFO files."
 msgstr ""
 
@@ -9381 +8689 @@
 #: rip/base_k3baudiorippingoptionwidget.ui:95
 msgid ""
-"<p>If this option is checked, the entries in the playlist will be relative to "
-"its location.\n"
+"<p>If this option is checked, the entries in the playlist will be relative to its location.\n"
 "<p>Example: If your playlist is located in <em>/home/myself/music</em> and\n"
-"your audio files are in <em>/home/myself/music/cool</em>; then the entries in "
-"the\n"
+"your audio files are in <em>/home/myself/music/cool</em>; then the entries in the\n"
 "playlist will look something like: <em>cool/track1.ogg</em>."
 msgstr ""
@@ -9427 +8733 @@
 #. +> trunk stable
 #: rip/base_k3baudiorippingoptionwidget.ui:148
-msgid ""
-"<p>If this option is checked K3b will create a CDRWIN cue file which allows "
-"to easily write a copy of the audio CD on other systems."
+msgid "<p>If this option is checked K3b will create a CDRWIN cue file which allows to easily write a copy of the audio CD on other systems."
 msgstr ""
 
@@ -9584 +8888 @@
 #: rip/k3baudiocdview.cpp:186
 #, kde-format
-msgid ""
-"Found Cd-Text (%1 - %2). Do you want to use it instead of CDDB (%3 - %4)?"
+msgid "Found Cd-Text (%1 - %2). Do you want to use it instead of CDDB (%3 - %4)?"
 msgstr ""
 
@@ -9977 +9280 @@
 #. +> trunk stable
 #: rip/k3baudiorippingdialog.cpp:210
-msgid ""
-"<p>This specifies the maximum number of retries to read a sector of audio "
-"data from the cd. After that K3b will either skip the sector if the <em>"
-"Ignore Read Errors</em> option is enabled or stop the process."
+msgid "<p>This specifies the maximum number of retries to read a sector of audio data from the cd. After that K3b will either skip the sector if the <em>Ignore Read Errors</em> option is enabled or stop the process."
 msgstr ""
 
@@ -9990 +9290 @@
 #. +> trunk stable
 #: rip/k3baudiorippingdialog.cpp:215
-msgid ""
-"<p>If this option is checked K3b will not rip the audio data in the pregaps. "
-"Most audio tracks contain an empty pregap which does not belong to the track "
-"itself.</p><p>Although the default behavior of nearly all ripping software is "
-"to include the pregaps for most CDs, it makes more sense to ignore them. In "
-"any case, when creating a K3b audio project, the pregaps will be regenerated."
-"</p>"
+msgid "<p>If this option is checked K3b will not rip the audio data in the pregaps. Most audio tracks contain an empty pregap which does not belong to the track itself.</p><p>Although the default behavior of nearly all ripping software is to include the pregaps for most CDs, it makes more sense to ignore them. In any case, when creating a K3b audio project, the pregaps will be regenerated.</p>"
 msgstr ""
 
@@ -10042 +9336 @@
 #. +> trunk stable
 #: rip/k3bcddbpatternwidget.cpp:53
-msgctxt ""
-"Please do NOT modify/translate the quotes, they are part of the pattern!"
+msgctxt "Please do NOT modify/translate the quotes, they are part of the pattern!"
 msgid "%A - %T/%n - !a='%A'{%a - }%t"
 msgstr ""
@@ -10074 +9367 @@
 #. +> trunk stable
 #: rip/k3bcddbpatternwidget.cpp:127
-msgid ""
-"<p><b>Pattern special strings:</b><p>The following strings will be replaced "
-"with their respective meaning in every track name.<br><em>Hint:</em> %A "
-"differs from %a only on soundtracks or compilations.<p><table border=\"0\"><"
-"tr><td></td><td><em>Meaning</em></td><td><em>Alternatives</em></td></tr><tr><"
-"td>%a</td><td>artist of the track</td><td>%{a} or %{artist}</td></tr><tr><td>%"
-"t</td><td>title of the track</td><td>%{t} or %{title}</td></tr><tr><td>%n</td>"
-"<td>track number</td><td>%{n} or %{number}</td></tr><tr><td>%y</td><td>year "
-"of the CD</td><td>%{y} or %{year}</td></tr><tr><td>%c</td><td>extended track "
-"information</td><td>%{c} or %{comment}</td></tr><tr><td>%g</td><td>genre of "
-"the CD</td><td>%{g} or %{genre}</td></tr><tr><td>%A</td><td>album artist</td>"
-"<td>%{A} or %{albumartist}</td></tr><tr><td>%T</td><td>album title</td><td>%"
-"{T} or %{albumtitle}</td></tr><tr><td>%C</td><td>extended CD information</td>"
-"<td>%{C} or %{albumcomment}</td></tr><tr><td>%d</td><td>current date</td><td>%"
-"{d} or %{date}</td></tr><tr><td>%e</td><td>file extension (if left out, it is "
-"added automatically)</td><td>%{e} or %{ext}</td></tr></table>"
+msgid "<p><b>Pattern special strings:</b><p>The following strings will be replaced with their respective meaning in every track name.<br><em>Hint:</em> %A differs from %a only on soundtracks or compilations.<p><table border=\"0\"><tr><td></td><td><em>Meaning</em></td><td><em>Alternatives</em></td></tr><tr><td>%a</td><td>artist of the track</td><td>%{a} or %{artist}</td></tr><tr><td>%t</td><td>title of the track</td><td>%{t} or %{title}</td></tr><tr><td>%n</td><td>track number</td><td>%{n} or %{number}</td></tr><tr><td>%y</td><td>year of the CD</td><td>%{y} or %{year}</td></tr><tr><td>%c</td><td>extended track information</td><td>%{c} or %{comment}</td></tr><tr><td>%g</td><td>genre of the CD</td><td>%{g} or %{genre}</td></tr><tr><td>%A</td><td>album artist</td><td>%{A} or %{albumartist}</td></tr><tr><td>%T</td><td>album title</td><td>%{T} or %{albumtitle}</td></tr><tr><td>%C</td><td>extended CD information</td><td>%{C} or %{albumcomment}</td></tr><tr><td>%d</td><td>current date</td><td>%{d} or %{date}</td></tr><tr><td>%e</td><td>file extension (if left out, it is added automatically)</td><td>%{e} or %{ext}</td></tr></table>"
 msgstr ""
 
@@ -10095 +9373 @@
 #: rip/k3bcddbpatternwidget.cpp:153
 #, c-format
-msgctxt ""
-"Please do NOT modify/translate the quotes, they are part of the pattern!"
-msgid ""
-"<p><b>Conditional inclusion:</b><p>These patterns make it possible to "
-"selectively include texts, depending on the value of CDDB entries. You can "
-"choose only to include or exclude texts if one of the entries is empty, or if "
-"it has a specific value. Examples:<ul><li>@T{TEXT} includes TEXT if the album "
-"title is specified<li>!T{TEXT} includes TEXT if the album title is not "
-"specified<li>@C='Soundtrack'{TEXT} includes TEXT if the CD's extended "
-"information is named Soundtrack<li>!C='Soundtrack'{TEXT} includes TEXT if the "
-"CD's extended information is anything else but Soundtrack<li>It is also "
-"possible to include special strings in texts and conditions, e.g. !a='%A'{%a} "
-"only includes the title's artist information if it does not differ from the "
-"album artist.</ul><p>Conditional includes make use of the same characters as "
-"the special strings, which means that the X in @X{...} can be one character "
-"out of [atnycgATCd]."
+msgctxt "Please do NOT modify/translate the quotes, they are part of the pattern!"
+msgid "<p><b>Conditional inclusion:</b><p>These patterns make it possible to selectively include texts, depending on the value of CDDB entries. You can choose only to include or exclude texts if one of the entries is empty, or if it has a specific value. Examples:<ul><li>@T{TEXT} includes TEXT if the album title is specified<li>!T{TEXT} includes TEXT if the album title is not specified<li>@C='Soundtrack'{TEXT} includes TEXT if the CD's extended information is named Soundtrack<li>!C='Soundtrack'{TEXT} includes TEXT if the CD's extended information is anything else but Soundtrack<li>It is also possible to include special strings in texts and conditions, e.g. !a='%A'{%a} only includes the title's artist information if it does not differ from the album artist.</ul><p>Conditional includes make use of the same characters as the special strings, which means that the X in @X{...} can be one character out of [atnycgATCd]."
 msgstr ""
 
@@ -10198 +9462 @@
 #. +> trunk
 #: rip/k3bvideocdrip.cpp:103
-msgid ""
-"You can find this on your distribution’s software repository or download it "
-"from http://www.vcdimager.org"
+msgid "You can find this on your distribution’s software repository or download it from http://www.vcdimager.org"
 msgstr ""
 
@@ -10211 +9473 @@
 #. +> trunk stable
 #: rip/k3bvideocdrip.cpp:112
-msgid ""
-"You can find this on your distribution disks or download it from http://www."
-"vcdimager.org"
+msgid "You can find this on your distribution disks or download it from http://www.vcdimager.org"
 msgstr ""
 
@@ -10364 +9624 @@
 #. +> trunk stable
 #: rip/k3bvideocdrippingdialog.cpp:134
-msgid ""
-"<p>Ignore extended PSD (located in the ISO-9660 filesystem under `/EXT/PSD_X."
-"VCD') and use the <em>standard</em> PSD.</p>"
+msgid "<p>Ignore extended PSD (located in the ISO-9660 filesystem under `/EXT/PSD_X.VCD') and use the <em>standard</em> PSD.</p>"
 msgstr ""
 
@@ -10376 +9634 @@
 #. +> trunk stable
 #: rip/k3bvideocdrippingdialog.cpp:137
-msgid ""
-"<p>This option only makes sense if you are reading from a BIN CD disk image. "
-"This indicates to `vcdxrip' to assume a 2336-byte sector mode for image file."
-"</p><b>Note: This option is slated to disappear.</b>"
+msgid "<p>This option only makes sense if you are reading from a BIN CD disk image. This indicates to `vcdxrip' to assume a 2336-byte sector mode for image file.</p><b>Note: This option is slated to disappear.</b>"
 msgstr ""
 
@@ -10389 +9644 @@
 #. +> trunk stable
 #: rip/k3bvideocdrippingdialog.cpp:141
-msgid ""
-"<p>This option creates an XML description file with all video CD information."
-"</p><p>This file will always contain all of the information.</p><p>Example: "
-"If you only extract sequences, the description file will also hold the "
-"information for files and segments.</p><p>The filename is the same as the "
-"video CD name, with a .xml extension. The default is VIDEOCD.xml.</p>"
+msgid "<p>This option creates an XML description file with all video CD information.</p><p>This file will always contain all of the information.</p><p>Example: If you only extract sequences, the description file will also hold the information for files and segments.</p><p>The filename is the same as the video CD name, with a .xml extension. The default is VIDEOCD.xml.</p>"
 msgstr ""
 
@@ -10475 +9725 @@
 #. +> trunk stable
 #: rip/videodvd/base_k3bvideodvdrippingwidget.ui:21
-msgid ""
-"Please select the audio streams you want to include in every ripped title"
+msgid "Please select the audio streams you want to include in every ripped title"
 msgstr ""
 
@@ -10526 +9775 @@
 #. +> trunk
 #: rip/videodvd/base_k3bvideodvdrippingwidget.ui:239
-msgid ""
-"<p>No Audio Quality settings available for <em>AC3 pass-through</em>. The "
-"audio stream from the Video DVD is used without any changes.</p>"
+msgid "<p>No Audio Quality settings available for <em>AC3 pass-through</em>. The audio stream from the Video DVD is used without any changes.</p>"
 msgstr ""
 
@@ -10534 +9781 @@
 #. +> stable
 #: rip/videodvd/base_k3bvideodvdrippingwidget.ui:257
-msgid ""
-"<p>No Audio Quality settings available for <em>AC3 pass-through</em>. The "
-"audio stream from the Video DVD is used without any changes."
+msgid "<p>No Audio Quality settings available for <em>AC3 pass-through</em>. The audio stream from the Video DVD is used without any changes."
 msgstr ""
 
@@ -10585 +9830 @@
 #: rip/videodvd/base_k3bvideodvdrippingwidget.ui:468
 msgid ""
-"<p>If this option is checked K3b encodes the video titles in two passes. The "
-"first pass is used to gather information about the video in order to improve "
-"the distribution of bits in the second pass. The resulting video will have a "
-"higher quality using a variable bitrate.\n"
-"<p>If this option is not checked K3b will create video files with a constant "
-"bitrate and a lower quality.\n"
+"<p>If this option is checked K3b encodes the video titles in two passes. The first pass is used to gather information about the video in order to improve the distribution of bits in the second pass. The resulting video will have a higher quality using a variable bitrate.\n"
+"<p>If this option is not checked K3b will create video files with a constant bitrate and a lower quality.\n"
 "<p>2-pass encoding results in a doubled encoding time."
 msgstr ""
@@ -10617 +9858 @@
 #: rip/videodvd/base_k3bvideodvdrippingwidget.ui:489
 msgid ""
-"<p>Most Video DVDs are encoded in a letterboxed format. <em>Letterboxed</em> "
-"refers to black bars used at the top and bottom (and sometimes at the sides) "
-"of the video to force it into one of the aspect ratios supported by the Video "
-"DVD standard.\n"
-"<p>If this option is checked K3b will automatically detect and remove these "
-"black bars from the resulting video.\n"
-"<p>Although this method is very reliable there may be problems if the source "
-"material is exceptionally short or dark."
+"<p>Most Video DVDs are encoded in a letterboxed format. <em>Letterboxed</em> refers to black bars used at the top and bottom (and sometimes at the sides) of the video to force it into one of the aspect ratios supported by the Video DVD standard.\n"
+"<p>If this option is checked K3b will automatically detect and remove these black bars from the resulting video.\n"
+"<p>Although this method is very reliable there may be problems if the source material is exceptionally short or dark."
 msgstr ""
 
@@ -10643 +9879 @@
 #: rip/videodvd/base_k3bvideodvdrippingwidget.ui:506
 msgid ""
-"<p>Video DVD audio streams normally are encoded with a sampling rate of 48000 "
-"Hz. Audio CDs on the other hand are encoded with a sampling rate of 44100 Hz."
-"\n"
-"<p>If this option is checked K3b will change the sampling rate of the audio "
-"stream to 44100 Hz."
+"<p>Video DVD audio streams normally are encoded with a sampling rate of 48000 Hz. Audio CDs on the other hand are encoded with a sampling rate of 44100 Hz.\n"
+"<p>If this option is checked K3b will change the sampling rate of the audio stream to 44100 Hz."
 msgstr ""
 
@@ -10743 +9976 @@
 #. +> trunk stable
 #: rip/videodvd/k3bvideodvdrippingdialog.cpp:498
-msgid ""
-"<p>When using the <em>AC3 pass-through</em> audio codec all selected audio "
-"streams need to be in AC3 format. Please select another audio codec or choose "
-"AC3 audio streams for all ripped titles."
+msgid "<p>When using the <em>AC3 pass-through</em> audio codec all selected audio streams need to be in AC3 format. Please select another audio codec or choose AC3 audio streams for all ripped titles."
 msgstr ""
 
@@ -10817 +10047 @@
 #. +> trunk stable
 #: rip/videodvd/k3bvideodvdrippingview.cpp:88
-msgid ""
-"Shows plain Video DVD vob files from the DVD (including decryption) for "
-"further processing with another application"
+msgid "Shows plain Video DVD vob files from the DVD (including decryption) for further processing with another application"
 msgstr ""
 
@@ -10835 +10063 @@
 #: rip/videodvd/k3bvideodvdrippingview.cpp:244
 #, kde-format
-msgid ""
-"K3b was unable to unmount device '%1' containing medium '%2'. Video DVD "
-"ripping will not work if the device is mounted. Please unmount manually."
+msgid "K3b was unable to unmount device '%1' containing medium '%2'. Video DVD ripping will not work if the device is mounted. Please unmount manually."
 msgstr ""
 
@@ -10847 +10073 @@
 #. +> trunk stable
 #: rip/videodvd/k3bvideodvdrippingview.cpp:259
-msgid ""
-"<p>Unable to read Video DVD contents: Found encrypted Video DVD.<p>Install <i>"
-"libdvdcss</i> to get Video DVD decryption support."
-msgstr ""
-
-#. +> trunk stable
+msgid "<p>Unable to read Video DVD contents: Found encrypted Video DVD.<p>Install <i>libdvdcss</i> to get Video DVD decryption support."
+msgstr ""
+
+#. +> trunk
 #: rip/videodvd/k3bvideodvdrippingview.cpp:270
+#, fuzzy, kde-format
+msgid "%1 (Video DVD)"
+msgstr "Video DVD"
+
+#. +> stable
+#: rip/videodvd/k3bvideodvdrippingview.cpp:218
 #, fuzzy
 msgid "Video DVD"
@@ -10874 +10104 @@
 #. +> trunk stable
 #: rip/videodvd/k3bvideodvdrippingview.cpp:293
-msgid ""
-"<p>K3b uses transcode to rip Video DVDs. Your installation of transcode lacks "
-"support for any of the codecs supported by K3b.<p>Please make sure it is "
-"installed properly."
+msgid "<p>K3b uses transcode to rip Video DVDs. Your installation of transcode lacks support for any of the codecs supported by K3b.<p>Please make sure it is installed properly."
 msgstr ""
 
@@ -10892 +10119 @@
 #. +> trunk stable
 #: rip/videodvd/k3bvideodvdrippingview.cpp:350
-msgid ""
-"<p>Rips single titles from a video DVD into a compressed format such as XviD. "
-"Menu structures are completely ignored.<p>If you intend to copy the plain "
-"Video DVD vob files from the DVD (including decryption) for further "
-"processing with another application, please use \"Show files\" button.<p>If "
-"you intend to make a copy of the entire Video DVD including all menus and "
-"extras it is recommended to use the K3b Copy tool."
+msgid "<p>Rips single titles from a video DVD into a compressed format such as XviD. Menu structures are completely ignored.<p>If you intend to copy the plain Video DVD vob files from the DVD (including decryption) for further processing with another application, please use \"Show files\" button.<p>If you intend to make a copy of the entire Video DVD including all menus and extras it is recommended to use the K3b Copy tool."
 msgstr ""
 
@@ -10925 +10146 @@
 #. +> trunk stable
 #: rip/videodvd/k3bvideodvdrippingwidget.cpp:286
-msgid ""
-"<p><b>Pattern special strings:</b><p>The following strings will be replaced "
-"with their respective meaning in every track name.<br><p><table border=\"0\">"
-"<tr><td></td><td><em>Meaning</em></td><td><em>Alternatives</em></td></tr><tr>"
-"<td>%t</td><td>title number</td><td>%{t} or %{title_number}</td></tr><tr><td>%"
-"i</td><td>volume id (mostly the name of the Video DVD)</td><td>%{i} or %"
-"{volume_id}</td></tr><tr><td>%b</td><td>beautified volume id</td><td>%{b} or %"
-"{beautified_volume_id}</td></tr><tr><td>%l</td><td>two chars language code<"
-"/td><td>%{l} or %{lang_code}</td></tr><tr><td>%n</td><td>language name</td><"
-"td>%{n} or %{lang_name}</td></tr><tr><td>%a</td><td>audio format (on the "
-"Video DVD)</td><td>%{a} or %{audio_format}</td></tr><tr><td>%c</td><td>number "
-"of audio channels (on the Video DVD)</td><td>%{c} or %{channels}</td></tr><tr>"
-"<td>%v</td><td>size of the original video</td><td>%{v} or %{orig_video_size}<"
-"/td></tr><tr><td>%s</td><td>size of the resulting video (<em>Caution: "
-"auto-clipping values are not taken into account.</em>)</td><td>%{s} or %"
-"{video_size}</td></tr><tr><td>%r</td><td>aspect ratio of the original video<"
-"/td><td>%{r} or %{aspect_ratio}</td></tr><tr><td>%d</td><td>current date</td>"
-"<td>%{d} or %{date}</td></tr></table><p><em>Hint: K3b also accepts slight "
-"variations of the long special strings. One can, for example, leave out the "
-"underscores.</em>"
+msgid "<p><b>Pattern special strings:</b><p>The following strings will be replaced with their respective meaning in every track name.<br><p><table border=\"0\"><tr><td></td><td><em>Meaning</em></td><td><em>Alternatives</em></td></tr><tr><td>%t</td><td>title number</td><td>%{t} or %{title_number}</td></tr><tr><td>%i</td><td>volume id (mostly the name of the Video DVD)</td><td>%{i} or %{volume_id}</td></tr><tr><td>%b</td><td>beautified volume id</td><td>%{b} or %{beautified_volume_id}</td></tr><tr><td>%l</td><td>two chars language code</td><td>%{l} or %{lang_code}</td></tr><tr><td>%n</td><td>language name</td><td>%{n} or %{lang_name}</td></tr><tr><td>%a</td><td>audio format (on the Video DVD)</td><td>%{a} or %{audio_format}</td></tr><tr><td>%c</td><td>number of audio channels (on the Video DVD)</td><td>%{c} or %{channels}</td></tr><tr><td>%v</td><td>size of the original video</td><td>%{v} or %{orig_video_size}</td></tr><tr><td>%s</td><td>size of the resulting video (<em>Caution: auto-clipping values are not taken into account.</em>)</td><td>%{s} or %{video_size}</td></tr><tr><td>%r</td><td>aspect ratio of the original video</td><td>%{r} or %{aspect_ratio}</td></tr><tr><td>%d</td><td>current date</td><td>%{d} or %{date}</td></tr></table><p><em>Hint: K3b also accepts slight variations of the long special strings. One can, for example, leave out the underscores.</em>"
 msgstr ""
 
@@ -10954 +10156 @@
 #. +> trunk stable
 #: rip/videodvd/k3bvideodvdrippingwidget.cpp:343
-msgid ""
-"<p>Please choose the width and height of the resulting video. If one value is "
-"set to <em>Auto</em> K3b will choose this value depending on the aspect ratio "
-"of the video picture.<br>Be aware that setting both the width and the height "
-"to fixed values will result in no aspect ratio correction being performed."
-msgstr ""
-
-#. +> trunk stable
+msgid "<p>Please choose the width and height of the resulting video. If one value is set to <em>Auto</em> K3b will choose this value depending on the aspect ratio of the video picture.<br>Be aware that setting both the width and the height to fixed values will result in no aspect ratio correction being performed."
+msgstr ""
+
+#. +> trunk
 #: rip/videodvd/k3bvideodvdrippingwidget.cpp:358
+#, fuzzy
+msgid "Width:"
+msgstr "Å irina:"
+
+#. +> stable
+#: rip/videodvd/k3bvideodvdrippingwidget.cpp:365
 #, fuzzy
 msgid "Width"
 msgstr "Å irina"
 
-#. +> trunk stable
+#. +> trunk
 #: rip/videodvd/k3bvideodvdrippingwidget.cpp:360
+#, fuzzy
+msgid "Height:"
+msgstr "Visina:"
+
+#. +> stable
+#: rip/videodvd/k3bvideodvdrippingwidget.cpp:367
 #, fuzzy
 msgid "Height"
@@ -11107 +10317 @@
 #. +> stable
 #: projects/k3baudioview.cpp:136
-msgid ""
-"No audio decoder plugins found. You will not be able to add any files to the "
-"audio project."
+msgid "No audio decoder plugins found. You will not be able to add any files to the audio project."
 msgstr ""
 
@@ -11132 +10340 @@
 #: tips:16
 msgid ""
-"<p>...that K3b has two types of settings. On the one hand K3b has settings "
-"like most\n"
-"KDE applications have accessible through the configuration dialog via the "
-"settings menu;\n"
-"on the other hand every K3b action dialog has three buttons to load and save "
-"defaults\n"
-"for that action.  This way one may, for example, set the defaults for CD "
-"Copy: these defaults\n"
-"will then be loaded every time the CD Copy dialog is opened. The button <em>"
-"K3b defaults</em>\n"
-"will restore the <em>factory settings</em> in case you do not know if the "
-"settings you chose\n"
+"<p>...that K3b has two types of settings. On the one hand K3b has settings like most\n"
+"KDE applications have accessible through the configuration dialog via the settings menu;\n"
+"on the other hand every K3b action dialog has three buttons to load and save defaults\n"
+"for that action.  This way one may, for example, set the defaults for CD Copy: these defaults\n"
+"will then be loaded every time the CD Copy dialog is opened. The button <em>K3b defaults</em>\n"
+"will restore the <em>factory settings</em> in case you do not know if the settings you chose\n"
 "are appropriate.</p>\n"
 msgstr ""
@@ -11151 +10353 @@
 #: tips:28
 msgid ""
-"<p>...that you do not need to bother changing the settings marked as <em>"
-"advanced</em> if you \n"
-"do not know what they mean. K3b's defaults are suitable for most daily use.<"
-"/p>\n"
+"<p>...that you do not need to bother changing the settings marked as <em>advanced</em> if you \n"
+"do not know what they mean. K3b's defaults are suitable for most daily use.</p>\n"
 msgstr ""
 
@@ -11161 +10361 @@
 #: tips:35
 msgid ""
-"<p>Just left-click one of your devices in the device and file tree and see "
-"what happens. K3b opens a specific\n"
-"window based on the media's contents. For an audio CD for example you will be "
-"given a list of the tracks with\n"
-"the possibility to rip these tracks to any format supported by K3b (like mp3 "
-"or Ogg-Vorbis).</p>\n"
+"<p>Just left-click one of your devices in the device and file tree and see what happens. K3b opens a specific\n"
+"window based on the media's contents. For an audio CD for example you will be given a list of the tracks with\n"
+"the possibility to rip these tracks to any format supported by K3b (like mp3 or Ogg-Vorbis).</p>\n"
 msgstr ""
 
@@ -11173 +10370 @@
 #: tips:43
 msgid ""
-"<p>...that K3b lets you choose media instead of devices for burning. So if "
-"you want to burn to a certain\n"
-"medium simply insert it and wait for K3b to detect it. It will then appear as "
-"your burning medium.</p>\n"
-msgstr ""
+"<p>...that K3b lets you choose media instead of devices for burning. So if you want to burn to a certain\n"
+"medium simply insert it and wait for K3b to detect it. It will then appear as your burning medium.</p>\n"
+msgstr ""

kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/kaffeine.po

@@ -6 +6 @@
 "Project-Id-Version: \n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-09 09:11+0200\n"
+"POT-Creation-Date: 2011-05-25 09:37+0200\n"
 "PO-Revision-Date: 2010-01-24 16:34+0100\n"
 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
@@ -31 +31 @@
 
 #. +> trunk
+#: backend-mplayer/mplayermediawidget.cpp:220
+#, fuzzy
+msgid "Cannot start mplayer process."
+msgstr "Nije moguće pokrenuti proces %1."
+
+#. +> trunk
 #: configurationdialog.cpp:37
 #, fuzzy
@@ -1211 +1217 @@
 
 #. +> trunk
-#: mediawidget.cpp:105 mediawidget.cpp:395
+#: mediawidget.cpp:105 mediawidget.cpp:393
 #, fuzzy
 msgctxt "'Playback' menu"
@@ -1218 +1224 @@
 
 #. +> trunk
-#: mediawidget.cpp:111 mediawidget.cpp:399
+#: mediawidget.cpp:111 mediawidget.cpp:397
 #, fuzzy
 msgctxt "'Playback' menu"
@@ -1338 +1344 @@
 
 #. +> trunk
-#: mediawidget.cpp:265 mediawidget.cpp:272 mediawidget.cpp:954
-#: mediawidget.cpp:962
+#: mediawidget.cpp:265 mediawidget.cpp:272 mediawidget.cpp:950
+#: mediawidget.cpp:958
 #, kde-format, no-c-format
 msgctxt "submenu of 'Skip'"
@@ -1346 +1352 @@
 
 #. +> trunk
-#: mediawidget.cpp:279 mediawidget.cpp:286 mediawidget.cpp:956
-#: mediawidget.cpp:964
+#: mediawidget.cpp:279 mediawidget.cpp:286 mediawidget.cpp:952
+#: mediawidget.cpp:960
 #, kde-format, no-c-format
 msgctxt "submenu of 'Skip'"
@@ -1360 +1366 @@
 #. +> trunk
 #: mediawidget.cpp:304
+#, fuzzy
 msgctxt "dvd navigation"
-msgid "Toggle Menu"
-msgstr ""
+msgid "DVD Menu"
+msgstr "KDE izbornik"
 
 #. +> trunk
@@ -1388 +1395 @@
 
 #. +> trunk
-#: mediawidget.cpp:378
+#: mediawidget.cpp:376
 msgctxt "file filter"
 msgid "Supported Media Files"
@@ -1394 +1401 @@
 
 #. +> trunk
-#: mediawidget.cpp:379
+#: mediawidget.cpp:377
 msgctxt "file filter"
 msgid "All Files"
@@ -1400 +1407 @@
 
 #. +> trunk
-#: mediawidget.cpp:411
+#: mediawidget.cpp:409
 #, fuzzy
 msgctxt "'Playback' menu"
@@ -1407 +1414 @@
 
 #. +> trunk
-#: mediawidget.cpp:415
+#: mediawidget.cpp:413
 #, fuzzy
 msgctxt "'Playback' menu"
@@ -1414 +1421 @@
 
 #. +> trunk
-#: mediawidget.cpp:673
+#: mediawidget.cpp:670
 msgctxt "osd"
 msgid "Stopped"
@@ -1420 +1427 @@
 
 #. +> trunk
-#: mediawidget.cpp:731
+#: mediawidget.cpp:727
 msgctxt "osd"
 msgid "Mute On"
@@ -1426 +1433 @@
 
 #. +> trunk
-#: mediawidget.cpp:734
+#: mediawidget.cpp:730
 msgctxt "osd"
 msgid "Mute Off"
@@ -1432 +1439 @@
 
 #. +> trunk
-#: mediawidget.cpp:741
+#: mediawidget.cpp:737
 #, kde-format
 msgctxt "osd"
@@ -1439 +1446 @@
 
 #. +> trunk
-#: mediawidget.cpp:776
+#: mediawidget.cpp:772
 msgctxt "osd message"
 msgid "Deinterlacing On"
@@ -1445 +1452 @@
 
 #. +> trunk
-#: mediawidget.cpp:778
+#: mediawidget.cpp:774
 msgctxt "osd message"
 msgid "Deinterlacing Off"
@@ -1451 +1458 @@
 
 #. +> trunk
-#: mediawidget.cpp:1177
+#: mediawidget.cpp:1187
 msgctxt "osd"
 msgid "Playing"
@@ -1457 +1464 @@
 
 #. +> trunk
-#: mediawidget.cpp:1196
+#: mediawidget.cpp:1206
 msgctxt "osd"
 msgid "Paused"
@@ -1463 +1470 @@
 
 #. +> trunk
-#: mediawidget.cpp:1444
+#: mediawidget.cpp:1393
 #, fuzzy
 msgctxt "@title:window"
@@ -1470 +1477 @@
 
 #. +> trunk
-#: mediawidget.cpp:1449
+#: mediawidget.cpp:1398
 msgid "Enter a position:"
 msgstr ""

kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/kplayer.po

@@ -6 +6 @@
 "Project-Id-Version: \n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2010-11-16 11:11+0100\n"
+"POT-Creation-Date: 2011-05-25 09:37+0200\n"
 "PO-Revision-Date: 2010-01-24 16:36+0100\n"
 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
@@ -1358 +1358 @@
 #. +> trunk
 #: kplayernode.cpp:1703
+#, fuzzy
 msgid "Searches"
-msgstr ""
+msgstr "Pretrage"
 
 #. +> trunk
@@ -1992 +1993 @@
 
 #. +> trunk
-#: kplayerpart.cpp:127 main.cpp:39
+#: kplayerpart.cpp:127
 msgid "(C) 2002-2008, kiriuja"
 msgstr ""
 
 #. +> trunk
-#: kplayerpart.cpp:129 main.cpp:40
+#: kplayerpart.cpp:129
 msgid "kiriuja"
 msgstr ""
@@ -6810 +6811 @@
 
 #. +> trunk
+#: main.cpp:39
+#, fuzzy
+msgid "(C) 2002-2008, Kirill Bulygin"
+msgstr "© 2008–2009 Gilles Caulier"
+
+#. +> trunk
+#: main.cpp:40
+msgid "Kirill Bulygin"
+msgstr ""
+
+#. +> trunk
 #: main.cpp:90
 msgid "Play the files immediately (default)"

kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/libk3b.po

@@ -6 +6 @@
 "Project-Id-Version: \n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-04-27 10:53+0200\n"
+"POT-Creation-Date: 2011-05-25 09:37+0200\n"
 "PO-Revision-Date: 2010-01-24 16:35+0100\n"
 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
@@ -359 +359 @@
 #. +> trunk stable
 #: jobs/k3bcdcopyjob.cpp:584 jobs/k3bdvdcopyjob.cpp:319
-#, kde-format
+#, fuzzy, kde-format
 msgid "Do you want to overwrite %1?"
-msgstr ""
+msgstr "Åœelite li prebrisati %1?"
 
 #. +> trunk stable
@@ -482 +482 @@
 msgstr ""
 
-#. +> trunk stable
+#. +> trunk
 #: jobs/k3bcdcopyjob.cpp:1102 jobs/k3bverificationjob.cpp:269
+#: projects/k3bcdrecordwriter.cpp:750 projects/mixedcd/k3bmixedjob.cpp:564
+#, fuzzy
+msgid "Please reload the medium and press 'OK'"
+msgstr "Unesite ispravnu adresu elektronske pošte"
+
+#. +> stable
+#: jobs/k3bcdcopyjob.cpp:1101 jobs/k3bverificationjob.cpp:269
 #: projects/k3bcdrecordwriter.cpp:750 projects/mixedcd/k3bmixedjob.cpp:564
 msgid "Please reload the medium and press 'ok'"
@@ -1809 +1816 @@
 msgstr ""
 
-#. +> trunk stable
+#. +> trunk
+#: projects/audiocd/k3baudiojob.cpp:501
+msgid "I/O Error. Most likely no space left on harddisk."
+msgstr ""
+
+#. +> stable
 #: projects/audiocd/k3baudiojob.cpp:501
 msgid "IO Error. Most likely no space left on harddisk."
 msgstr ""
 
-#. +> trunk stable
+#. +> trunk
+#: projects/audiocd/k3baudiojob.cpp:550 projects/mixedcd/k3bmixedjob.cpp:638
+#: projects/mixedcd/k3bmixedjob.cpp:679
+#, fuzzy
+msgid "I/O Error"
+msgstr "Ulazno-izlazna pogreška"
+
+#. +> stable
 #: projects/audiocd/k3baudiojob.cpp:550 projects/mixedcd/k3bmixedjob.cpp:638
 #: projects/mixedcd/k3bmixedjob.cpp:679
@@ -2249 +2268 @@
 msgstr ""
 
-#. +> trunk stable
+#. +> trunk
 #: projects/datacd/k3bmkisofshandler.cpp:122
+msgid "The boot image contains multiple partitions."
+msgstr ""
+
+#. +> stable
+#: projects/datacd/k3bmkisofshandler.cpp:117
 msgid "The boot image contains multiple partitions.."
 msgstr ""
@@ -2665 +2689 @@
 #. +> trunk stable
 #: projects/k3bcdrecordwriter.cpp:723 projects/k3bgrowisofshandler.cpp:140
-#: projects/k3bgrowisofshandler.cpp:147 projects/k3bgrowisofshandler.cpp:148
+#: projects/k3bgrowisofshandler.cpp:147
 msgid "Closing Session"
 msgstr ""
@@ -2922 +2946 @@
 
 #. +> trunk stable
-#: projects/k3bgrowisofshandler.cpp:143 projects/k3bgrowisofshandler.cpp:144
+#: projects/k3bgrowisofshandler.cpp:143
 msgid "Updating RMA"
 msgstr ""
+
+#. +> trunk
+#: projects/k3bgrowisofshandler.cpp:144
+#, fuzzy
+msgid "Updating RMA..."
+msgstr "AÅŸuriram ikonicu 
"
+
+#. +> trunk
+#: projects/k3bgrowisofshandler.cpp:148
+#, fuzzy
+msgid "Closing Session..."
+msgstr "Zatvori sesiju"
 
 #. +> trunk stable
@@ -3360 +3396 @@
 msgstr ""
 
-#. +> trunk stable
+#. +> trunk
+#: projects/videocd/k3bvcdjob.cpp:184
+#, fuzzy
+msgid "Could not write correct XML file."
+msgstr "Nije moguće pisati u datoteku %1."
+
+#. +> stable
 #: projects/videocd/k3bvcdjob.cpp:184
 msgid "Could not write correct XML-file."
@@ -3750 +3792 @@
 #. +> trunk stable
 #: tools/k3bmedium.cpp:359
+#, fuzzy
 msgid "No medium present"
-msgstr ""
+msgstr "Medij nije prisutan"
 
 #. +> trunk stable

kde-croatia/kde4/summit/hr/summit/messages/kdebase/desktop_kdebase_kate.po

@@ -6 +6 @@
 "Project-Id-Version: desktop_kdesdk 0\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-23 09:07+0200\n"
+"POT-Creation-Date: 2011-05-25 09:38+0200\n"
 "PO-Revision-Date: 2009-10-27 17:52+0100\n"
 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
@@ -296 +296 @@
 
 #. +> trunk
-#: kate/plugins/search/katesearch.desktop:18
+#: kate/plugins/search/katesearch.desktop:19
 #, fuzzy
 msgctxt "Comment"
@@ -349 +349 @@
 
 #. +> trunk
-#: kate/plugins/tabbarextension/katetabbarextension.desktop:23
+#: kate/plugins/tabbarextension/katetabbarextension.desktop:24
 msgctxt "Comment"
 msgid "Adds a tab bar with multiple rows to Kate's main window"
@@ -414 +414 @@
 
 #. +> trunk
-#: ktexteditor/kcm_ktexteditor.desktop:29
+#: ktexteditor/kcm_ktexteditor.desktop:30
 #, fuzzy
 msgctxt "Comment"
@@ -449 +449 @@
 
 #. +> trunk
-#: kwrite/kwrite.desktop:29
+#: kwrite/kwrite.desktop:30
 #, fuzzy
 msgctxt "Name"
@@ -472 +472 @@
 
 #. +> trunk
-#: part/plugins/autobookmarker/ktexteditor_autobookmarker.desktop:40
+#: part/plugins/autobookmarker/ktexteditor_autobookmarker.desktop:41
 #, fuzzy
 msgctxt "Comment"
@@ -486 +486 @@
 
 #. +> trunk
-#: part/plugins/autobrace/ktexteditor_autobrace.desktop:43
+#: part/plugins/autobrace/ktexteditor_autobrace.desktop:44
 #, fuzzy
 msgctxt "Comment"
@@ -507 +507 @@
 
 #. +> trunk
-#: part/plugins/exporter/ktexteditor_exporter.desktop:45
+#: part/plugins/exporter/ktexteditor_exporter.desktop:46
 #, fuzzy
 msgctxt "Comment"
@@ -521 +521 @@
 
 #. +> trunk
-#: part/plugins/hlselection/ktexteditor_hlselection.desktop:43
+#: part/plugins/hlselection/ktexteditor_hlselection.desktop:44
 #, fuzzy
 msgctxt "Comment"
@@ -535 +535 @@
 
 #. +> trunk
-#: part/plugins/insertfile/ktexteditor_insertfile.desktop:45
+#: part/plugins/insertfile/ktexteditor_insertfile.desktop:46
 #, fuzzy
 msgctxt "Comment"
@@ -549 +549 @@
 
 #. +> trunk
-#: part/plugins/kdatatool/ktexteditor_kdatatool.desktop:45
+#: part/plugins/kdatatool/ktexteditor_kdatatool.desktop:46
 #, fuzzy
 msgctxt "Comment"
@@ -563 +563 @@
 
 #. +> trunk
-#: part/plugins/kte_iconinserter/ktexteditor_iconinserter.desktop:25
+#: part/plugins/kte_iconinserter/ktexteditor_iconinserter.desktop:26
 #, fuzzy
 msgctxt "Name"
@@ -570 +570 @@
 
 #. +> trunk
-#: part/plugins/kte_iconinserter/ktexteditor_iconinserter.desktop:48
+#: part/plugins/kte_iconinserter/ktexteditor_iconinserter.desktop:50
 #, fuzzy
 msgctxt "GenericName"
@@ -584 +584 @@
 
 #. +> trunk
-#: part/plugins/kte_insanehtml_le/data/ktexteditor_insanehtml_le.desktop:37
+#: part/plugins/kte_insanehtml_le/data/ktexteditor_insanehtml_le.desktop:38
 #, fuzzy
 msgctxt "Comment"
@@ -598 +598 @@
 
 #. +> trunk
-#: part/plugins/pythonencoding/ktexteditor_python-encoding.desktop:29
+#: part/plugins/pythonencoding/ktexteditor_python-encoding.desktop:30
 #, fuzzy
 msgctxt "Comment"
@@ -612 +612 @@
 
 #. +> trunk
-#: part/plugins/timedate/ktexteditor_timedate.desktop:46
+#: part/plugins/timedate/ktexteditor_timedate.desktop:47
 #, fuzzy
 msgctxt "Comment"
@@ -632 +632 @@
 
 #. +> trunk
-#: playground/kte_acomment/ktexteditor_acomment.desktop:20
+#: playground/kte_acomment/ktexteditor_acomment.desktop:21
 msgctxt "Name"
 msgid "Artistic Comment"
@@ -638 +638 @@
 
 #. +> trunk
-#: playground/kte_acomment/ktexteditor_acomment.desktop:42
+#: playground/kte_acomment/ktexteditor_acomment.desktop:44
 msgctxt "GenericName"
 msgid "Format comments in an \"artistic\" way"

kde-croatia/kde4/summit/hr/summit/messages/kdebase/katepart4.po

@@ -10 +10 @@
 "Project-Id-Version: katepart4 0\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-20 07:32+0200\n"
+"POT-Creation-Date: 2011-05-25 09:38+0200\n"
 "PO-Revision-Date: 2010-06-06 14:00+0200\n"
 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
@@ -6643 +6643 @@
 
 #. +> trunk stable
-#: vimode/katevimodebase.cpp:684 vimode/katevinormalmode.cpp:1057
+#: vimode/katevimodebase.cpp:684 vimode/katevinormalmode.cpp:1059
 #, kde-format
 msgid "Nothing in register %1"
@@ -6649 +6649 @@
 
 #. +> trunk stable
-#: vimode/katevinormalmode.cpp:1329
+#: vimode/katevinormalmode.cpp:1331
 #, kde-format
 msgid "'%1' %2,  Hex %3,  Octal %4"
@@ -6655 +6655 @@
 
 #. +> trunk stable
-#: vimode/katevinormalmode.cpp:1983
+#: vimode/katevinormalmode.cpp:1985
 #, kde-format
 msgid "Mark not set: %1"

kde-croatia/kde4/summit/hr/summit/messages/kdebase/konqueror.po

@@ -9 +9 @@
 "Project-Id-Version: konqueror 0\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-13 05:50+0200\n"
+"POT-Creation-Date: 2011-05-25 09:38+0200\n"
 "PO-Revision-Date: 2011-02-15 16:19+0100\n"
 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
@@ -2640 +2640 @@
 
 #. +> trunk stable
-#: src/konqview.cpp:1199
+#: src/konqview.cpp:1203
 msgid "The page you are trying to view is the result of posted form data. If you resend the data, any action the form carried out (such as search or online purchase) will be repeated. "
 msgstr "Stranica koju ÅŸelite otvoriti rezultat je podataka objavljenih u obliku obrasca. Ako ponovno poÅ¡aljete podatke svaka će akcija koja proizlazi iz obrasca biti ponovljena (npr. pretraÅŸivanje ili kupovina putem Interneta)."
 
 #. +> trunk
-#: src/konqview.cpp:1201
+#: src/konqview.cpp:1205
 #, fuzzy
 msgctxt "@title:window"
@@ -2657 +2657 @@
 
 #. +> trunk stable
-#: src/konqview.cpp:1201
+#: src/konqview.cpp:1205
 msgid "Resend"
 msgstr "Ponovno pošalji"

kde-croatia/kde4/summit/hr/summit/messages/kdebase/nepomukstorage.po

@@ -8 +8 @@
 "Project-Id-Version: nepomuk\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-13 05:50+0200\n"
+"POT-Creation-Date: 2011-05-25 09:38+0200\n"
 "PO-Revision-Date: 2010-05-30 18:06+0200\n"
 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
@@ -49 +49 @@
 
 #. +> trunk stable
-#: ontologyloader.cpp:135
+#: ontologyloader.cpp:134
 #, kde-format
 msgid "Parsing of file %1 failed (%2)"

kde-croatia/kde4/summit/hr/summit/messages/kdeedu/blinken.po

@@ -6 +6 @@
 "Project-Id-Version: blinken\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-01-11 10:25+0100\n"
+"POT-Creation-Date: 2011-05-25 09:38+0200\n"
 "PO-Revision-Date: 2010-03-12 10:41+0100\n"
 "Last-Translator: Ivo Ugrina <ivo@iugrina.com>\n"
@@ -210 +210 @@
 
 #. +> stable
-#: highscoredialog.cpp:152 highscoredialog.cpp:153
+#: highscoredialog.cpp:156 highscoredialog.cpp:157
 #, kde-format
 msgctxt "@title:group level high scores"
@@ -236 +236 @@
 
 #. +> stable
-#: highscoredialog.cpp:154
+#: highscoredialog.cpp:158
 msgctxt "@title:group all other level high scores"
 msgid "Level ?"

kde-croatia/kde4/summit/hr/summit/messages/kdeedu/kalgebra.po

@@ -7 +7 @@
 "Project-Id-Version: \n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-17 08:57+0200\n"
+"POT-Creation-Date: 2011-05-25 09:38+0200\n"
 "PO-Revision-Date: 2010-02-25 21:28+0100\n"
 "Last-Translator: Ivo Ugrina <ivo@iugrina.com>\n"
@@ -40 +40 @@
 
 #. +> trunk stable
-#: analitza/analyzer.cpp:495
+#: analitza/analyzer.cpp:498
 msgctxt "Error message, no proper condition found."
 msgid "Could not find a proper choice for a condition statement."
@@ -52 +52 @@
 
 #. +> trunk stable
-#: analitza/analyzer.cpp:824
+#: analitza/analyzer.cpp:827
 msgid "Type not supported for bounding."
 msgstr ""
 
 #. +> trunk stable
-#: analitza/analyzer.cpp:849
+#: analitza/analyzer.cpp:852
 msgid "The downlimit is greater than the uplimit"
 msgstr ""
 
 #. +> trunk stable
-#: analitza/analyzer.cpp:851
+#: analitza/analyzer.cpp:854
 msgid "Incorrect uplimit or downlimit."
 msgstr ""
@@ -72 +72 @@
 
 #. +> trunk stable
-#: analitza/analyzer.cpp:1813
+#: analitza/analyzer.cpp:1812
 msgctxt "By a cycle i mean a variable that depends on itself"
 msgid "Defined a variable cycle"
@@ -78 +78 @@
 
 #. +> trunk stable
-#: analitza/analyzer.cpp:1855
+#: analitza/analyzer.cpp:1854
 msgid "The result is not a number"
 msgstr "Rezultat nije broj"
@@ -171 +171 @@
 
 #. +> trunk stable
-#: analitza/expression.cpp:372
+#: analitza/expression.cpp:373
 #, kde-format
 msgid "Error while parsing: %1"
@@ -177 +177 @@
 
 #. +> trunk stable
-#: analitza/expression.cpp:403
+#: analitza/expression.cpp:404
 #, kde-format
 msgctxt "An error message"
@@ -184 +184 @@
 
 #. +> trunk stable
-#: analitza/expression.cpp:409
+#: analitza/expression.cpp:410
 #, kde-format
 msgid "Cannot codify the %1 value."
@@ -190 +190 @@
 
 #. +> trunk stable
-#: analitza/expression.cpp:415
+#: analitza/expression.cpp:416
 #, kde-format
 msgid "The %1 operator cannot have child contexts."
@@ -196 +196 @@
 
 #. +> trunk stable
-#: analitza/expression.cpp:419
+#: analitza/expression.cpp:420
 #, kde-format
 msgid "The element '%1' is not an operator."
@@ -202 +202 @@
 
 #. +> trunk stable
-#: analitza/expression.cpp:432
+#: analitza/expression.cpp:433
 #, fuzzy
 msgid "Do not want empty vectors"
@@ -208 +208 @@
 
 #. +> trunk stable
-#: analitza/expression.cpp:450
+#: analitza/expression.cpp:451
 #, kde-format
 msgctxt "Error message due to an unrecognized input"
@@ -215 +215 @@
 
 #. +> trunk
-#: analitza/expressiontypechecker.cpp:401
+#: analitza/expressiontypechecker.cpp:391
 msgid "The domain should be either a vector or a list."
 msgstr ""
 
 #. +> trunk stable
-#: analitza/expressiontypechecker.cpp:501
+#: analitza/expressiontypechecker.cpp:492
 #, fuzzy, kde-format
 #| msgid "Wrong parameter count, had 1 parameter for '%2'"
@@ -231 +231 @@
 
 #. +> trunk stable
-#: analitza/expressiontypechecker.cpp:533
+#: analitza/expressiontypechecker.cpp:531
 #, fuzzy, kde-format
 msgid "Could not call '%1'"
@@ -237 +237 @@
 
 #. +> trunk stable
-#: analitza/expressiontypechecker.cpp:541
+#: analitza/expressiontypechecker.cpp:539
 #, fuzzy, kde-format
 msgid "Could not solve '%1'"
@@ -243 +243 @@
 
 #. +> trunk stable
-#: analitza/expressiontypechecker.cpp:589
+#: analitza/expressiontypechecker.cpp:587
 msgid "Could not determine the type for piecewise"
 msgstr ""
 
 #. +> trunk
-#: analitza/expressiontypechecker.cpp:768
+#: analitza/expressiontypechecker.cpp:764
 #, fuzzy
 msgid "Unexpected type"
@@ -254 +254 @@
 
 #. +> trunk stable
-#: analitza/expressiontypechecker.cpp:791
+#: analitza/expressiontypechecker.cpp:787
 #, fuzzy, kde-format
 #| msgid "Cannot convert %1 to %2"
@@ -379 +379 @@
 
 #. +> trunk stable
-#: analitzagui/function.cpp:66 exp.g:415
+#: analitzagui/function.cpp:66 exp.g:420
 #, fuzzy
 msgid ", "
@@ -879 +879 @@
 
 #. +> trunk stable
-#: analitzagui/operatorsmodel.cpp:531
+#: analitzagui/operatorsmodel.cpp:533
 #, kde-format
 msgctxt "n-ary function prototype"
@@ -886 +886 @@
 
 #. +> trunk stable
-#: analitzagui/operatorsmodel.cpp:542
+#: analitzagui/operatorsmodel.cpp:544
 #, kde-format
 msgctxt "Function name in function prototype"
@@ -893 +893 @@
 
 #. +> trunk stable
-#: analitzagui/operatorsmodel.cpp:543
+#: analitzagui/operatorsmodel.cpp:545
 #, kde-format
 msgctxt "Uncorrect function name in function prototype"
@@ -900 +900 @@
 
 #. +> trunk stable
-#: analitzagui/operatorsmodel.cpp:546
+#: analitzagui/operatorsmodel.cpp:548
 #, kde-format
 msgctxt "Parameter in function prototype"
@@ -907 +907 @@
 
 #. +> trunk stable
-#: analitzagui/operatorsmodel.cpp:549 analitzagui/operatorsmodel.cpp:559
+#: analitzagui/operatorsmodel.cpp:551 analitzagui/operatorsmodel.cpp:561
 #, kde-format
 msgctxt "Current parameter in function prototype"
@@ -914 +914 @@
 
 #. +> trunk stable
-#: analitzagui/operatorsmodel.cpp:552
+#: analitzagui/operatorsmodel.cpp:554
 msgctxt "Function parameter separator"
 msgid ", "
@@ -920 +920 @@
 
 #. +> trunk stable
-#: analitzagui/operatorsmodel.cpp:556
+#: analitzagui/operatorsmodel.cpp:558
 msgctxt "Current parameter is the bounding"
 msgid " : bounds"
@@ -932 +932 @@
 
 #. +> trunk stable
-#: exp.g:415
+#: exp.g:420
 #, kde-format
 msgctxt "error message"
@@ -939 +939 @@
 
 #. +> trunk stable
-#: exp.g:417
+#: exp.g:422
 msgid "Missing right parenthesis"
 msgstr "Nedostaje desna zagrada"
 
 #. +> trunk stable
-#: exp.g:419
+#: exp.g:424
 msgid "Unbalanced right parenthesis"
 msgstr ""
 
 #. +> trunk stable
-#: exp.g:421
+#: exp.g:426
 #, kde-format
 msgid "Unexpected token %1"

kde-croatia/kde4/summit/hr/summit/messages/kdeedu/kalzium.po

@@ -6 +6 @@
 "Project-Id-Version: kalzium 0\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-16 08:59+0200\n"
+"POT-Creation-Date: 2011-05-25 09:38+0200\n"
 "PO-Revision-Date: 2010-08-24 23:53+0200\n"
 "Last-Translator: Oliver Mucafir <oliver.untwist@gmail.com>\n"
@@ -86 +86 @@
 
 #. +> trunk stable
-#: data/knowledge.xml:4 src/kalziumgradienttype.cpp:448
+#: data/knowledge.xml:4 src/kalziumgradienttype.cpp:454
 msgid "State of matter"
 msgstr "Agregatno stanje"
@@ -399 +399 @@
 #. +> trunk stable
 #: data/knowledge.xml:131 src/elementdataviewer.cpp:228
-#: src/kalziumgradienttype.cpp:284
+#: src/kalziumgradienttype.cpp:290
 msgid "Atomic Mass"
 msgstr "Atomska masa"
@@ -564 +564 @@
 #: data/knowledge.xml:275 src/detailinfodlg.cpp:235
 #: src/elementdataviewer.cpp:261 src/exportdialog.cpp:130
-#: src/kalziumgradienttype.cpp:169 src/plotsetupwidget.ui:146
+#: src/kalziumgradienttype.cpp:175 src/plotsetupwidget.ui:146
 #: src/plotsetupwidget.ui:298 src/settings_gradients.ui:60
 msgid "Covalent Radius"
@@ -5114 +5114 @@
 #. +> trunk stable
 #: src/detailinfodlg.cpp:207 src/elementdataviewer.cpp:240
-#: src/exportdialog.cpp:132 src/kalziumgradienttype.cpp:393
+#: src/exportdialog.cpp:132 src/kalziumgradienttype.cpp:399
 #: src/plotsetupwidget.ui:131 src/plotsetupwidget.ui:283
 #: src/settings_gradients.ui:88
@@ -5125 +5125 @@
 #. +> trunk stable
 #: src/detailinfodlg.cpp:214 src/elementdataviewer.cpp:247
-#: src/exportdialog.cpp:133 src/kalziumgradienttype.cpp:337
+#: src/exportdialog.cpp:133 src/kalziumgradienttype.cpp:343
 #: src/plotsetupwidget.ui:136 src/plotsetupwidget.ui:288
 #: src/settings_gradients.ui:81
@@ -6507 +6507 @@
 
 #. +> trunk stable
-#: src/kalziumgradienttype.cpp:226
+#: src/kalziumgradienttype.cpp:232
 msgid "van Der Waals"
 msgstr "Van Der Waals"
 
 #. +> trunk stable
-#: src/kalziumgradienttype.cpp:296
+#: src/kalziumgradienttype.cpp:302
 msgid "u"
 msgstr "u"
@@ -6524 +6524 @@
 
 #. +> trunk stable
-#: src/kalziumgradienttype.cpp:504
+#: src/kalziumgradienttype.cpp:510
 msgid "Electronegativity (Pauling)"
 msgstr "Elektronegativnost (Pauling)"
 
 #. +> trunk stable
-#: src/kalziumgradienttype.cpp:559
+#: src/kalziumgradienttype.cpp:565
 msgid "Discovery date"
 msgstr "Datum otkrića"
@@ -6540 +6540 @@
 #. i18n: ectx: property (text), widget (QCheckBox, kcfg_LogarithmicElectronaffinityGradient)
 #. +> trunk stable
-#: src/kalziumgradienttype.cpp:616 src/settings_gradients.ui:109
+#: src/kalziumgradienttype.cpp:622 src/settings_gradients.ui:109
 msgid "Electronaffinity"
 msgstr "Elektronski afinitet"
 
 #. +> trunk stable
-#: src/kalziumgradienttype.cpp:673
+#: src/kalziumgradienttype.cpp:678
 msgid "First Ionization"
 msgstr "Prva ionizacija"

kde-croatia/kde4/summit/hr/summit/messages/kdeedu/marble_qt.po

@@ -7 +7 @@
 "Project-Id-Version: \n"
 "Report-Msgid-Bugs-To: \n"
-"POT-Creation-Date: 2011-05-22 08:38+0200\n"
+"POT-Creation-Date: 2011-05-25 09:39+0200\n"
 "PO-Revision-Date: 2010-09-14 15:36+0200\n"
 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
@@ -397 +397 @@
 
 #. +> trunk stable
-#: src/lib/geodata/parser/GeoDataParser.cpp:98
+#: src/lib/geodata/parser/GeoDataParser.cpp:99
 msgid "The file is not a valid GPX 1.0 / 1.1 file"
 msgstr ""
 
 #. +> trunk stable
-#: src/lib/geodata/parser/GeoDataParser.cpp:101
+#: src/lib/geodata/parser/GeoDataParser.cpp:102
 msgid "The file is not a valid KML 2.0 / 2.1 / 2.2 file"
 msgstr ""
 
 #. +> trunk stable
-#: src/lib/geodata/parser/GeoParser.cpp:129
+#: src/lib/geodata/parser/GeoParser.cpp:130
 #, fuzzy, qt-format
 msgid "Error parsing file at line: %1 and column %2 . "
@@ -413 +413 @@
 
 #. +> trunk stable
-#: src/lib/geodata/parser/GeoParser.cpp:131
+#: src/lib/geodata/parser/GeoParser.cpp:132
 #, fuzzy
 msgid "This is an Invalid File"
@@ -419 +419 @@
 
 #. +> trunk stable
-#: src/lib/geodata/parser/GeoParser.cpp:190
+#: src/lib/geodata/parser/GeoParser.cpp:191
 msgid "File format unrecognized"
 msgstr ""
 
 #. +> trunk stable
-#: src/lib/geodata/parser/GeoSceneParser.cpp:64
+#: src/lib/geodata/parser/GeoSceneParser.cpp:65
 msgid "The file is not a valid DGML 2.0 file"
 msgstr ""
@@ -1132 +1132 @@
 
 #. +> trunk stable
-#: src/lib/MarbleWidget.cpp:1159
+#: src/lib/MarbleWidget.cpp:1170
 #: src/plugins/render/mapscale/MapScaleFloatItem.cpp:48
 #: src/plugins/render/mapscale/MapScaleFloatItem.cpp:244
@@ -1140 +1140 @@
 
 #. +> trunk stable
-#: src/lib/MarbleWidget.cpp:1163
+#: src/lib/MarbleWidget.cpp:1174
 #: src/plugins/render/mapscale/MapScaleFloatItem.cpp:253
 #, fuzzy

kde-croatia/kde4/summit/hr/summit/messages/kdegraphics/gwenview.po

@@ -9 +9 @@
 "Project-Id-Version: \n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-23 09:09+0200\n"
+"POT-Creation-Date: 2011-05-25 09:39+0200\n"
 "PO-Revision-Date: 2011-03-12 12:13+0100\n"
 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
@@ -126 +126 @@
 
 #. +> trunk
-#: app/fileoperations.cpp:72
+#: app/fileoperations.cpp:57
 #, fuzzy
 #| msgid "Copy To"
@@ -139 +139 @@
 
 #. +> trunk stable
-#: app/fileoperations.cpp:73
+#: app/fileoperations.cpp:58
 msgctxt "@action:button"
 msgid "Copy"
@@ -145 +145 @@
 
 #. +> trunk
-#: app/fileoperations.cpp:76
+#: app/fileoperations.cpp:61
 #, fuzzy
 #| msgid "Move To"
@@ -158 +158 @@
 
 #. +> trunk stable
-#: app/fileoperations.cpp:77
+#: app/fileoperations.cpp:62
 msgctxt "@action:button"
 msgid "Move"
@@ -164 +164 @@
 
 #. +> trunk
-#: app/fileoperations.cpp:80
+#: app/fileoperations.cpp:65
 #, fuzzy
 #| msgid "Link To"
@@ -177 +177 @@
 
 #. +> trunk stable
-#: app/fileoperations.cpp:81
+#: app/fileoperations.cpp:66
 msgctxt "@action:button"
 msgid "Link"
 msgstr "PoveÅŸi"
 
-#. +> trunk
-#: app/fileoperations.cpp:170
-#, fuzzy
-#| msgid "Create Folder"
-msgctxt "@title:window"
-msgid "Create Folder"
-msgstr "Stvori mapu"
+#. +> trunk stable
+#: app/fileoperations.cpp:159
+msgid "Move Here"
+msgstr "Ovdje premjesti"
+
+#. +> trunk stable
+#: app/fileoperations.cpp:162
+msgid "Copy Here"
+msgstr "Ovdje kopiraj"
+
+#. +> trunk stable
+#: app/fileoperations.cpp:165
+msgid "Link Here"
+msgstr "Ovdje poveÅŸi"
+
+#. +> trunk stable
+#: app/fileoperations.cpp:169
+msgid "Cancel"
+msgstr "Prekini"
 
 #. +> stable
@@ -195 +207 @@
 msgstr "Stvori mapu"
 
-#. +> trunk stable
+#. +> stable
 #: app/fileoperations.cpp:171
 msgid "Enter the name of the folder to create:"
 msgstr "Unesite naziv mape koju treba stvoriti:"
 
-#. +> trunk stable
-#: app/fileoperations.cpp:201
-msgid "Move Here"
-msgstr "Ovdje premjesti"
-
-#. +> trunk stable
-#: app/fileoperations.cpp:204
-msgid "Copy Here"
-msgstr "Ovdje kopiraj"
-
-#. +> trunk stable
-#: app/fileoperations.cpp:207
-msgid "Link Here"
-msgstr "Ovdje poveÅŸi"
-
-#. +> trunk stable
-#: app/fileoperations.cpp:211
-msgid "Cancel"
-msgstr "Prekini"
-
 #. +> trunk
-#: app/fileoperations.cpp:227
+#: app/fileoperations.cpp:188
 #, fuzzy
 #| msgid "Rename"
@@ -234 +226 @@
 
 #. +> trunk stable
-#: app/fileoperations.cpp:228
+#: app/fileoperations.cpp:189
 #, kde-format
 msgid "Rename <filename>%1</filename> to:"
 msgstr "Preimenuj <filename>%1</filename> u:"
 
-#. +> trunk stable
-#: app/fileopscontextmanageritem.cpp:86
+#. +> stable
+#: app/fileopscontextmanageritem.cpp:82
 msgctxt "@action:inmenu"
 msgid "Paste One Folder"
 msgstr "Zalijepi jednu mapu"
 
-#. +> trunk stable
-#: app/fileopscontextmanageritem.cpp:87
+#. +> stable
+#: app/fileopscontextmanageritem.cpp:83
 msgctxt "@action:inmenu"
 msgid "Paste One File"
 msgstr "Zalijepi jednu datoteku"
 
-#. +> trunk stable
-#: app/fileopscontextmanageritem.cpp:90
+#. +> stable
+#: app/fileopscontextmanageritem.cpp:86
 #, kde-format
 msgctxt "@action:inmenu"
@@ -261 +253 @@
 msgstr[2] "Zalijepi %1 stavki"
 
-#. +> trunk stable
-#: app/fileopscontextmanageritem.cpp:92
+#. +> stable
+#: app/fileopscontextmanageritem.cpp:88
 msgctxt "@action:inmenu"
 msgid "Paste Clipboard Contents..."
 msgstr "Zalijepi sadrÅŸaj odlagaliÅ¡ta 
"
 
-#. +> trunk stable
-#: app/fileopscontextmanageritem.cpp:96
+#. +> stable
+#: app/fileopscontextmanageritem.cpp:92
 msgctxt "@action:inmenu"
 msgid "Paste"
@@ -274 +266 @@
 
 #. +> trunk stable
-#: app/fileopscontextmanageritem.cpp:208
+#: app/fileopscontextmanageritem.cpp:165
 msgid "File Operations"
 msgstr "Postupci nad datotekom"
 
 #. +> trunk stable
-#: app/fileopscontextmanageritem.cpp:219 app/mainwindow.cpp:311
+#: app/fileopscontextmanageritem.cpp:176 app/mainwindow.cpp:311
 #: app/thumbnailviewpanel.cpp:147
 msgctxt "@title actions category"
@@ -286 +278 @@
 
 #. +> trunk stable
-#: app/fileopscontextmanageritem.cpp:220
+#: app/fileopscontextmanageritem.cpp:177
 #: app/semanticinfocontextmanageritem.cpp:161
 msgctxt "@title actions category"
@@ -293 +285 @@
 
 #. +> trunk stable
-#: app/fileopscontextmanageritem.cpp:235
+#: app/fileopscontextmanageritem.cpp:192
 msgctxt "Verb"
 msgid "Copy To..."
@@ -299 +291 @@
 
 #. +> trunk stable
-#: app/fileopscontextmanageritem.cpp:239
+#: app/fileopscontextmanageritem.cpp:196
 msgctxt "Verb"
 msgid "Move To..."
@@ -305 +297 @@
 
 #. +> trunk stable
-#: app/fileopscontextmanageritem.cpp:243
+#: app/fileopscontextmanageritem.cpp:200
 msgctxt "Verb: create link to the file where user wants"
 msgid "Link To..."
@@ -311 +303 @@
 
 #. +> trunk stable
-#: app/fileopscontextmanageritem.cpp:247
+#: app/fileopscontextmanageritem.cpp:204
 msgctxt "Verb"
 msgid "Rename..."
@@ -317 +309 @@
 
 #. +> trunk stable
-#: app/fileopscontextmanageritem.cpp:251
+#: app/fileopscontextmanageritem.cpp:208
 msgctxt "Verb"
 msgid "Trash"
@@ -323 +315 @@
 
 #. +> trunk stable
-#: app/fileopscontextmanageritem.cpp:256
+#: app/fileopscontextmanageritem.cpp:213
 msgid "Delete"
 msgstr "Izbriši"
 
 #. +> trunk
-#: app/fileopscontextmanageritem.cpp:261
+#: app/fileopscontextmanageritem.cpp:218
 #, fuzzy
 msgid "Restore"
@@ -334 +326 @@
 
 #. +> trunk stable
-#: app/fileopscontextmanageritem.cpp:264
+#: app/fileopscontextmanageritem.cpp:221
 msgid "Properties"
 msgstr "Svojstva"
 
 #. +> trunk stable
-#: app/fileopscontextmanageritem.cpp:268
+#: app/fileopscontextmanageritem.cpp:225
 msgid "Create Folder..."
 msgstr "Stvori mapu 
"
 
 #. +> trunk stable
-#: app/fileopscontextmanageritem.cpp:272
+#: app/fileopscontextmanageritem.cpp:229
 msgid "Open With"
 msgstr "Otvori s"
 
 #. +> trunk stable
-#: app/fileopscontextmanageritem.cpp:461
+#: app/fileopscontextmanageritem.cpp:419
 msgid "Other Application..."
 msgstr "Druga aplikacija 
"
@@ -753 +745 @@
 
 #. +> trunk stable
-#: app/infocontextmanageritem.cpp:164
+#: app/infocontextmanageritem.cpp:165
 #, kde-format
 msgctxt "@item:intext %1 is a key, we append a colon to it. A value is displayed after"
@@ -760 +752 @@
 
 #. +> trunk stable
-#: app/infocontextmanageritem.cpp:236
+#: app/infocontextmanageritem.cpp:237
 msgctxt "@action show more image meta info"
 msgid "More..."
@@ -766 +758 @@
 
 #. +> trunk stable
-#: app/infocontextmanageritem.cpp:247
+#: app/infocontextmanageritem.cpp:248
 msgctxt "@title:group"
 msgid "Meta Information"
@@ -772 +764 @@
 
 #. +> trunk stable
-#: app/infocontextmanageritem.cpp:336
+#: app/infocontextmanageritem.cpp:337
 #, kde-format
 msgctxt "@label"
@@ -782 +774 @@
 
 #. +> trunk stable
-#: app/infocontextmanageritem.cpp:338
+#: app/infocontextmanageritem.cpp:339
 #, kde-format
 msgctxt "@label"
@@ -792 +784 @@
 
 #. +> trunk stable
-#: app/infocontextmanageritem.cpp:341
+#: app/infocontextmanageritem.cpp:342
 #, kde-format
 msgid "%1 folder"
@@ -801 +793 @@
 
 #. +> trunk stable
-#: app/infocontextmanageritem.cpp:341
+#: app/infocontextmanageritem.cpp:342
 #, kde-format
 msgid "%1 file"
@@ -810 +802 @@
 
 #. +> trunk stable
-#: app/infocontextmanageritem.cpp:341
+#: app/infocontextmanageritem.cpp:342
 #, kde-format
 msgctxt "@label. The two parameters are strings like '2 folders' and '1 file'."
@@ -2112 +2104 @@
 msgstr "P&rikaz"
 
+#, fuzzy
+#~| msgid "Create Folder"
+#~ msgctxt "@title:window"
+#~ msgid "Create Folder"
+#~ msgstr "Stvori mapu"
+
 #~ msgid "Enter the new size of the image:"
 #~ msgstr "Unesite novu veličinu slike:"

kde-croatia/kde4/summit/hr/summit/messages/kdelibs/kdecalendarsystems.po

@@ -12 +12 @@
 "Project-Id-Version: kdelibs4\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-09 09:14+0200\n"
+"POT-Creation-Date: 2011-05-25 09:40+0200\n"
 "PO-Revision-Date: 2011-05-05 10:21+0200\n"
 "Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
@@ -30 +30 @@
 
 #. +> trunk stable
-#: kcalendarsystem.cpp:83 kcalendarsystem.cpp:174
+#: kcalendarsystem.cpp:83 kcalendarsystem.cpp:175
 msgctxt "@item Calendar system"
 msgid "Invalid Calendar Type"
@@ -36 +36 @@
 
 #. +> trunk stable
-#: kcalendarsystem.cpp:149
+#: kcalendarsystem.cpp:150
 msgctxt "@item Calendar system"
 msgid "Gregorian"
@@ -42 +42 @@
 
 #. +> trunk stable
-#: kcalendarsystem.cpp:151
+#: kcalendarsystem.cpp:152
 msgctxt "@item Calendar system"
 msgid "Coptic"
@@ -48 +48 @@
 
 #. +> trunk stable
-#: kcalendarsystem.cpp:153
+#: kcalendarsystem.cpp:154
 msgctxt "@item Calendar system"
 msgid "Ethiopian"
@@ -54 +54 @@
 
 #. +> trunk stable
-#: kcalendarsystem.cpp:155
+#: kcalendarsystem.cpp:156
 msgctxt "@item Calendar system"
 msgid "Gregorian (Proleptic)"
@@ -60 +60 @@
 
 #. +> trunk stable
-#: kcalendarsystem.cpp:157
+#: kcalendarsystem.cpp:158
 msgctxt "@item Calendar system"
 msgid "Hebrew"
@@ -66 +66 @@
 
 #. +> trunk stable
-#: kcalendarsystem.cpp:159
+#: kcalendarsystem.cpp:160
 msgctxt "@item Calendar system"
 msgid "Islamic / Hijri (Civil)"
@@ -72 +72 @@
 
 #. +> trunk stable
-#: kcalendarsystem.cpp:161
+#: kcalendarsystem.cpp:162
 msgctxt "@item Calendar system"
 msgid "Indian National"
@@ -78 +78 @@
 
 #. +> trunk stable
-#: kcalendarsystem.cpp:163
+#: kcalendarsystem.cpp:164
 msgctxt "@item Calendar system"
 msgid "Jalali"
@@ -84 +84 @@
 
 #. +> trunk stable
-#: kcalendarsystem.cpp:165
+#: kcalendarsystem.cpp:166
 msgctxt "@item Calendar system"
 msgid "Japanese"
@@ -90 +90 @@
 
 #. +> trunk stable
-#: kcalendarsystem.cpp:167
+#: kcalendarsystem.cpp:168
 msgctxt "@item Calendar system"
 msgid "Julian"
@@ -96 +96 @@
 
 #. +> trunk stable
-#: kcalendarsystem.cpp:169
+#: kcalendarsystem.cpp:170
 msgctxt "@item Calendar system"
 msgid "Taiwanese"
@@ -102 +102 @@
 
 #. +> trunk stable
-#: kcalendarsystem.cpp:171
+#: kcalendarsystem.cpp:172
 msgctxt "@item Calendar system"
 msgid "Thai"
@@ -108 +108 @@
 
 #. +> trunk stable
-#: kcalendarsystem.cpp:1990
+#: kcalendarsystem.cpp:2026
 msgctxt "Negative symbol as used for year numbers, e.g. -5 = 5 BC"
 msgid "-"
@@ -114 +114 @@
 
 #. +> trunk stable
-#: kcalendarsystem.cpp:2027
+#: kcalendarsystem.cpp:2063
 msgid "Today"
 msgstr "Danas"
 
 #. +> trunk stable
-#: kcalendarsystem.cpp:2029
+#: kcalendarsystem.cpp:2065
 msgid "Yesterday"
 msgstr "Jučer"
@@ -1282 +1282 @@
 
 #. +> trunk stable
-#: kcalendarsystemethiopian.cpp:56
+#: kcalendarsystemethiopian.cpp:54
 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, LongFormat"
 msgid "Amata Mehrat"
@@ -1288 +1288 @@
 
 #. +> trunk stable
-#: kcalendarsystemethiopian.cpp:57
+#: kcalendarsystemethiopian.cpp:55
 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, ShortFormat"
 msgid "AM"
@@ -1294 +1294 @@
 
 #. +> trunk stable
-#: kcalendarsystemethiopian.cpp:58
+#: kcalendarsystemethiopian.cpp:56
 #, c-format
 msgctxt "(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM"
@@ -1301 +1301 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:70
+#: kcalendarsystemethiopian.cpp:68
 #, fuzzy
 msgctxt "Ethiopian month 1 - KLocale::NarrowName"
@@ -1308 +1308 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:72
+#: kcalendarsystemethiopian.cpp:70
 #, fuzzy
 msgctxt "Ethiopian month 2 - KLocale::NarrowName"
@@ -1315 +1315 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:74
+#: kcalendarsystemethiopian.cpp:72
 #, fuzzy
 msgctxt "Ethiopian month 3 - KLocale::NarrowName"
@@ -1322 +1322 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:76
+#: kcalendarsystemethiopian.cpp:74
 #, fuzzy
 msgctxt "Ethiopian month 4 - KLocale::NarrowName"
@@ -1329 +1329 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:78
+#: kcalendarsystemethiopian.cpp:76
 #, fuzzy
 msgctxt "Ethiopian month 5 - KLocale::NarrowName"
@@ -1336 +1336 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:80
+#: kcalendarsystemethiopian.cpp:78
 #, fuzzy
 msgctxt "Ethiopian month 6 - KLocale::NarrowName"
@@ -1343 +1343 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:82
+#: kcalendarsystemethiopian.cpp:80
 #, fuzzy
 msgctxt "Ethiopian month 7 - KLocale::NarrowName"
@@ -1350 +1350 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:84
+#: kcalendarsystemethiopian.cpp:82
 #, fuzzy
 msgctxt "Ethiopian month 8 - KLocale::NarrowName"
@@ -1357 +1357 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:86
+#: kcalendarsystemethiopian.cpp:84
 #, fuzzy
 msgctxt "Ethiopian month 9 - KLocale::NarrowName"
@@ -1364 +1364 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:88
+#: kcalendarsystemethiopian.cpp:86
 #, fuzzy
 msgctxt "Ethiopian month 10 - KLocale::NarrowName"
@@ -1371 +1371 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:90
+#: kcalendarsystemethiopian.cpp:88
 #, fuzzy
 msgctxt "Ethiopian month 11 - KLocale::NarrowName"
@@ -1378 +1378 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:92
+#: kcalendarsystemethiopian.cpp:90
 #, fuzzy
 msgctxt "Ethiopian month 12 - KLocale::NarrowName"
@@ -1385 +1385 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:94
+#: kcalendarsystemethiopian.cpp:92
 #, fuzzy
 #| msgid "PM"
@@ -1393 +1393 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:103
+#: kcalendarsystemethiopian.cpp:101
 #, fuzzy
 #| msgctxt "Coptic month 6 - ShortNamePossessive"
@@ -1408 +1408 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:105
+#: kcalendarsystemethiopian.cpp:103
 #, fuzzy
 #| msgctxt "Ethiopian month 2 - ShortNamePossessive"
@@ -1423 +1423 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:107
+#: kcalendarsystemethiopian.cpp:105
 #, fuzzy
 #| msgctxt "Ethiopian month 3 - ShortNamePossessive"
@@ -1438 +1438 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:109
+#: kcalendarsystemethiopian.cpp:107
 #, fuzzy
 #| msgctxt "Ethiopian month 4 - ShortNamePossessive"
@@ -1453 +1453 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:111
+#: kcalendarsystemethiopian.cpp:109
 #, fuzzy
 #| msgctxt "Ethiopian month 5 - ShortNamePossessive"
@@ -1468 +1468 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:113
+#: kcalendarsystemethiopian.cpp:111
 #, fuzzy
 #| msgctxt "Ethiopian month 6 - ShortNamePossessive"
@@ -1483 +1483 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:115
+#: kcalendarsystemethiopian.cpp:113
 #, fuzzy
 #| msgctxt "Ethiopian month 7 - ShortNamePossessive"
@@ -1498 +1498 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:117
+#: kcalendarsystemethiopian.cpp:115
 #, fuzzy
 #| msgctxt "Ethiopian month 8 - ShortNamePossessive"
@@ -1513 +1513 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:119
+#: kcalendarsystemethiopian.cpp:117
 #, fuzzy
 #| msgctxt "Ethiopian month 9 - ShortNamePossessive"
@@ -1528 +1528 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:121
+#: kcalendarsystemethiopian.cpp:119
 #, fuzzy
 #| msgctxt "Ethiopian month 10 - ShortNamePossessive"
@@ -1543 +1543 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:123
+#: kcalendarsystemethiopian.cpp:121
 #, fuzzy
 #| msgctxt "Ethiopian month 11 - ShortNamePossessive"
@@ -1558 +1558 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:125
+#: kcalendarsystemethiopian.cpp:123
 #, fuzzy
 #| msgctxt "Ethiopian month 12 - ShortNamePossessive"
@@ -1573 +1573 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:127
+#: kcalendarsystemethiopian.cpp:125
 #, fuzzy
 #| msgctxt "Ethiopian month 13 - ShortNamePossessive"
@@ -1588 +1588 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:136
+#: kcalendarsystemethiopian.cpp:134
 #, fuzzy
 #| msgctxt "Coptic month 6 - ShortName"
@@ -1603 +1603 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:138
+#: kcalendarsystemethiopian.cpp:136
 #, fuzzy
 #| msgctxt "Ethiopian month 2 - ShortName"
@@ -1618 +1618 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:140
+#: kcalendarsystemethiopian.cpp:138
 #, fuzzy
 #| msgctxt "Ethiopian month 3 - ShortName"
@@ -1633 +1633 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:142
+#: kcalendarsystemethiopian.cpp:140
 #, fuzzy
 #| msgctxt "Ethiopian month 4 - ShortName"
@@ -1648 +1648 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:144
+#: kcalendarsystemethiopian.cpp:142
 #, fuzzy
 #| msgctxt "Ethiopian month 5 - ShortName"
@@ -1663 +1663 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:146
+#: kcalendarsystemethiopian.cpp:144
 #, fuzzy
 #| msgctxt "Ethiopian month 6 - ShortName"
@@ -1678 +1678 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:148
+#: kcalendarsystemethiopian.cpp:146
 #, fuzzy
 #| msgctxt "Ethiopian month 7 - ShortName"
@@ -1693 +1693 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:150
+#: kcalendarsystemethiopian.cpp:148
 #, fuzzy
 #| msgctxt "Ethiopian month 8 - ShortName"
@@ -1708 +1708 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:152
+#: kcalendarsystemethiopian.cpp:150
 #, fuzzy
 #| msgctxt "Ethiopian month 9 - ShortName"
@@ -1723 +1723 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:154
+#: kcalendarsystemethiopian.cpp:152
 #, fuzzy
 #| msgctxt "Ethiopian month 10 - ShortName"
@@ -1738 +1738 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:156
+#: kcalendarsystemethiopian.cpp:154
 #, fuzzy
 msgctxt "Ethiopian month 11 - KLocale::ShortName"
@@ -1751 +1751 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:158
+#: kcalendarsystemethiopian.cpp:156
 #, fuzzy
 #| msgctxt "Ethiopian month 12 - ShortName"
@@ -1766 +1766 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:160
+#: kcalendarsystemethiopian.cpp:158
 #, fuzzy
 #| msgctxt "Ethiopian month 13 - ShortName"
@@ -1781 +1781 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:169
+#: kcalendarsystemethiopian.cpp:167
 #, fuzzy
 #| msgctxt "Ethiopian month 1 - LongNamePossessive"
@@ -1796 +1796 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:171
+#: kcalendarsystemethiopian.cpp:169
 #, fuzzy
 #| msgctxt "Ethiopian month 2 - LongNamePossessive"
@@ -1811 +1811 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:173
+#: kcalendarsystemethiopian.cpp:171
 #, fuzzy
 #| msgctxt "Ethiopian month 3 - LongNamePossessive"
@@ -1826 +1826 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:175
+#: kcalendarsystemethiopian.cpp:173
 #, fuzzy
 #| msgctxt "Ethiopian month 4 - LongNamePossessive"
@@ -1841 +1841 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:177
+#: kcalendarsystemethiopian.cpp:175
 #, fuzzy
 #| msgctxt "Ethiopian month 5 - ShortNamePossessive"
@@ -1856 +1856 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:179
+#: kcalendarsystemethiopian.cpp:177
 #, fuzzy
 #| msgctxt "Ethiopian month 6 - LongNamePossessive"
@@ -1871 +1871 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:181
+#: kcalendarsystemethiopian.cpp:179
 #, fuzzy
 #| msgctxt "Ethiopian month 7 - LongNamePossessive"
@@ -1886 +1886 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:183
+#: kcalendarsystemethiopian.cpp:181
 #, fuzzy
 #| msgctxt "Ethiopian month 8 - LongNamePossessive"
@@ -1901 +1901 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:185
+#: kcalendarsystemethiopian.cpp:183
 #, fuzzy
 #| msgctxt "Ethiopian month 9 - LongNamePossessive"
@@ -1916 +1916 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:187
+#: kcalendarsystemethiopian.cpp:185
 #, fuzzy
 #| msgctxt "Ethiopian month 10 - LongNamePossessive"
@@ -1931 +1931 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:189
+#: kcalendarsystemethiopian.cpp:187
 #, fuzzy
 #| msgctxt "Ethiopian month 11 - LongNamePossessive"
@@ -1946 +1946 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:191
+#: kcalendarsystemethiopian.cpp:189
 #, fuzzy
 #| msgctxt "Ethiopian month 12 - LongNamePossessive"
@@ -1961 +1961 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:193
+#: kcalendarsystemethiopian.cpp:191
 #, fuzzy
 #| msgctxt "Ethiopian month 13 - LongNamePossessive"
@@ -1976 +1976 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:202
+#: kcalendarsystemethiopian.cpp:200
 #, fuzzy
 #| msgctxt "Ethiopian month 1 - LongName"
@@ -1991 +1991 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:204
+#: kcalendarsystemethiopian.cpp:202
 #, fuzzy
 #| msgctxt "Ethiopian month 2 - LongName"
@@ -2006 +2006 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:206
+#: kcalendarsystemethiopian.cpp:204
 #, fuzzy
 #| msgctxt "Ethiopian month 3 - LongName"
@@ -2021 +2021 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:208
+#: kcalendarsystemethiopian.cpp:206
 #, fuzzy
 #| msgctxt "Ethiopian month 4 - LongName"
@@ -2036 +2036 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:210
+#: kcalendarsystemethiopian.cpp:208
 #, fuzzy
 #| msgctxt "Ethiopian month 5 - ShortName"
@@ -2051 +2051 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:212
+#: kcalendarsystemethiopian.cpp:210
 #, fuzzy
 #| msgctxt "Ethiopian month 6 - LongName"
@@ -2066 +2066 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:214
+#: kcalendarsystemethiopian.cpp:212
 #, fuzzy
 #| msgctxt "Ethiopian month 7 - LongName"
@@ -2081 +2081 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:216
+#: kcalendarsystemethiopian.cpp:214
 #, fuzzy
 #| msgctxt "Ethiopian month 8 - LongName"
@@ -2096 +2096 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:218
+#: kcalendarsystemethiopian.cpp:216
 #, fuzzy
 #| msgctxt "Ethiopian month 9 - LongName"
@@ -2111 +2111 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:220
+#: kcalendarsystemethiopian.cpp:218
 #, fuzzy
 #| msgctxt "Ethiopian month 10 - LongName"
@@ -2126 +2126 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:222
+#: kcalendarsystemethiopian.cpp:220
 #, fuzzy
 #| msgctxt "Ethiopian month 11 - LongName"
@@ -2141 +2141 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:224
+#: kcalendarsystemethiopian.cpp:222
 #, fuzzy
 #| msgctxt "Ethiopian month 12 - LongName"
@@ -2156 +2156 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:226
+#: kcalendarsystemethiopian.cpp:224
 #, fuzzy
 #| msgctxt "Ethiopian month 13 - LongName"
@@ -2171 +2171 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:238
+#: kcalendarsystemethiopian.cpp:236
 #, fuzzy
 msgctxt "Ethiopian weekday 1 - KLocale::NarrowName "
@@ -2178 +2178 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:240
+#: kcalendarsystemethiopian.cpp:238
 #, fuzzy
 msgctxt "Ethiopian weekday 2 - KLocale::NarrowName "
@@ -2185 +2185 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:242
+#: kcalendarsystemethiopian.cpp:240
 #, fuzzy
 msgctxt "Ethiopian weekday 3 - KLocale::NarrowName "
@@ -2192 +2192 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:244
+#: kcalendarsystemethiopian.cpp:242
 #, fuzzy
 msgctxt "Ethiopian weekday 4 - KLocale::NarrowName "
@@ -2199 +2199 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:246
+#: kcalendarsystemethiopian.cpp:244
 #, fuzzy
 msgctxt "Ethiopian weekday 5 - KLocale::NarrowName "
@@ -2206 +2206 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:248
+#: kcalendarsystemethiopian.cpp:246
 #, fuzzy
 msgctxt "Ethiopian weekday 6 - KLocale::NarrowName "
@@ -2213 +2213 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:250
+#: kcalendarsystemethiopian.cpp:248
 #, fuzzy
 msgctxt "Ethiopian weekday 7 - KLocale::NarrowName "
@@ -2220 +2220 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:259
+#: kcalendarsystemethiopian.cpp:257
 #, fuzzy
 #| msgctxt "Ethiopian weekday 1 - ShortDayName"
@@ -2235 +2235 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:261
+#: kcalendarsystemethiopian.cpp:259
 #, fuzzy
 #| msgctxt "Ethiopian weekday 2 - ShortDayName"
@@ -2250 +2250 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:263
+#: kcalendarsystemethiopian.cpp:261
 #, fuzzy
 #| msgctxt "Ethiopian weekday 3 - ShortDayName"
@@ -2265 +2265 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:265
+#: kcalendarsystemethiopian.cpp:263
 #, fuzzy
 msgctxt "Ethiopian weekday 4 - KLocale::ShortName"
@@ -2278 +2278 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:267
+#: kcalendarsystemethiopian.cpp:265
 #, fuzzy
 #| msgid "Arb"
@@ -2292 +2292 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:269
+#: kcalendarsystemethiopian.cpp:267
 #, fuzzy
 #| msgctxt "Ethiopian weekday 6 - ShortDayName"
@@ -2307 +2307 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:271
+#: kcalendarsystemethiopian.cpp:269
 #, fuzzy
 #| msgctxt "Ethiopian weekday 7 - ShortDayName"
@@ -2322 +2322 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:278
+#: kcalendarsystemethiopian.cpp:276
 #, fuzzy
 #| msgctxt "Ethiopian weekday 1 - LongDayName"
@@ -2337 +2337 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:280
+#: kcalendarsystemethiopian.cpp:278
 #, fuzzy
 #| msgctxt "Ethiopian weekday 2 - LongDayName"
@@ -2352 +2352 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:282
+#: kcalendarsystemethiopian.cpp:280
 #, fuzzy
 #| msgctxt "Ethiopian weekday 3 - ShortDayName"
@@ -2367 +2367 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:284
+#: kcalendarsystemethiopian.cpp:282
 #, fuzzy
 #| msgctxt "Ethiopian weekday 4 - LongDayName"
@@ -2382 +2382 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:286
+#: kcalendarsystemethiopian.cpp:284
 #, fuzzy
 #| msgid "Arb"
@@ -2396 +2396 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:288
+#: kcalendarsystemethiopian.cpp:286
 #, fuzzy
 #| msgctxt "Ethiopian weekday 6 - LongDayName"
@@ -2411 +2411 @@
 
 #. +> trunk
-#: kcalendarsystemethiopian.cpp:290
+#: kcalendarsystemethiopian.cpp:288
 #, fuzzy
 #| msgctxt "Ethiopian weekday 7 - LongDayName"
@@ -2426 +2426 @@
 
 #. +> trunk stable
-#: kcalendarsystemgregorian.cpp:90 kcalendarsystemgregorianproleptic.cpp:60
+#: kcalendarsystemgregorian.cpp:60 kcalendarsystemqdate.cpp:90
 msgctxt "Calendar Era: Gregorian Common Era, years < 0, LongFormat"
 msgid "Before Common Era"
@@ -2432 +2432 @@
 
 #. +> trunk stable
-#: kcalendarsystemgregorian.cpp:91 kcalendarsystemgregorianproleptic.cpp:61
+#: kcalendarsystemgregorian.cpp:61 kcalendarsystemqdate.cpp:91
 msgctxt "Calendar Era: Gregorian Common Era, years < 0, ShortFormat"
 msgid "BCE"
@@ -2438 +2438 @@
 
 #. +> trunk stable
-#: kcalendarsystemgregorian.cpp:93 kcalendarsystemgregorianproleptic.cpp:63
+#: kcalendarsystemgregorian.cpp:63 kcalendarsystemqdate.cpp:93
 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, LongFormat"
 msgid "Before Christ"
@@ -2444 +2444 @@
 
 #. +> trunk stable
-#: kcalendarsystemgregorian.cpp:94 kcalendarsystemgregorianproleptic.cpp:64
+#: kcalendarsystemgregorian.cpp:64 kcalendarsystemqdate.cpp:94
 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, ShortFormat"
 msgid "BC"
@@ -2450 +2450 @@
 
 #. +> trunk stable
-#: kcalendarsystemgregorian.cpp:96 kcalendarsystemgregorianproleptic.cpp:66
+#: kcalendarsystemgregorian.cpp:66 kcalendarsystemqdate.cpp:96
 #, c-format
 msgctxt "(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC"
@@ -2457 +2457 @@
 
 #. +> trunk stable
-#: kcalendarsystemgregorian.cpp:100 kcalendarsystemgregorianproleptic.cpp:70
+#: kcalendarsystemgregorian.cpp:70 kcalendarsystemqdate.cpp:100
 msgctxt "Calendar Era: Gregorian Common Era, years > 0, LongFormat"
 msgid "Common Era"
@@ -2463 +2463 @@
 
 #. +> trunk stable
-#: kcalendarsystemgregorian.cpp:101 kcalendarsystemgregorianproleptic.cpp:71
+#: kcalendarsystemgregorian.cpp:71 kcalendarsystemqdate.cpp:101
 msgctxt "Calendar Era: Gregorian Common Era, years > 0, ShortFormat"
 msgid "CE"
@@ -2469 +2469 @@
 
 #. +> trunk stable
-#: kcalendarsystemgregorian.cpp:103 kcalendarsystemgregorianproleptic.cpp:73
-#: kcalendarsystemjapanese.cpp:63
+#: kcalendarsystemgregorian.cpp:73 kcalendarsystemjapanese.cpp:63
+#: kcalendarsystemqdate.cpp:103
 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, LongFormat"
 msgid "Anno Domini"
@@ -2476 +2476 @@
 
 #. +> trunk stable
-#: kcalendarsystemgregorian.cpp:104 kcalendarsystemgregorianproleptic.cpp:74
-#: kcalendarsystemjapanese.cpp:64
+#: kcalendarsystemgregorian.cpp:74 kcalendarsystemjapanese.cpp:64
+#: kcalendarsystemqdate.cpp:104
 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, ShortFormat"
 msgid "AD"
@@ -2483 +2483 @@
 
 #. +> trunk stable
-#: kcalendarsystemgregorian.cpp:106 kcalendarsystemgregorianproleptic.cpp:76
-#: kcalendarsystemjapanese.cpp:65
+#: kcalendarsystemgregorian.cpp:76 kcalendarsystemjapanese.cpp:65
+#: kcalendarsystemqdate.cpp:106
 #, c-format
 msgctxt "(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD"
@@ -2491 +2491 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:175 kcalendarsystemgregorianproleptic.cpp:171
+#: kcalendarsystemgregorian.cpp:171 kcalendarsystemqdate.cpp:175
 #, fuzzy
 msgctxt "Gregorian month 1 - KLocale::NarrowName"
@@ -2498 +2498 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:177 kcalendarsystemgregorianproleptic.cpp:173
+#: kcalendarsystemgregorian.cpp:173 kcalendarsystemqdate.cpp:177
 #, fuzzy
 msgctxt "Gregorian month 2 - KLocale::NarrowName"
@@ -2505 +2505 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:179 kcalendarsystemgregorianproleptic.cpp:175
+#: kcalendarsystemgregorian.cpp:175 kcalendarsystemqdate.cpp:179
 #, fuzzy
 msgctxt "Gregorian month 3 - KLocale::NarrowName"
@@ -2512 +2512 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:181 kcalendarsystemgregorianproleptic.cpp:177
+#: kcalendarsystemgregorian.cpp:177 kcalendarsystemqdate.cpp:181
 #, fuzzy
 msgctxt "Gregorian month 4 - KLocale::NarrowName"
@@ -2519 +2519 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:183 kcalendarsystemgregorianproleptic.cpp:179
+#: kcalendarsystemgregorian.cpp:179 kcalendarsystemqdate.cpp:183
 #, fuzzy
 msgctxt "Gregorian month 5 - KLocale::NarrowName"
@@ -2526 +2526 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:185 kcalendarsystemgregorianproleptic.cpp:181
+#: kcalendarsystemgregorian.cpp:181 kcalendarsystemqdate.cpp:185
 #, fuzzy
 msgctxt "Gregorian month 6 - KLocale::NarrowName"
@@ -2533 +2533 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:187 kcalendarsystemgregorianproleptic.cpp:183
+#: kcalendarsystemgregorian.cpp:183 kcalendarsystemqdate.cpp:187
 #, fuzzy
 msgctxt "Gregorian month 7 - KLocale::NarrowName"
@@ -2540 +2540 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:189 kcalendarsystemgregorianproleptic.cpp:185
+#: kcalendarsystemgregorian.cpp:185 kcalendarsystemqdate.cpp:189
 #, fuzzy
 msgctxt "Gregorian month 8 - KLocale::NarrowName"
@@ -2547 +2547 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:191 kcalendarsystemgregorianproleptic.cpp:187
+#: kcalendarsystemgregorian.cpp:187 kcalendarsystemqdate.cpp:191
 #, fuzzy
 msgctxt "Gregorian month 9 - KLocale::NarrowName"
@@ -2554 +2554 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:193 kcalendarsystemgregorianproleptic.cpp:189
+#: kcalendarsystemgregorian.cpp:189 kcalendarsystemqdate.cpp:193
 #, fuzzy
 msgctxt "Gregorian month 10 - KLocale::NarrowName"
@@ -2561 +2561 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:195 kcalendarsystemgregorianproleptic.cpp:191
+#: kcalendarsystemgregorian.cpp:191 kcalendarsystemqdate.cpp:195
 #, fuzzy
 msgctxt "Gregorian month 11 - KLocale::NarrowName"
@@ -2568 +2568 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:197 kcalendarsystemgregorianproleptic.cpp:193
+#: kcalendarsystemgregorian.cpp:193 kcalendarsystemqdate.cpp:197
 #, fuzzy
 msgctxt "Gregorian month 12 - KLocale::NarrowName"
@@ -2575 +2575 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:206 kcalendarsystemgregorianproleptic.cpp:202
+#: kcalendarsystemgregorian.cpp:202 kcalendarsystemqdate.cpp:206
 #, fuzzy
 #| msgctxt "of January"
@@ -2591 +2591 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:208 kcalendarsystemgregorianproleptic.cpp:204
+#: kcalendarsystemgregorian.cpp:204 kcalendarsystemqdate.cpp:208
 #, fuzzy
 #| msgctxt "of February"
@@ -2607 +2607 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:210 kcalendarsystemgregorianproleptic.cpp:206
+#: kcalendarsystemgregorian.cpp:206 kcalendarsystemqdate.cpp:210
 #, fuzzy
 #| msgctxt "of March"
@@ -2623 +2623 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:212 kcalendarsystemgregorianproleptic.cpp:208
+#: kcalendarsystemgregorian.cpp:208 kcalendarsystemqdate.cpp:212
 #, fuzzy
 #| msgctxt "of April"
@@ -2639 +2639 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:214 kcalendarsystemgregorianproleptic.cpp:210
+#: kcalendarsystemgregorian.cpp:210 kcalendarsystemqdate.cpp:214
 #, fuzzy
 #| msgctxt "of May short"
@@ -2648 +2648 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:216 kcalendarsystemgregorianproleptic.cpp:212
+#: kcalendarsystemgregorian.cpp:212 kcalendarsystemqdate.cpp:216
 #, fuzzy
 #| msgctxt "of June"
@@ -2664 +2664 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:218 kcalendarsystemgregorianproleptic.cpp:214
+#: kcalendarsystemgregorian.cpp:214 kcalendarsystemqdate.cpp:218
 #, fuzzy
 #| msgctxt "of July"
@@ -2680 +2680 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:220 kcalendarsystemgregorianproleptic.cpp:216
+#: kcalendarsystemgregorian.cpp:216 kcalendarsystemqdate.cpp:220
 #, fuzzy
 #| msgctxt "of August"
@@ -2696 +2696 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:222 kcalendarsystemgregorianproleptic.cpp:218
+#: kcalendarsystemgregorian.cpp:218 kcalendarsystemqdate.cpp:222
 #, fuzzy
 #| msgctxt "of September"
@@ -2712 +2712 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:224 kcalendarsystemgregorianproleptic.cpp:220
+#: kcalendarsystemgregorian.cpp:220 kcalendarsystemqdate.cpp:224
 #, fuzzy
 #| msgctxt "of October"
@@ -2728 +2728 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:226 kcalendarsystemgregorianproleptic.cpp:222
+#: kcalendarsystemgregorian.cpp:222 kcalendarsystemqdate.cpp:226
 #, fuzzy
 #| msgctxt "of November"
@@ -2744 +2744 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:228 kcalendarsystemgregorianproleptic.cpp:224
+#: kcalendarsystemgregorian.cpp:224 kcalendarsystemqdate.cpp:228
 #, fuzzy
 #| msgctxt "of December"
@@ -2760 +2760 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:237 kcalendarsystemgregorianproleptic.cpp:233
+#: kcalendarsystemgregorian.cpp:233 kcalendarsystemqdate.cpp:237
 #, fuzzy
 msgctxt "Gregorian month 1 - KLocale::ShortName"
@@ -2774 +2774 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:239 kcalendarsystemgregorianproleptic.cpp:235
+#: kcalendarsystemgregorian.cpp:235 kcalendarsystemqdate.cpp:239
 #, fuzzy
 msgctxt "Gregorian month 2 - KLocale::ShortName"
@@ -2788 +2788 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:241 kcalendarsystemgregorianproleptic.cpp:237
+#: kcalendarsystemgregorian.cpp:237 kcalendarsystemqdate.cpp:241
 #, fuzzy
 msgctxt "Gregorian month 3 - KLocale::ShortName"
@@ -2802 +2802 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:243 kcalendarsystemgregorianproleptic.cpp:239
+#: kcalendarsystemgregorian.cpp:239 kcalendarsystemqdate.cpp:243
 #, fuzzy
 msgctxt "Gregorian month 4 - KLocale::ShortName"
@@ -2816 +2816 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:245 kcalendarsystemgregorianproleptic.cpp:241
+#: kcalendarsystemgregorian.cpp:241 kcalendarsystemqdate.cpp:245
 #, fuzzy
 msgctxt "Gregorian month 5 - KLocale::ShortName"
@@ -2823 +2823 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:247 kcalendarsystemgregorianproleptic.cpp:243
+#: kcalendarsystemgregorian.cpp:243 kcalendarsystemqdate.cpp:247
 #, fuzzy
 msgctxt "Gregorian month 6 - KLocale::ShortName"
@@ -2837 +2837 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:249 kcalendarsystemgregorianproleptic.cpp:245
+#: kcalendarsystemgregorian.cpp:245 kcalendarsystemqdate.cpp:249
 #, fuzzy
 msgctxt "Gregorian month 7 - KLocale::ShortName"
@@ -2851 +2851 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:251 kcalendarsystemgregorianproleptic.cpp:247
+#: kcalendarsystemgregorian.cpp:247 kcalendarsystemqdate.cpp:251
 #, fuzzy
 msgctxt "Gregorian month 8 - KLocale::ShortName"
@@ -2865 +2865 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:253 kcalendarsystemgregorianproleptic.cpp:249
+#: kcalendarsystemgregorian.cpp:249 kcalendarsystemqdate.cpp:253
 #, fuzzy
 msgctxt "Gregorian month 9 - KLocale::ShortName"
@@ -2879 +2879 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:255 kcalendarsystemgregorianproleptic.cpp:251
+#: kcalendarsystemgregorian.cpp:251 kcalendarsystemqdate.cpp:255
 #, fuzzy
 msgctxt "Gregorian month 10 - KLocale::ShortName"
@@ -2893 +2893 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:257 kcalendarsystemgregorianproleptic.cpp:253
+#: kcalendarsystemgregorian.cpp:253 kcalendarsystemqdate.cpp:257
 #, fuzzy
 msgctxt "Gregorian month 11 - KLocale::ShortName"
@@ -2907 +2907 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:259 kcalendarsystemgregorianproleptic.cpp:255
+#: kcalendarsystemgregorian.cpp:255 kcalendarsystemqdate.cpp:259
 #, fuzzy
 msgctxt "Gregorian month 12 - KLocale::ShortName"
@@ -2921 +2921 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:268 kcalendarsystemgregorianproleptic.cpp:264
+#: kcalendarsystemgregorian.cpp:264 kcalendarsystemqdate.cpp:268
 #, fuzzy
 #| msgid "of January"
@@ -2935 +2935 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:270 kcalendarsystemgregorianproleptic.cpp:266
+#: kcalendarsystemgregorian.cpp:266 kcalendarsystemqdate.cpp:270
 #, fuzzy
 #| msgid "of February"
@@ -2949 +2949 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:272 kcalendarsystemgregorianproleptic.cpp:268
+#: kcalendarsystemgregorian.cpp:268 kcalendarsystemqdate.cpp:272
 #, fuzzy
 #| msgid "of March"
@@ -2963 +2963 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:274 kcalendarsystemgregorianproleptic.cpp:270
+#: kcalendarsystemgregorian.cpp:270 kcalendarsystemqdate.cpp:274
 #, fuzzy
 #| msgid "of April"
@@ -2977 +2977 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:276 kcalendarsystemgregorianproleptic.cpp:272
+#: kcalendarsystemgregorian.cpp:272 kcalendarsystemqdate.cpp:276
 #, fuzzy
 #| msgctxt "of May short"
@@ -3000 +3000 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:278 kcalendarsystemgregorianproleptic.cpp:274
+#: kcalendarsystemgregorian.cpp:274 kcalendarsystemqdate.cpp:278
 #, fuzzy
 #| msgid "of June"
@@ -3014 +3014 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:280 kcalendarsystemgregorianproleptic.cpp:276
+#: kcalendarsystemgregorian.cpp:276 kcalendarsystemqdate.cpp:280
 #, fuzzy
 #| msgid "of July"
@@ -3028 +3028 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:282 kcalendarsystemgregorianproleptic.cpp:278
+#: kcalendarsystemgregorian.cpp:278 kcalendarsystemqdate.cpp:282
 #, fuzzy
 #| msgid "of August"
@@ -3042 +3042 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:284 kcalendarsystemgregorianproleptic.cpp:280
+#: kcalendarsystemgregorian.cpp:280 kcalendarsystemqdate.cpp:284
 #, fuzzy
 #| msgid "of September"
@@ -3056 +3056 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:286 kcalendarsystemgregorianproleptic.cpp:282
+#: kcalendarsystemgregorian.cpp:282 kcalendarsystemqdate.cpp:286
 #, fuzzy
 #| msgid "of October"
@@ -3070 +3070 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:288 kcalendarsystemgregorianproleptic.cpp:284
+#: kcalendarsystemgregorian.cpp:284 kcalendarsystemqdate.cpp:288
 #, fuzzy
 #| msgid "of November"
@@ -3084 +3084 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:290 kcalendarsystemgregorianproleptic.cpp:286
+#: kcalendarsystemgregorian.cpp:286 kcalendarsystemqdate.cpp:290
 #, fuzzy
 #| msgid "of December"
@@ -3098 +3098 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:299 kcalendarsystemgregorianproleptic.cpp:295
+#: kcalendarsystemgregorian.cpp:295 kcalendarsystemqdate.cpp:299
 #, fuzzy
 #| msgid "January"
@@ -3112 +3112 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:301 kcalendarsystemgregorianproleptic.cpp:297
+#: kcalendarsystemgregorian.cpp:297 kcalendarsystemqdate.cpp:301
 #, fuzzy
 #| msgid "February"
@@ -3126 +3126 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:303 kcalendarsystemgregorianproleptic.cpp:299
+#: kcalendarsystemgregorian.cpp:299 kcalendarsystemqdate.cpp:303
 #, fuzzy
 msgctxt "Gregorian month 3 - KLocale::LongName"
@@ -3140 +3140 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:305 kcalendarsystemgregorianproleptic.cpp:301
+#: kcalendarsystemgregorian.cpp:301 kcalendarsystemqdate.cpp:305
 #, fuzzy
 #| msgid "April"
@@ -3154 +3154 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:307 kcalendarsystemgregorianproleptic.cpp:303
+#: kcalendarsystemgregorian.cpp:303 kcalendarsystemqdate.cpp:307
 #, fuzzy
 msgctxt "Gregorian month 5 - KLocale::LongName"
@@ -3175 +3175 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:309 kcalendarsystemgregorianproleptic.cpp:305
+#: kcalendarsystemgregorian.cpp:305 kcalendarsystemqdate.cpp:309
 #, fuzzy
 #| msgid "June"
@@ -3189 +3189 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:311 kcalendarsystemgregorianproleptic.cpp:307
+#: kcalendarsystemgregorian.cpp:307 kcalendarsystemqdate.cpp:311
 #, fuzzy
 #| msgid "July"
@@ -3203 +3203 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:313 kcalendarsystemgregorianproleptic.cpp:309
+#: kcalendarsystemgregorian.cpp:309 kcalendarsystemqdate.cpp:313
 #, fuzzy
 msgctxt "Gregorian month 8 - KLocale::LongName"
@@ -3217 +3217 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:315 kcalendarsystemgregorianproleptic.cpp:311
+#: kcalendarsystemgregorian.cpp:311 kcalendarsystemqdate.cpp:315
 #, fuzzy
 #| msgid "September"
@@ -3231 +3231 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:317 kcalendarsystemgregorianproleptic.cpp:313
+#: kcalendarsystemgregorian.cpp:313 kcalendarsystemqdate.cpp:317
 #, fuzzy
 #| msgid "October"
@@ -3245 +3245 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:319 kcalendarsystemgregorianproleptic.cpp:315
+#: kcalendarsystemgregorian.cpp:315 kcalendarsystemqdate.cpp:319
 #, fuzzy
 #| msgid "November"
@@ -3259 +3259 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:321 kcalendarsystemgregorianproleptic.cpp:317
+#: kcalendarsystemgregorian.cpp:317 kcalendarsystemqdate.cpp:321
 #, fuzzy
 #| msgid "December"
@@ -3273 +3273 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:332 kcalendarsystemgregorianproleptic.cpp:328
-#: kcalendarsystemhebrew.cpp:820
+#: kcalendarsystemgregorian.cpp:328 kcalendarsystemhebrew.cpp:820
+#: kcalendarsystemqdate.cpp:332
 #, fuzzy
 msgctxt "Gregorian weekday 1 - KLocale::NarrowName "
@@ -3281 +3281 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:334 kcalendarsystemgregorianproleptic.cpp:330
-#: kcalendarsystemhebrew.cpp:822
+#: kcalendarsystemgregorian.cpp:330 kcalendarsystemhebrew.cpp:822
+#: kcalendarsystemqdate.cpp:334
 #, fuzzy
 msgctxt "Gregorian weekday 2 - KLocale::NarrowName "
@@ -3289 +3289 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:336 kcalendarsystemgregorianproleptic.cpp:332
-#: kcalendarsystemhebrew.cpp:824
+#: kcalendarsystemgregorian.cpp:332 kcalendarsystemhebrew.cpp:824
+#: kcalendarsystemqdate.cpp:336
 #, fuzzy
 msgctxt "Gregorian weekday 3 - KLocale::NarrowName "
@@ -3297 +3297 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:338 kcalendarsystemgregorianproleptic.cpp:334
-#: kcalendarsystemhebrew.cpp:826
+#: kcalendarsystemgregorian.cpp:334 kcalendarsystemhebrew.cpp:826
+#: kcalendarsystemqdate.cpp:338
 #, fuzzy
 msgctxt "Gregorian weekday 4 - KLocale::NarrowName "
@@ -3305 +3305 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:340 kcalendarsystemgregorianproleptic.cpp:336
-#: kcalendarsystemhebrew.cpp:828
+#: kcalendarsystemgregorian.cpp:336 kcalendarsystemhebrew.cpp:828
+#: kcalendarsystemqdate.cpp:340
 #, fuzzy
 msgctxt "Gregorian weekday 5 - KLocale::NarrowName "
@@ -3313 +3313 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:342 kcalendarsystemgregorianproleptic.cpp:338
-#: kcalendarsystemhebrew.cpp:830
+#: kcalendarsystemgregorian.cpp:338 kcalendarsystemhebrew.cpp:830
+#: kcalendarsystemqdate.cpp:342
 #, fuzzy
 msgctxt "Gregorian weekday 6 - KLocale::NarrowName "
@@ -3321 +3321 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:344 kcalendarsystemgregorianproleptic.cpp:340
-#: kcalendarsystemhebrew.cpp:832
+#: kcalendarsystemgregorian.cpp:340 kcalendarsystemhebrew.cpp:832
+#: kcalendarsystemqdate.cpp:344
 #, fuzzy
 msgctxt "Gregorian weekday 7 - KLocale::NarrowName "
@@ -3329 +3329 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:353 kcalendarsystemgregorianproleptic.cpp:349
-#: kcalendarsystemhebrew.cpp:841
+#: kcalendarsystemgregorian.cpp:349 kcalendarsystemhebrew.cpp:841
+#: kcalendarsystemqdate.cpp:353
 #, fuzzy
 msgctxt "Gregorian weekday 1 - KLocale::ShortName"
@@ -3344 +3344 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:355 kcalendarsystemgregorianproleptic.cpp:351
-#: kcalendarsystemhebrew.cpp:843
+#: kcalendarsystemgregorian.cpp:351 kcalendarsystemhebrew.cpp:843
+#: kcalendarsystemqdate.cpp:355
 #, fuzzy
 msgctxt "Gregorian weekday 2 - KLocale::ShortName"
@@ -3359 +3359 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:357 kcalendarsystemgregorianproleptic.cpp:353
-#: kcalendarsystemhebrew.cpp:845
+#: kcalendarsystemgregorian.cpp:353 kcalendarsystemhebrew.cpp:845
+#: kcalendarsystemqdate.cpp:357
 #, fuzzy
 msgctxt "Gregorian weekday 3 - KLocale::ShortName"
@@ -3374 +3374 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:359 kcalendarsystemgregorianproleptic.cpp:355
-#: kcalendarsystemhebrew.cpp:847
+#: kcalendarsystemgregorian.cpp:355 kcalendarsystemhebrew.cpp:847
+#: kcalendarsystemqdate.cpp:359
 #, fuzzy
 msgctxt "Gregorian weekday 4 - KLocale::ShortName"
@@ -3389 +3389 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:361 kcalendarsystemgregorianproleptic.cpp:357
-#: kcalendarsystemhebrew.cpp:849
+#: kcalendarsystemgregorian.cpp:357 kcalendarsystemhebrew.cpp:849
+#: kcalendarsystemqdate.cpp:361
 #, fuzzy
 msgctxt "Gregorian weekday 5 - KLocale::ShortName"
@@ -3404 +3404 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:363 kcalendarsystemgregorianproleptic.cpp:359
-#: kcalendarsystemhebrew.cpp:851
+#: kcalendarsystemgregorian.cpp:359 kcalendarsystemhebrew.cpp:851
+#: kcalendarsystemqdate.cpp:363
 #, fuzzy
 msgctxt "Gregorian weekday 6 - KLocale::ShortName"
@@ -3419 +3419 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:365 kcalendarsystemgregorianproleptic.cpp:361
-#: kcalendarsystemhebrew.cpp:853
+#: kcalendarsystemgregorian.cpp:361 kcalendarsystemhebrew.cpp:853
+#: kcalendarsystemqdate.cpp:365
 #, fuzzy
 msgctxt "Gregorian weekday 7 - KLocale::ShortName"
@@ -3434 +3434 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:372 kcalendarsystemgregorianproleptic.cpp:368
-#: kcalendarsystemhebrew.cpp:860
+#: kcalendarsystemgregorian.cpp:368 kcalendarsystemhebrew.cpp:860
+#: kcalendarsystemqdate.cpp:372
 #, fuzzy
 #| msgid "Monday"
@@ -3449 +3449 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:374 kcalendarsystemgregorianproleptic.cpp:370
-#: kcalendarsystemhebrew.cpp:862
+#: kcalendarsystemgregorian.cpp:370 kcalendarsystemhebrew.cpp:862
+#: kcalendarsystemqdate.cpp:374
 #, fuzzy
 #| msgid "Tuesday"
@@ -3464 +3464 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:376 kcalendarsystemgregorianproleptic.cpp:372
-#: kcalendarsystemhebrew.cpp:864
+#: kcalendarsystemgregorian.cpp:372 kcalendarsystemhebrew.cpp:864
+#: kcalendarsystemqdate.cpp:376
 #, fuzzy
 #| msgid "Wednesday"
@@ -3479 +3479 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:378 kcalendarsystemgregorianproleptic.cpp:374
-#: kcalendarsystemhebrew.cpp:866
+#: kcalendarsystemgregorian.cpp:374 kcalendarsystemhebrew.cpp:866
+#: kcalendarsystemqdate.cpp:378
 #, fuzzy
 #| msgid "Thursday"
@@ -3494 +3494 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:380 kcalendarsystemgregorianproleptic.cpp:376
-#: kcalendarsystemhebrew.cpp:868
+#: kcalendarsystemgregorian.cpp:376 kcalendarsystemhebrew.cpp:868
+#: kcalendarsystemqdate.cpp:380
 #, fuzzy
 #| msgid "Friday"
@@ -3509 +3509 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:382 kcalendarsystemgregorianproleptic.cpp:378
-#: kcalendarsystemhebrew.cpp:870
+#: kcalendarsystemgregorian.cpp:378 kcalendarsystemhebrew.cpp:870
+#: kcalendarsystemqdate.cpp:382
 #, fuzzy
 #| msgid "Saturday"
@@ -3524 +3524 @@
 
 #. +> trunk
-#: kcalendarsystemgregorian.cpp:384 kcalendarsystemgregorianproleptic.cpp:380
-#: kcalendarsystemhebrew.cpp:872
+#: kcalendarsystemgregorian.cpp:380 kcalendarsystemhebrew.cpp:872
+#: kcalendarsystemqdate.cpp:384
 #, fuzzy
 #| msgid "Sunday"
@@ -4242 +4242 @@
 
 #. +> trunk stable
-#: kcalendarsystemhijri.cpp:72
-msgctxt "Calendar Era: Hijri Islamic Era, years > 0, LongFormat"
-msgid "Anno Hegirae"
-msgstr "Anno Hegirae"
-
-#. +> trunk stable
-#: kcalendarsystemhijri.cpp:73
-msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat"
-msgid "AH"
-msgstr "AH"
-
-#. +> trunk stable
-#: kcalendarsystemhijri.cpp:74
-#, c-format
-msgctxt "(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH"
-msgid "%Ey %EC"
-msgstr "%Ey %EC"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:180
-#, fuzzy
-msgctxt "Hijri month 1 - KLocale::NarrowName"
-msgid "M"
-msgstr "AM"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:182
-#, fuzzy
-msgctxt "Hijri month 2 - KLocale::NarrowName"
-msgid "S"
-msgstr "S"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:184
-#, fuzzy
-msgctxt "Hijri month 3 - KLocale::NarrowName"
-msgid "A"
-msgstr "A"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:186
-#, fuzzy
-msgctxt "Hijri month 4 - KLocale::NarrowName"
-msgid "T"
-msgstr "TGA"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:188
-#, fuzzy
-msgctxt "Hijri month 5 - KLocale::NarrowName"
-msgid "A"
-msgstr "A"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:190
-#, fuzzy
-msgctxt "Hijri month 6 - KLocale::NarrowName"
-msgid "T"
-msgstr "TGA"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:192
-#, fuzzy
-msgctxt "Hijri month 7 - KLocale::NarrowName"
-msgid "R"
-msgstr "R"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:194
-#, fuzzy
-msgctxt "Hijri month 8 - KLocale::NarrowName"
-msgid "S"
-msgstr "S"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:196
-#, fuzzy
-msgctxt "Hijri month 9 - KLocale::NarrowName"
-msgid "R"
-msgstr "R"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:198
-#, fuzzy
-msgctxt "Hijri month 10 - KLocale::NarrowName"
-msgid "S"
-msgstr "S"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:200
-#, fuzzy
-msgctxt "Hijri month 11 - KLocale::NarrowName"
-msgid "Q"
-msgstr "Kv"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:202
-#, fuzzy
-msgctxt "Hijri month 12 - KLocale::NarrowName"
-msgid "H"
-msgstr "H:"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:211
-#, fuzzy
-#| msgctxt "of Mehr short"
-#| msgid "of Meh"
-msgctxt "Hijri month 1 - KLocale::ShortName Possessive"
-msgid "of Muh"
-msgstr "od Meh"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:213
-#, fuzzy
-#| msgid "of Safar"
-msgctxt "Hijri month 2 - KLocale::ShortName Possessive"
-msgid "of Saf"
-msgstr "od Safara"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:215
-#, fuzzy
-#| msgid "of R. Awal"
-msgctxt "Hijri month 3 - KLocale::ShortName Possessive"
-msgid "of R.A"
-msgstr "od R. Awala"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:217
-#, fuzzy
-#| msgid "of R. Thaani"
-msgctxt "Hijri month 4 - KLocale::ShortName Possessive"
-msgid "of R.T"
-msgstr "od R. Thaania"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:219
-#, fuzzy
-#| msgid "of J. Awal"
-msgctxt "Hijri month 5 - KLocale::ShortName Possessive"
-msgid "of J.A"
-msgstr "od J. Awala"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:221
-#, fuzzy
-#| msgid "of J. Thaani"
-msgctxt "Hijri month 6 - KLocale::ShortName Possessive"
-msgid "of J.T"
-msgstr "od J. Thaania"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:223
-#, fuzzy
-#| msgid "of Rajab"
-msgctxt "Hijri month 7 - KLocale::ShortName Possessive"
-msgid "of Raj"
-msgstr "od Rajaba"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:225
-#, fuzzy
-#| msgctxt "of Shahrivar short"
-#| msgid "of Sha"
-msgctxt "Hijri month 8 - KLocale::ShortName Possessive"
-msgid "of Sha"
-msgstr "od Sha"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:227
-#, fuzzy
-#| msgctxt "Coptic month 8 - ShortNamePossessive"
-#| msgid "of Pam"
-msgctxt "Hijri month 9 - KLocale::ShortName Possessive"
-msgid "of Ram"
-msgstr "od Pam"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:229
-#, fuzzy
-#| msgctxt "Indian National month 5 - ShortNamePossessive"
-#| msgid "of Shr"
-msgctxt "Hijri month 10 - KLocale::ShortName Possessive"
-msgid "of Shw"
-msgstr "od Shr"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:231
-#, fuzzy
-#| msgid "of Qi`dah"
-msgctxt "Hijri month 11 - KLocale::ShortName Possessive"
-msgid "of Qid"
-msgstr "od Qi`daha"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:233
-#, fuzzy
-#| msgid "of Hijjah"
-msgctxt "Hijri month 12 - KLocale::ShortName Possessive"
-msgid "of Hij"
-msgstr "od Hijjaha"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:242
-#, fuzzy
-#| msgctxt "City name (optional, probably does not need a translation)"
-#| msgid "Muncy"
-msgctxt "Hijri month 1 - KLocale::ShortName"
-msgid "Muh"
-msgstr "Muncy"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:244
-#, fuzzy
-#| msgid "Safar"
-msgctxt "Hijri month 2 - KLocale::ShortName"
-msgid "Saf"
-msgstr "Safar"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:246
-#, fuzzy
-msgctxt "Hijri month 3 - KLocale::ShortName"
-msgid "R.A"
-msgstr "DU"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:248
-#, fuzzy
-msgctxt "Hijri month 4 - KLocale::ShortName"
-msgid "R.T"
-msgstr "RT"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:250
-#, fuzzy
-msgctxt "Hijri month 5 - KLocale::ShortName"
-msgid "J.A"
-msgstr "Mlađi"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:252
-#, fuzzy
-msgctxt "Hijri month 6 - KLocale::ShortName"
-msgid "J.T"
-msgstr "Mlađi"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:254
-#, fuzzy
-#| msgid "Rajab"
-msgctxt "Hijri month 7 - KLocale::ShortName"
-msgid "Raj"
-msgstr "Rajab"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:256
-#, fuzzy
-#| msgctxt "Shahrivar short"
-#| msgid "Sha"
-msgctxt "Hijri month 8 - KLocale::ShortName"
-msgid "Sha"
-msgstr "Sha"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:258
-#, fuzzy
-msgctxt "Hijri month 9 - KLocale::ShortName"
-msgid "Ram"
-msgstr "Rampa"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:260
-#, fuzzy
-msgctxt "Hijri month 10 - KLocale::ShortName"
-msgid "Shw"
-msgstr "PrikaÅŸi"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:262
-#, fuzzy
-#| msgid "Qi`dah"
-msgctxt "Hijri month 11 - KLocale::ShortName"
-msgid "Qid"
-msgstr "Qi`dah"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:264
-#, fuzzy
-#| msgctxt "@item Calendar system"
-#| msgid "Hijri"
-msgctxt "Hijri month 12 - KLocale::ShortName"
-msgid "Hij"
-msgstr "Hijri"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:273
-#, fuzzy
-#| msgid "of Muharram"
-msgctxt "Hijri month 1 - KLocale::LongName Possessive"
-msgid "of Muharram"
-msgstr "od Muharrama"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:335 kcalendarsystemhijri.cpp:366
-msgid "of Muharram"
-msgstr "od Muharrama"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:275
-#, fuzzy
-#| msgid "of Safar"
-msgctxt "Hijri month 2 - KLocale::LongName Possessive"
-msgid "of Safar"
-msgstr "od Safara"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:337 kcalendarsystemhijri.cpp:368
-msgid "of Safar"
-msgstr "od Safara"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:277
-#, fuzzy
-#| msgid "of Rabi` al-Awal"
-msgctxt "Hijri month 3 - KLocale::LongName Possessive"
-msgid "of Rabi` al-Awal"
-msgstr "od Rabi` al-Awala"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:370
-msgid "of Rabi` al-Awal"
-msgstr "od Rabi` al-Awala"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:279
-#, fuzzy
-#| msgid "of Rabi` al-Thaani"
-msgctxt "Hijri month 4 - KLocale::LongName Possessive"
-msgid "of Rabi` al-Thaani"
-msgstr "od Rabi` al-Thaania"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:372
-msgid "of Rabi` al-Thaani"
-msgstr "od Rabi` al-Thaania"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:281
-#, fuzzy
-#| msgid "of Jumaada al-Awal"
-msgctxt "Hijri month 5 - KLocale::LongName Possessive"
-msgid "of Jumaada al-Awal"
-msgstr "od Jumaada al-Awala"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:374
-msgid "of Jumaada al-Awal"
-msgstr "od Jumaada al-Awala"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:283
-#, fuzzy
-#| msgid "of Jumaada al-Thaani"
-msgctxt "Hijri month 6 - KLocale::LongName Possessive"
-msgid "of Jumaada al-Thaani"
-msgstr "od Jumaada al-Thaania"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:376
-msgid "of Jumaada al-Thaani"
-msgstr "od Jumaada al-Thaania"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:285
-#, fuzzy
-#| msgid "of Rajab"
-msgctxt "Hijri month 7 - KLocale::LongName Possessive"
-msgid "of Rajab"
-msgstr "od Rajaba"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:347 kcalendarsystemhijri.cpp:378
-msgid "of Rajab"
-msgstr "od Rajaba"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:287
-#, fuzzy
-#| msgid "of Sha`ban"
-msgctxt "Hijri month 8 - KLocale::LongName Possessive"
-msgid "of Sha`ban"
-msgstr "od Sha`bana"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:349 kcalendarsystemhijri.cpp:380
-msgid "of Sha`ban"
-msgstr "od Sha`bana"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:289
-#, fuzzy
-#| msgid "of Ramadan"
-msgctxt "Hijri month 9 - KLocale::LongName Possessive"
-msgid "of Ramadan"
-msgstr "od Ramadana"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:351 kcalendarsystemhijri.cpp:382
-msgid "of Ramadan"
-msgstr "od Ramadana"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:291
-#, fuzzy
-#| msgid "of Shawwal"
-msgctxt "Hijri month 10 - KLocale::LongName Possessive"
-msgid "of Shawwal"
-msgstr "od Shawwala"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:353 kcalendarsystemhijri.cpp:384
-msgid "of Shawwal"
-msgstr "od Shawwala"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:293
-#, fuzzy
-#| msgid "of Thu al-Qi`dah"
-msgctxt "Hijri month 11 - KLocale::LongName Possessive"
-msgid "of Thu al-Qi`dah"
-msgstr "od Thu al-Qi`daha"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:386
-msgid "of Thu al-Qi`dah"
-msgstr "od Thu al-Qi`daha"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:295
-#, fuzzy
-#| msgid "of Thu al-Hijjah"
-msgctxt "Hijri month 12 - KLocale::LongName Possessive"
-msgid "of Thu al-Hijjah"
-msgstr "od Thu al-Hijjaha"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:388
-msgid "of Thu al-Hijjah"
-msgstr "od Thu al-Hijjaha"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:304
-#, fuzzy
-#| msgid "Muharram"
-msgctxt "Hijri month 1 - KLocale::LongName"
-msgid "Muharram"
-msgstr "Muharram"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:397 kcalendarsystemhijri.cpp:428
-msgid "Muharram"
-msgstr "Muharram"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:306
-#, fuzzy
-#| msgid "Safar"
-msgctxt "Hijri month 2 - KLocale::LongName"
-msgid "Safar"
-msgstr "Safar"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:399 kcalendarsystemhijri.cpp:430
-msgid "Safar"
-msgstr "Safar"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:308
-#, fuzzy
-#| msgid "Rabi` al-Awal"
-msgctxt "Hijri month 3 - KLocale::LongName"
-msgid "Rabi` al-Awal"
-msgstr "Rabi` al-Awal"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:432
-msgid "Rabi` al-Awal"
-msgstr "Rabi` al-Awal"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:310
-#, fuzzy
-#| msgid "Rabi` al-Thaani"
-msgctxt "Hijri month 4 - KLocale::LongName"
-msgid "Rabi` al-Thaani"
-msgstr "Rabi` al-Thaani"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:434
-msgid "Rabi` al-Thaani"
-msgstr "Rabi` al-Thaani"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:312
-#, fuzzy
-#| msgid "Jumaada al-Awal"
-msgctxt "Hijri month 5 - KLocale::LongName"
-msgid "Jumaada al-Awal"
-msgstr "Jumaada al-Awal"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:436
-msgid "Jumaada al-Awal"
-msgstr "Jumaada al-Awal"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:314
-#, fuzzy
-#| msgid "Jumaada al-Thaani"
-msgctxt "Hijri month 6 - KLocale::LongName"
-msgid "Jumaada al-Thaani"
-msgstr "Jumaada al-Thaani"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:438
-msgid "Jumaada al-Thaani"
-msgstr "Jumaada al-Thaani"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:316
-#, fuzzy
-#| msgid "Rajab"
-msgctxt "Hijri month 7 - KLocale::LongName"
-msgid "Rajab"
-msgstr "Rajab"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:409 kcalendarsystemhijri.cpp:440
-msgid "Rajab"
-msgstr "Rajab"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:318
-#, fuzzy
-#| msgid "Sha`ban"
-msgctxt "Hijri month 8 - KLocale::LongName"
-msgid "Sha`ban"
-msgstr "Sha`ban"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:411 kcalendarsystemhijri.cpp:442
-msgid "Sha`ban"
-msgstr "Sha`ban"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:320
-#, fuzzy
-#| msgid "Ramadan"
-msgctxt "Hijri month 9 - KLocale::LongName"
-msgid "Ramadan"
-msgstr "Ramadan"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:413 kcalendarsystemhijri.cpp:444
-msgid "Ramadan"
-msgstr "Ramadan"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:322
-#, fuzzy
-#| msgid "Shawwal"
-msgctxt "Hijri month 10 - KLocale::LongName"
-msgid "Shawwal"
-msgstr "Sha`ban"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:415 kcalendarsystemhijri.cpp:446
-msgid "Shawwal"
-msgstr "Sha`ban"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:324
-#, fuzzy
-#| msgid "Thu al-Qi`dah"
-msgctxt "Hijri month 11 - KLocale::LongName"
-msgid "Thu al-Qi`dah"
-msgstr "Thu al-Qi`dah"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:448
-msgid "Thu al-Qi`dah"
-msgstr "Thu al-Qi`dah"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:326
-#, fuzzy
-#| msgid "Thu al-Hijjah"
-msgctxt "Hijri month 12 - KLocale::LongName"
-msgid "Thu al-Hijjah"
-msgstr "Thu al-Hijjah"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:450
-msgid "Thu al-Hijjah"
-msgstr "Thu al-Hijjah"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:337
-#, fuzzy
-msgctxt "Hijri weekday 1 - KLocale::NarrowName "
-msgid "I"
-msgstr "I"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:339
-#, fuzzy
-msgctxt "Hijri weekday 2 - KLocale::NarrowName "
-msgid "T"
-msgstr "TGA"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:339
-msgid "of R. Awal"
-msgstr "od R. Awala"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:341
-#, fuzzy
-msgctxt "Hijri weekday 3 - KLocale::NarrowName "
-msgid "A"
-msgstr "A"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:341
-msgid "of R. Thaani"
-msgstr "od R. Thaania"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:343
-#, fuzzy
-msgctxt "Hijri weekday 4 - KLocale::NarrowName "
-msgid "K"
-msgstr "K"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:343
-msgid "of J. Awal"
-msgstr "od J. Awala"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:345
-#, fuzzy
-msgctxt "Hijri weekday 5 - KLocale::NarrowName "
-msgid "J"
-msgstr "J"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:345
-msgid "of J. Thaani"
-msgstr "od J. Thaania"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:347
-#, fuzzy
-msgctxt "Hijri weekday 6 - KLocale::NarrowName "
-msgid "S"
-msgstr "S"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:349
-#, fuzzy
-msgctxt "Hijri weekday 7 - KLocale::NarrowName "
-msgid "A"
-msgstr "A"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:355
-msgid "of Qi`dah"
-msgstr "od Qi`daha"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:357
-msgid "of Hijjah"
-msgstr "od Hijjaha"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:358
-#, fuzzy
-#| msgid "Ith"
-msgctxt "Hijri weekday 1 - KLocale::ShortName"
-msgid "Ith"
-msgstr "Ith"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:466
-msgid "Ith"
-msgstr "Ith"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:360
-#, fuzzy
-#| msgid "Thl"
-msgctxt "Hijri weekday 2 - KLocale::ShortName"
-msgid "Thl"
-msgstr "Thl"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:468
-msgid "Thl"
-msgstr "Thl"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:362
-#, fuzzy
-#| msgid "Arb"
-msgctxt "Hijri weekday 3 - KLocale::ShortName"
-msgid "Arb"
-msgstr "Arb"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:470
-msgid "Arb"
-msgstr "Arb"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:364
-#, fuzzy
-#| msgid "Kha"
-msgctxt "Hijri weekday 4 - KLocale::ShortName"
-msgid "Kha"
-msgstr "Kha"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:472
-msgid "Kha"
-msgstr "Kha"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:366
-#, fuzzy
-#| msgid "Jum"
-msgctxt "Hijri weekday 5 - KLocale::ShortName"
-msgid "Jum"
-msgstr "Jum"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:474
-msgid "Jum"
-msgstr "Jum"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:368
-#, fuzzy
-#| msgid "Sab"
-msgctxt "Hijri weekday 6 - KLocale::ShortName"
-msgid "Sab"
-msgstr "Sab"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:476
-msgid "Sab"
-msgstr "Sab"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:370
-#, fuzzy
-#| msgid "Ahd"
-msgctxt "Hijri weekday 7 - KLocale::ShortName"
-msgid "Ahd"
-msgstr "Ahd"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:478
-msgid "Ahd"
-msgstr "Ahd"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:377
-#, fuzzy
-#| msgid "Yaum al-Ithnain"
-msgctxt "Hijri weekday 1 - KLocale::LongName"
-msgid "Yaum al-Ithnain"
-msgstr "Yaum al-Ithnain"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:487
-msgid "Yaum al-Ithnain"
-msgstr "Yaum al-Ithnain"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:379
-#, fuzzy
-#| msgid "Yau al-Thulatha"
-msgctxt "Hijri weekday 2 - KLocale::LongName"
-msgid "Yau al-Thulatha"
-msgstr "Yau al-Thulatha"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:489
-msgid "Yau al-Thulatha"
-msgstr "Yau al-Thulatha"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:381
-#, fuzzy
-#| msgid "Yaum al-Arbi'a"
-msgctxt "Hijri weekday 3 - KLocale::LongName"
-msgid "Yaum al-Arbi'a"
-msgstr "Yaum al-Arbi'a"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:491
-msgid "Yaum al-Arbi'a"
-msgstr "Yaum al-Arbi'a"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:383
-#, fuzzy
-#| msgid "Yaum al-Khamees"
-msgctxt "Hijri weekday 4 - KLocale::LongName"
-msgid "Yaum al-Khamees"
-msgstr "Yaum al-Khamees"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:493
-msgid "Yaum al-Khamees"
-msgstr "Yaum al-Khamees"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:385
-#, fuzzy
-#| msgid "Yaum al-Jumma"
-msgctxt "Hijri weekday 5 - KLocale::LongName"
-msgid "Yaum al-Jumma"
-msgstr "Yaum al-Jumma"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:495
-msgid "Yaum al-Jumma"
-msgstr "Yaum al-Jumma"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:387
-#, fuzzy
-#| msgid "Yaum al-Sabt"
-msgctxt "Hijri weekday 6 - KLocale::LongName"
-msgid "Yaum al-Sabt"
-msgstr "Yaum al-Sabt"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:497
-msgid "Yaum al-Sabt"
-msgstr "Yaum al-Sabt"
-
-#. +> trunk
-#: kcalendarsystemhijri.cpp:389
-#, fuzzy
-#| msgid "Yaum al-Ahad"
-msgctxt "Hijri weekday 7 - KLocale::LongName"
-msgid "Yaum al-Ahad"
-msgstr "Yaum al-Ahad"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:401
-msgid "R. Awal"
-msgstr "R. Awal"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:403
-msgid "R. Thaani"
-msgstr "R. Thaani"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:405
-msgid "J. Awal"
-msgstr "J. Awal"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:407
-msgid "J. Thaani"
-msgstr "J. Thaani"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:417
-msgid "Qi`dah"
-msgstr "Qi`dah"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:419
-msgid "Hijjah"
-msgstr "Hijjah"
-
-#. +> stable
-#: kcalendarsystemhijri.cpp:499
-msgid "Yaum al-Ahad"
-msgstr "Yaum al-Ahad"
-
-#. +> trunk stable
 #: kcalendarsystemindiannational.cpp:74
 msgctxt "Calendar Era: Indian National Saka Era, years > 0, LongFormat"
@@ -6227 +5328 @@
 
 #. +> trunk stable
+#: kcalendarsystemislamiccivil.cpp:72
+msgctxt "Calendar Era: Hijri Islamic Era, years > 0, LongFormat"
+msgid "Anno Hegirae"
+msgstr "Anno Hegirae"
+
+#. +> trunk stable
+#: kcalendarsystemislamiccivil.cpp:73
+msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat"
+msgid "AH"
+msgstr "AH"
+
+#. +> trunk stable
+#: kcalendarsystemislamiccivil.cpp:74
+#, c-format
+msgctxt "(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH"
+msgid "%Ey %EC"
+msgstr "%Ey %EC"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:180
+#, fuzzy
+msgctxt "Hijri month 1 - KLocale::NarrowName"
+msgid "M"
+msgstr "AM"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:182
+#, fuzzy
+msgctxt "Hijri month 2 - KLocale::NarrowName"
+msgid "S"
+msgstr "S"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:184
+#, fuzzy
+msgctxt "Hijri month 3 - KLocale::NarrowName"
+msgid "A"
+msgstr "A"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:186
+#, fuzzy
+msgctxt "Hijri month 4 - KLocale::NarrowName"
+msgid "T"
+msgstr "TGA"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:188
+#, fuzzy
+msgctxt "Hijri month 5 - KLocale::NarrowName"
+msgid "A"
+msgstr "A"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:190
+#, fuzzy
+msgctxt "Hijri month 6 - KLocale::NarrowName"
+msgid "T"
+msgstr "TGA"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:192
+#, fuzzy
+msgctxt "Hijri month 7 - KLocale::NarrowName"
+msgid "R"
+msgstr "R"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:194
+#, fuzzy
+msgctxt "Hijri month 8 - KLocale::NarrowName"
+msgid "S"
+msgstr "S"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:196
+#, fuzzy
+msgctxt "Hijri month 9 - KLocale::NarrowName"
+msgid "R"
+msgstr "R"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:198
+#, fuzzy
+msgctxt "Hijri month 10 - KLocale::NarrowName"
+msgid "S"
+msgstr "S"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:200
+#, fuzzy
+msgctxt "Hijri month 11 - KLocale::NarrowName"
+msgid "Q"
+msgstr "Kv"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:202
+#, fuzzy
+msgctxt "Hijri month 12 - KLocale::NarrowName"
+msgid "H"
+msgstr "H:"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:211
+#, fuzzy
+#| msgctxt "of Mehr short"
+#| msgid "of Meh"
+msgctxt "Hijri month 1 - KLocale::ShortName Possessive"
+msgid "of Muh"
+msgstr "od Meh"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:213
+#, fuzzy
+#| msgid "of Safar"
+msgctxt "Hijri month 2 - KLocale::ShortName Possessive"
+msgid "of Saf"
+msgstr "od Safara"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:215
+#, fuzzy
+#| msgid "of R. Awal"
+msgctxt "Hijri month 3 - KLocale::ShortName Possessive"
+msgid "of R.A"
+msgstr "od R. Awala"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:217
+#, fuzzy
+#| msgid "of R. Thaani"
+msgctxt "Hijri month 4 - KLocale::ShortName Possessive"
+msgid "of R.T"
+msgstr "od R. Thaania"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:219
+#, fuzzy
+#| msgid "of J. Awal"
+msgctxt "Hijri month 5 - KLocale::ShortName Possessive"
+msgid "of J.A"
+msgstr "od J. Awala"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:221
+#, fuzzy
+#| msgid "of J. Thaani"
+msgctxt "Hijri month 6 - KLocale::ShortName Possessive"
+msgid "of J.T"
+msgstr "od J. Thaania"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:223
+#, fuzzy
+#| msgid "of Rajab"
+msgctxt "Hijri month 7 - KLocale::ShortName Possessive"
+msgid "of Raj"
+msgstr "od Rajaba"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:225
+#, fuzzy
+#| msgctxt "of Shahrivar short"
+#| msgid "of Sha"
+msgctxt "Hijri month 8 - KLocale::ShortName Possessive"
+msgid "of Sha"
+msgstr "od Sha"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:227
+#, fuzzy
+#| msgctxt "Coptic month 8 - ShortNamePossessive"
+#| msgid "of Pam"
+msgctxt "Hijri month 9 - KLocale::ShortName Possessive"
+msgid "of Ram"
+msgstr "od Pam"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:229
+#, fuzzy
+#| msgctxt "Indian National month 5 - ShortNamePossessive"
+#| msgid "of Shr"
+msgctxt "Hijri month 10 - KLocale::ShortName Possessive"
+msgid "of Shw"
+msgstr "od Shr"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:231
+#, fuzzy
+#| msgid "of Qi`dah"
+msgctxt "Hijri month 11 - KLocale::ShortName Possessive"
+msgid "of Qid"
+msgstr "od Qi`daha"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:233
+#, fuzzy
+#| msgid "of Hijjah"
+msgctxt "Hijri month 12 - KLocale::ShortName Possessive"
+msgid "of Hij"
+msgstr "od Hijjaha"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:242
+#, fuzzy
+#| msgctxt "City name (optional, probably does not need a translation)"
+#| msgid "Muncy"
+msgctxt "Hijri month 1 - KLocale::ShortName"
+msgid "Muh"
+msgstr "Muncy"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:244
+#, fuzzy
+#| msgid "Safar"
+msgctxt "Hijri month 2 - KLocale::ShortName"
+msgid "Saf"
+msgstr "Safar"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:246
+#, fuzzy
+msgctxt "Hijri month 3 - KLocale::ShortName"
+msgid "R.A"
+msgstr "DU"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:248
+#, fuzzy
+msgctxt "Hijri month 4 - KLocale::ShortName"
+msgid "R.T"
+msgstr "RT"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:250
+#, fuzzy
+msgctxt "Hijri month 5 - KLocale::ShortName"
+msgid "J.A"
+msgstr "Mlađi"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:252
+#, fuzzy
+msgctxt "Hijri month 6 - KLocale::ShortName"
+msgid "J.T"
+msgstr "Mlađi"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:254
+#, fuzzy
+#| msgid "Rajab"
+msgctxt "Hijri month 7 - KLocale::ShortName"
+msgid "Raj"
+msgstr "Rajab"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:256
+#, fuzzy
+#| msgctxt "Shahrivar short"
+#| msgid "Sha"
+msgctxt "Hijri month 8 - KLocale::ShortName"
+msgid "Sha"
+msgstr "Sha"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:258
+#, fuzzy
+msgctxt "Hijri month 9 - KLocale::ShortName"
+msgid "Ram"
+msgstr "Rampa"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:260
+#, fuzzy
+msgctxt "Hijri month 10 - KLocale::ShortName"
+msgid "Shw"
+msgstr "PrikaÅŸi"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:262
+#, fuzzy
+#| msgid "Qi`dah"
+msgctxt "Hijri month 11 - KLocale::ShortName"
+msgid "Qid"
+msgstr "Qi`dah"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:264
+#, fuzzy
+#| msgctxt "@item Calendar system"
+#| msgid "Hijri"
+msgctxt "Hijri month 12 - KLocale::ShortName"
+msgid "Hij"
+msgstr "Hijri"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:273
+#, fuzzy
+#| msgid "of Muharram"
+msgctxt "Hijri month 1 - KLocale::LongName Possessive"
+msgid "of Muharram"
+msgstr "od Muharrama"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:335 kcalendarsystemhijri.cpp:366
+msgid "of Muharram"
+msgstr "od Muharrama"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:275
+#, fuzzy
+#| msgid "of Safar"
+msgctxt "Hijri month 2 - KLocale::LongName Possessive"
+msgid "of Safar"
+msgstr "od Safara"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:337 kcalendarsystemhijri.cpp:368
+msgid "of Safar"
+msgstr "od Safara"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:277
+#, fuzzy
+#| msgid "of Rabi` al-Awal"
+msgctxt "Hijri month 3 - KLocale::LongName Possessive"
+msgid "of Rabi` al-Awal"
+msgstr "od Rabi` al-Awala"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:370
+msgid "of Rabi` al-Awal"
+msgstr "od Rabi` al-Awala"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:279
+#, fuzzy
+#| msgid "of Rabi` al-Thaani"
+msgctxt "Hijri month 4 - KLocale::LongName Possessive"
+msgid "of Rabi` al-Thaani"
+msgstr "od Rabi` al-Thaania"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:372
+msgid "of Rabi` al-Thaani"
+msgstr "od Rabi` al-Thaania"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:281
+#, fuzzy
+#| msgid "of Jumaada al-Awal"
+msgctxt "Hijri month 5 - KLocale::LongName Possessive"
+msgid "of Jumaada al-Awal"
+msgstr "od Jumaada al-Awala"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:374
+msgid "of Jumaada al-Awal"
+msgstr "od Jumaada al-Awala"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:283
+#, fuzzy
+#| msgid "of Jumaada al-Thaani"
+msgctxt "Hijri month 6 - KLocale::LongName Possessive"
+msgid "of Jumaada al-Thaani"
+msgstr "od Jumaada al-Thaania"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:376
+msgid "of Jumaada al-Thaani"
+msgstr "od Jumaada al-Thaania"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:285
+#, fuzzy
+#| msgid "of Rajab"
+msgctxt "Hijri month 7 - KLocale::LongName Possessive"
+msgid "of Rajab"
+msgstr "od Rajaba"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:347 kcalendarsystemhijri.cpp:378
+msgid "of Rajab"
+msgstr "od Rajaba"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:287
+#, fuzzy
+#| msgid "of Sha`ban"
+msgctxt "Hijri month 8 - KLocale::LongName Possessive"
+msgid "of Sha`ban"
+msgstr "od Sha`bana"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:349 kcalendarsystemhijri.cpp:380
+msgid "of Sha`ban"
+msgstr "od Sha`bana"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:289
+#, fuzzy
+#| msgid "of Ramadan"
+msgctxt "Hijri month 9 - KLocale::LongName Possessive"
+msgid "of Ramadan"
+msgstr "od Ramadana"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:351 kcalendarsystemhijri.cpp:382
+msgid "of Ramadan"
+msgstr "od Ramadana"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:291
+#, fuzzy
+#| msgid "of Shawwal"
+msgctxt "Hijri month 10 - KLocale::LongName Possessive"
+msgid "of Shawwal"
+msgstr "od Shawwala"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:353 kcalendarsystemhijri.cpp:384
+msgid "of Shawwal"
+msgstr "od Shawwala"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:293
+#, fuzzy
+#| msgid "of Thu al-Qi`dah"
+msgctxt "Hijri month 11 - KLocale::LongName Possessive"
+msgid "of Thu al-Qi`dah"
+msgstr "od Thu al-Qi`daha"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:386
+msgid "of Thu al-Qi`dah"
+msgstr "od Thu al-Qi`daha"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:295
+#, fuzzy
+#| msgid "of Thu al-Hijjah"
+msgctxt "Hijri month 12 - KLocale::LongName Possessive"
+msgid "of Thu al-Hijjah"
+msgstr "od Thu al-Hijjaha"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:388
+msgid "of Thu al-Hijjah"
+msgstr "od Thu al-Hijjaha"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:304
+#, fuzzy
+#| msgid "Muharram"
+msgctxt "Hijri month 1 - KLocale::LongName"
+msgid "Muharram"
+msgstr "Muharram"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:397 kcalendarsystemhijri.cpp:428
+msgid "Muharram"
+msgstr "Muharram"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:306
+#, fuzzy
+#| msgid "Safar"
+msgctxt "Hijri month 2 - KLocale::LongName"
+msgid "Safar"
+msgstr "Safar"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:399 kcalendarsystemhijri.cpp:430
+msgid "Safar"
+msgstr "Safar"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:308
+#, fuzzy
+#| msgid "Rabi` al-Awal"
+msgctxt "Hijri month 3 - KLocale::LongName"
+msgid "Rabi` al-Awal"
+msgstr "Rabi` al-Awal"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:432
+msgid "Rabi` al-Awal"
+msgstr "Rabi` al-Awal"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:310
+#, fuzzy
+#| msgid "Rabi` al-Thaani"
+msgctxt "Hijri month 4 - KLocale::LongName"
+msgid "Rabi` al-Thaani"
+msgstr "Rabi` al-Thaani"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:434
+msgid "Rabi` al-Thaani"
+msgstr "Rabi` al-Thaani"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:312
+#, fuzzy
+#| msgid "Jumaada al-Awal"
+msgctxt "Hijri month 5 - KLocale::LongName"
+msgid "Jumaada al-Awal"
+msgstr "Jumaada al-Awal"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:436
+msgid "Jumaada al-Awal"
+msgstr "Jumaada al-Awal"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:314
+#, fuzzy
+#| msgid "Jumaada al-Thaani"
+msgctxt "Hijri month 6 - KLocale::LongName"
+msgid "Jumaada al-Thaani"
+msgstr "Jumaada al-Thaani"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:438
+msgid "Jumaada al-Thaani"
+msgstr "Jumaada al-Thaani"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:316
+#, fuzzy
+#| msgid "Rajab"
+msgctxt "Hijri month 7 - KLocale::LongName"
+msgid "Rajab"
+msgstr "Rajab"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:409 kcalendarsystemhijri.cpp:440
+msgid "Rajab"
+msgstr "Rajab"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:318
+#, fuzzy
+#| msgid "Sha`ban"
+msgctxt "Hijri month 8 - KLocale::LongName"
+msgid "Sha`ban"
+msgstr "Sha`ban"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:411 kcalendarsystemhijri.cpp:442
+msgid "Sha`ban"
+msgstr "Sha`ban"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:320
+#, fuzzy
+#| msgid "Ramadan"
+msgctxt "Hijri month 9 - KLocale::LongName"
+msgid "Ramadan"
+msgstr "Ramadan"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:413 kcalendarsystemhijri.cpp:444
+msgid "Ramadan"
+msgstr "Ramadan"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:322
+#, fuzzy
+#| msgid "Shawwal"
+msgctxt "Hijri month 10 - KLocale::LongName"
+msgid "Shawwal"
+msgstr "Sha`ban"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:415 kcalendarsystemhijri.cpp:446
+msgid "Shawwal"
+msgstr "Sha`ban"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:324
+#, fuzzy
+#| msgid "Thu al-Qi`dah"
+msgctxt "Hijri month 11 - KLocale::LongName"
+msgid "Thu al-Qi`dah"
+msgstr "Thu al-Qi`dah"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:448
+msgid "Thu al-Qi`dah"
+msgstr "Thu al-Qi`dah"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:326
+#, fuzzy
+#| msgid "Thu al-Hijjah"
+msgctxt "Hijri month 12 - KLocale::LongName"
+msgid "Thu al-Hijjah"
+msgstr "Thu al-Hijjah"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:450
+msgid "Thu al-Hijjah"
+msgstr "Thu al-Hijjah"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:337
+#, fuzzy
+msgctxt "Hijri weekday 1 - KLocale::NarrowName "
+msgid "I"
+msgstr "I"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:339
+#, fuzzy
+msgctxt "Hijri weekday 2 - KLocale::NarrowName "
+msgid "T"
+msgstr "TGA"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:339
+msgid "of R. Awal"
+msgstr "od R. Awala"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:341
+#, fuzzy
+msgctxt "Hijri weekday 3 - KLocale::NarrowName "
+msgid "A"
+msgstr "A"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:341
+msgid "of R. Thaani"
+msgstr "od R. Thaania"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:343
+#, fuzzy
+msgctxt "Hijri weekday 4 - KLocale::NarrowName "
+msgid "K"
+msgstr "K"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:343
+msgid "of J. Awal"
+msgstr "od J. Awala"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:345
+#, fuzzy
+msgctxt "Hijri weekday 5 - KLocale::NarrowName "
+msgid "J"
+msgstr "J"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:345
+msgid "of J. Thaani"
+msgstr "od J. Thaania"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:347
+#, fuzzy
+msgctxt "Hijri weekday 6 - KLocale::NarrowName "
+msgid "S"
+msgstr "S"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:349
+#, fuzzy
+msgctxt "Hijri weekday 7 - KLocale::NarrowName "
+msgid "A"
+msgstr "A"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:355
+msgid "of Qi`dah"
+msgstr "od Qi`daha"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:357
+msgid "of Hijjah"
+msgstr "od Hijjaha"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:358
+#, fuzzy
+#| msgid "Ith"
+msgctxt "Hijri weekday 1 - KLocale::ShortName"
+msgid "Ith"
+msgstr "Ith"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:466
+msgid "Ith"
+msgstr "Ith"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:360
+#, fuzzy
+#| msgid "Thl"
+msgctxt "Hijri weekday 2 - KLocale::ShortName"
+msgid "Thl"
+msgstr "Thl"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:468
+msgid "Thl"
+msgstr "Thl"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:362
+#, fuzzy
+#| msgid "Arb"
+msgctxt "Hijri weekday 3 - KLocale::ShortName"
+msgid "Arb"
+msgstr "Arb"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:470
+msgid "Arb"
+msgstr "Arb"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:364
+#, fuzzy
+#| msgid "Kha"
+msgctxt "Hijri weekday 4 - KLocale::ShortName"
+msgid "Kha"
+msgstr "Kha"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:472
+msgid "Kha"
+msgstr "Kha"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:366
+#, fuzzy
+#| msgid "Jum"
+msgctxt "Hijri weekday 5 - KLocale::ShortName"
+msgid "Jum"
+msgstr "Jum"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:474
+msgid "Jum"
+msgstr "Jum"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:368
+#, fuzzy
+#| msgid "Sab"
+msgctxt "Hijri weekday 6 - KLocale::ShortName"
+msgid "Sab"
+msgstr "Sab"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:476
+msgid "Sab"
+msgstr "Sab"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:370
+#, fuzzy
+#| msgid "Ahd"
+msgctxt "Hijri weekday 7 - KLocale::ShortName"
+msgid "Ahd"
+msgstr "Ahd"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:478
+msgid "Ahd"
+msgstr "Ahd"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:377
+#, fuzzy
+#| msgid "Yaum al-Ithnain"
+msgctxt "Hijri weekday 1 - KLocale::LongName"
+msgid "Yaum al-Ithnain"
+msgstr "Yaum al-Ithnain"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:487
+msgid "Yaum al-Ithnain"
+msgstr "Yaum al-Ithnain"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:379
+#, fuzzy
+#| msgid "Yau al-Thulatha"
+msgctxt "Hijri weekday 2 - KLocale::LongName"
+msgid "Yau al-Thulatha"
+msgstr "Yau al-Thulatha"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:489
+msgid "Yau al-Thulatha"
+msgstr "Yau al-Thulatha"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:381
+#, fuzzy
+#| msgid "Yaum al-Arbi'a"
+msgctxt "Hijri weekday 3 - KLocale::LongName"
+msgid "Yaum al-Arbi'a"
+msgstr "Yaum al-Arbi'a"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:491
+msgid "Yaum al-Arbi'a"
+msgstr "Yaum al-Arbi'a"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:383
+#, fuzzy
+#| msgid "Yaum al-Khamees"
+msgctxt "Hijri weekday 4 - KLocale::LongName"
+msgid "Yaum al-Khamees"
+msgstr "Yaum al-Khamees"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:493
+msgid "Yaum al-Khamees"
+msgstr "Yaum al-Khamees"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:385
+#, fuzzy
+#| msgid "Yaum al-Jumma"
+msgctxt "Hijri weekday 5 - KLocale::LongName"
+msgid "Yaum al-Jumma"
+msgstr "Yaum al-Jumma"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:495
+msgid "Yaum al-Jumma"
+msgstr "Yaum al-Jumma"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:387
+#, fuzzy
+#| msgid "Yaum al-Sabt"
+msgctxt "Hijri weekday 6 - KLocale::LongName"
+msgid "Yaum al-Sabt"
+msgstr "Yaum al-Sabt"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:497
+msgid "Yaum al-Sabt"
+msgstr "Yaum al-Sabt"
+
+#. +> trunk
+#: kcalendarsystemislamiccivil.cpp:389
+#, fuzzy
+#| msgid "Yaum al-Ahad"
+msgctxt "Hijri weekday 7 - KLocale::LongName"
+msgid "Yaum al-Ahad"
+msgstr "Yaum al-Ahad"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:401
+msgid "R. Awal"
+msgstr "R. Awal"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:403
+msgid "R. Thaani"
+msgstr "R. Thaani"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:405
+msgid "J. Awal"
+msgstr "J. Awal"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:407
+msgid "J. Thaani"
+msgstr "J. Thaani"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:417
+msgid "Qi`dah"
+msgstr "Qi`dah"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:419
+msgid "Hijjah"
+msgstr "Hijjah"
+
+#. +> stable
+#: kcalendarsystemhijri.cpp:499
+msgid "Yaum al-Ahad"
+msgstr "Yaum al-Ahad"
+
+#. +> trunk stable
 #: kcalendarsystemjalali.cpp:80
 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, LongFormat"
@@ -7333 +7333 @@
 
 #. +> trunk stable
-#: kcalendarsystemjapanese.cpp:293
+#: kcalendarsystemjapanese.cpp:192
 msgctxt "Japanese year 1 of era"
 msgid "Gannen"

kde-croatia/kde4/summit/hr/summit/messages/kdelibs/kio4.po

@@ -11 +11 @@
 "Project-Id-Version: kio4 0\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-22 08:38+0200\n"
+"POT-Creation-Date: 2011-05-25 09:40+0200\n"
 "PO-Revision-Date: 2011-05-05 10:23+0200\n"
 "Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
@@ -6983 +6983 @@
 
 #. +> trunk stable
-#: misc/kpac/proxyscout.cpp:201
+#: misc/kpac/proxyscout.cpp:203
 #, kde-format
 msgid ""
@@ -6993 +6993 @@
 
 #. +> trunk stable
-#: misc/kpac/proxyscout.cpp:315
+#: misc/kpac/proxyscout.cpp:317
 #, kde-format
 msgid ""

kde-croatia/kde4/summit/hr/summit/messages/kdemultimedia/juk.po

@@ -6 +6 @@
 "Project-Id-Version: juk 0\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-19 07:16+0200\n"
+"POT-Creation-Date: 2011-05-25 09:40+0200\n"
 "PO-Revision-Date: 2004-04-20 13:21+CEST\n"
 "Last-Translator: auto\n"
@@ -114 +114 @@
 #. i18n: ectx: property (windowTitle), widget (QWidget, CoverDialogBase)
 #. +> trunk stable
-#: coverdialogbase.ui:13 playlistcollection.cpp:897
+#: coverdialogbase.ui:13 playlistcollection.cpp:899
 #, fuzzy
 msgid "Cover Manager"
@@ -1320 +1320 @@
 
 #. +> trunk stable
-#: playlistbox.cpp:214 playlistcollection.cpp:400
+#: playlistbox.cpp:214 playlistcollection.cpp:402
 #, fuzzy
 msgctxt "verb, copy the playlist"
@@ -1369 +1369 @@
 
 #. +> trunk stable
-#: playlistbox.cpp:671 playlistcollection.cpp:889
+#: playlistbox.cpp:671 playlistcollection.cpp:891
 msgid "R&emove"
 msgstr "U&kloni"
@@ -1380 +1380 @@
 
 #. +> trunk stable
-#: playlistcollection.cpp:229
+#: playlistcollection.cpp:231
 #, fuzzy
 msgid "Now Playing"
@@ -1386 +1386 @@
 
 #. +> trunk stable
-#: playlistcollection.cpp:331
+#: playlistcollection.cpp:333
 #, fuzzy
 msgid "Do you want to add these items to the current list or to the collection list?"
@@ -1392 +1392 @@
 
 #. +> trunk stable
-#: playlistcollection.cpp:333
+#: playlistcollection.cpp:335
 #, fuzzy
 #| msgid "Current"
@@ -1400 +1400 @@
 
 #. +> trunk stable
-#: playlistcollection.cpp:334
+#: playlistcollection.cpp:336
 msgid "Collection"
 msgstr "Kolekcija"
 
 #. +> trunk stable
-#: playlistcollection.cpp:388
+#: playlistcollection.cpp:390
 msgid "Rename"
 msgstr "Preimenuj"
 
 #. +> trunk stable
-#: playlistcollection.cpp:502
+#: playlistcollection.cpp:504
 #, fuzzy
 msgid "Search Playlist"
@@ -1416 +1416 @@
 
 #. +> trunk stable
-#: playlistcollection.cpp:519
+#: playlistcollection.cpp:521
 #, fuzzy
 msgid "Create Folder Playlist"
@@ -1422 +1422 @@
 
 #. +> trunk stable
-#: playlistcollection.cpp:558
+#: playlistcollection.cpp:560
 msgid "History"
 msgstr "Povijest"
 
 #. +> trunk stable
-#: playlistcollection.cpp:740
+#: playlistcollection.cpp:742
 #, fuzzy
 msgid "Please enter a name for this playlist:"
@@ -1433 +1433 @@
 
 #. +> trunk stable
-#: playlistcollection.cpp:850
+#: playlistcollection.cpp:852
 #, fuzzy
 #| msgid "&New"
@@ -1441 +1441 @@
 
 #. +> trunk stable
-#: playlistcollection.cpp:853
+#: playlistcollection.cpp:855
 #, fuzzy
 msgid "&Empty Playlist..."
@@ -1447 +1447 @@
 
 #. +> trunk stable
-#: playlistcollection.cpp:855
+#: playlistcollection.cpp:857
 #, fuzzy
 msgid "&Search Playlist..."
@@ -1453 +1453 @@
 
 #. +> trunk stable
-#: playlistcollection.cpp:857
+#: playlistcollection.cpp:859
 #, fuzzy
 msgid "Playlist From &Folder..."
@@ -1459 +1459 @@
 
 #. +> trunk stable
-#: playlistcollection.cpp:863
+#: playlistcollection.cpp:865
 #, fuzzy
 msgid "&Guess Tag Information"
@@ -1465 +1465 @@
 
 #. +> trunk stable
-#: playlistcollection.cpp:868
+#: playlistcollection.cpp:870
 #, fuzzy
 msgid "From &File Name"
@@ -1471 +1471 @@
 
 #. +> trunk stable
-#: playlistcollection.cpp:870
+#: playlistcollection.cpp:872
 #, fuzzy
 msgid "From &Internet"
@@ -1477 +1477 @@
 
 #. +> trunk stable
-#: playlistcollection.cpp:873
+#: playlistcollection.cpp:875
 #, fuzzy
 msgid "Guess Tag Information From &File Name"
@@ -1483 +1483 @@
 
 #. +> trunk stable
-#: playlistcollection.cpp:878
+#: playlistcollection.cpp:880
 #, fuzzy
 msgid "Play First Track"
@@ -1489 +1489 @@
 
 #. +> trunk stable
-#: playlistcollection.cpp:879
+#: playlistcollection.cpp:881
 msgid "Play Next Album"
 msgstr ""
 
 #. +> trunk stable
-#: playlistcollection.cpp:885
+#: playlistcollection.cpp:887
 msgid "Add &Folder..."
 msgstr ""
 
 #. +> trunk stable
-#: playlistcollection.cpp:886
+#: playlistcollection.cpp:888
 msgid "&Rename..."
 msgstr "&Promijeni ime 
"
 
 #. +> trunk stable
-#: playlistcollection.cpp:887
+#: playlistcollection.cpp:889
 #, fuzzy
 #| msgid "D&uplicate..."
@@ -1512 +1512 @@
 
 #. +> trunk stable
-#: playlistcollection.cpp:890
+#: playlistcollection.cpp:892
 #, fuzzy
 msgid "Reload"
@@ -1518 +1518 @@
 
 #. +> trunk stable
-#: playlistcollection.cpp:891
+#: playlistcollection.cpp:893
 msgid "Edit Search..."
 msgstr ""
 
 #. +> trunk stable
-#: playlistcollection.cpp:893
+#: playlistcollection.cpp:895
 #, fuzzy
 msgid "&Delete"
@@ -1529 +1529 @@
 
 #. +> trunk stable
-#: playlistcollection.cpp:894
+#: playlistcollection.cpp:896
 #, fuzzy
 msgid "Refresh"
@@ -1535 +1535 @@
 
 #. +> trunk stable
-#: playlistcollection.cpp:895
+#: playlistcollection.cpp:897
 msgid "&Rename File"
 msgstr "&Promijeni ime datoteci"
 
 #. +> trunk stable
-#: playlistcollection.cpp:900
+#: playlistcollection.cpp:902
 #, fuzzy
 msgid "&View Cover"
@@ -1546 +1546 @@
 
 #. +> trunk stable
-#: playlistcollection.cpp:902
+#: playlistcollection.cpp:904
 msgid "Get Cover From &File..."
 msgstr ""
 
 #. +> trunk stable
-#: playlistcollection.cpp:904
+#: playlistcollection.cpp:906
 #, fuzzy
 msgid "Get Cover From &Internet..."
@@ -1557 +1557 @@
 
 #. +> trunk stable
-#: playlistcollection.cpp:906
+#: playlistcollection.cpp:908
 msgid "&Delete Cover"
 msgstr ""
 
 #. +> trunk stable
-#: playlistcollection.cpp:908
+#: playlistcollection.cpp:910
 #, fuzzy
 msgid "Show Cover &Manager"
@@ -1568 +1568 @@
 
 #. +> trunk stable
-#: playlistcollection.cpp:912
+#: playlistcollection.cpp:914
 #, fuzzy
 msgid "Show &Play Queue"

kde-croatia/kde4/summit/hr/summit/messages/kdenetwork/desktop_kdenetwork.po

@@ -8 +8 @@
 "Project-Id-Version: desktop_kdenetwork 0\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-20 07:34+0200\n"
+"POT-Creation-Date: 2011-05-25 09:40+0200\n"
 "PO-Revision-Date: 2010-05-26 11:57+0200\n"
 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
@@ -841 +841 @@
 
 #. +> trunk
-#: kopete/kopete/kopete.notifyrc:3140
+#: kopete/kopete/kopete.notifyrc:3141
 #, fuzzy
 msgctxt "Name"
@@ -848 +848 @@
 
 #. +> trunk
-#: kopete/kopete/kopete.notifyrc:3161
+#: kopete/kopete/kopete.notifyrc:3162
 #, fuzzy
 #| msgctxt "Comment"

kde-croatia/kde4/summit/hr/summit/messages/kdepim/desktop_kdepim.po

@@ -7 +7 @@
 "Project-Id-Version: desktop_kdepim 0\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-23 09:09+0200\n"
+"POT-Creation-Date: 2011-05-25 09:40+0200\n"
 "PO-Revision-Date: 2011-02-27 12:29+0100\n"
 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
@@ -305 +305 @@
 
 #. +> trunk
-#: examples/coisceim/kontact-plugin/coisceim_plugin.desktop:30
+#: examples/coisceim/kontact-plugin/coisceim_plugin.desktop:32
 #, fuzzy
 msgctxt "Name"
@@ -344 +344 @@
 
 #. +> trunk stable
-#: examples/mailreader/mailreader.desktop:42
+#: examples/mailreader/mailreader.desktop:43
 #, fuzzy
 msgctxt "GenericName"
@@ -358 +358 @@
 
 #. +> trunk stable
-#: kaddressbook/grantlee/tests/themes/air/theme-air.desktop:32
+#: kaddressbook/grantlee/tests/themes/air/theme-air.desktop:33
 #, fuzzy
 msgctxt "Description"
@@ -372 +372 @@
 
 #. +> trunk stable
-#: kaddressbook/grantlee/tests/themes/simple/theme-simple.desktop:32
+#: kaddressbook/grantlee/tests/themes/simple/theme-simple.desktop:33
 #, fuzzy
 msgctxt "Description"
@@ -386 +386 @@
 
 #. +> trunk stable
-#: kaddressbook/grantlee/tests/themes/test/theme-test.desktop:32
+#: kaddressbook/grantlee/tests/themes/test/theme-test.desktop:33
 #, fuzzy
 msgctxt "Description"
@@ -565 +565 @@
 
 #. +> trunk
-#: kalarm/rtcwakeaction.actions:78
+#: kalarm/rtcwakeaction.actions:80
 msgctxt "Description"
 msgid "Set RTC wake-from-suspend time"
@@ -1469 +1469 @@
 
 #. +> trunk stable
-#: kontact/src/kontactconfig.desktop:23
+#: kontact/src/kontactconfig.desktop:26
 #, fuzzy
 msgctxt "Comment"
@@ -1877 +1877 @@
 
 #. +> trunk stable
-#: libkleo/libkleopatrarc-win32.desktop:87
+#: libkleo/libkleopatrarc-win32.desktop:88
 msgctxt "Name"
 msgid "sha256sum"
@@ -1883 +1883 @@
 
 #. +> trunk stable
-#: libkleo/libkleopatrarc-win32.desktop:123 libkleo/libkleopatrarc.desktop:166
+#: libkleo/libkleopatrarc-win32.desktop:124 libkleo/libkleopatrarc.desktop:167
 msgctxt "Name"
 msgid "md5sum"
@@ -1889 +1889 @@
 
 #. +> trunk stable
-#: libkleo/libkleopatrarc-win32.desktop:160 libkleo/libkleopatrarc.desktop:203
+#: libkleo/libkleopatrarc-win32.desktop:162 libkleo/libkleopatrarc.desktop:205
 #, fuzzy
 msgctxt "Name"
@@ -1896 +1896 @@
 
 #. +> trunk stable
-#: libkleo/libkleopatrarc-win32.desktop:219 libkleo/libkleopatrarc.desktop:262
+#: libkleo/libkleopatrarc-win32.desktop:221 libkleo/libkleopatrarc.desktop:264
 #, fuzzy
 msgctxt "Name"
@@ -1903 +1903 @@
 
 #. +> trunk stable
-#: libkleo/libkleopatrarc-win32.desktop:279 libkleo/libkleopatrarc.desktop:322
+#: libkleo/libkleopatrarc-win32.desktop:281 libkleo/libkleopatrarc.desktop:324
 #, fuzzy
 msgctxt "Name"
@@ -1910 +1910 @@
 
 #. +> trunk stable
-#: libkleo/libkleopatrarc-win32.desktop:339 libkleo/libkleopatrarc.desktop:382
+#: libkleo/libkleopatrarc-win32.desktop:341 libkleo/libkleopatrarc.desktop:384
 msgctxt "Name"
 msgid "Trusted Root Certificate"
@@ -1916 +1916 @@
 
 #. +> trunk stable
-#: libkleo/libkleopatrarc-win32.desktop:401 libkleo/libkleopatrarc.desktop:444
+#: libkleo/libkleopatrarc-win32.desktop:403 libkleo/libkleopatrarc.desktop:446
 msgctxt "Name"
 msgid "Not Trusted Root Certificate"
@@ -1922 +1922 @@
 
 #. +> trunk stable
-#: libkleo/libkleopatrarc-win32.desktop:459 libkleo/libkleopatrarc.desktop:502
+#: libkleo/libkleopatrarc-win32.desktop:461 libkleo/libkleopatrarc.desktop:504
 msgctxt "Name"
 msgid "Keys for Qualified Signatures"
@@ -1928 +1928 @@
 
 #. +> trunk stable
-#: libkleo/libkleopatrarc-win32.desktop:502 libkleo/libkleopatrarc.desktop:545
+#: libkleo/libkleopatrarc-win32.desktop:504 libkleo/libkleopatrarc.desktop:547
 #, fuzzy
 msgctxt "Name"
@@ -1935 +1935 @@
 
 #. +> trunk stable
-#: libkleo/libkleopatrarc-win32.desktop:548 libkleo/libkleopatrarc.desktop:591
+#: libkleo/libkleopatrarc-win32.desktop:550 libkleo/libkleopatrarc.desktop:593
 msgctxt "Name"
 msgid "Smartcard Key"

kde-croatia/kde4/summit/hr/summit/messages/kdeutils/ark.po

@@ -9 +9 @@
 "Project-Id-Version: ark 0\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-16 09:01+0200\n"
+"POT-Creation-Date: 2011-05-25 09:41+0200\n"
 "PO-Revision-Date: 2011-03-03 21:22+0100\n"
 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
@@ -40 +40 @@
 
 #. +> trunk stable
-#: app/batchextract.cpp:135 app/batchextract.cpp:188
+#: app/batchextract.cpp:136 app/batchextract.cpp:192
 msgid "Extracting file..."
 msgstr "Otpakiravam datoteku
"
 
 #. +> trunk stable
-#: app/batchextract.cpp:136 app/batchextract.cpp:189
+#: app/batchextract.cpp:137 app/batchextract.cpp:193
 msgid "Source archive"
 msgstr "Izvorna arhiva"
 
 #. +> trunk stable
-#: app/batchextract.cpp:137 app/batchextract.cpp:190
+#: app/batchextract.cpp:138 app/batchextract.cpp:194
 msgid "Destination"
 msgstr "Odredište"
 
 #. +> trunk stable
-#: app/batchextract.cpp:150
+#: app/batchextract.cpp:151
 msgid "The following files could not be extracted:"
 msgstr "Sljedeće datoteke ne mogu biti otpakirane:"
 
 #. +> trunk stable
-#: app/batchextract.cpp:166
+#: app/batchextract.cpp:170
 msgid "There was an error during extraction."
 msgstr "Dogodila se greška prilikom otpakiravanja."
@@ -341 +341 @@
 
 #. +> trunk stable
-#: kerfuffle/cliinterface.cpp:494 kerfuffle/cliinterface.cpp:535
+#: kerfuffle/cliinterface.cpp:494 kerfuffle/cliinterface.cpp:534
 msgid "Incorrect password."
 msgstr "Netočna zaporka."
 
 #. +> trunk stable
-#: kerfuffle/cliinterface.cpp:502 kerfuffle/cliinterface.cpp:543
+#: kerfuffle/cliinterface.cpp:501 kerfuffle/cliinterface.cpp:541
 msgid "Extraction failed because of an unexpected error."
 msgstr "Otpakiravanje nije uspjelo zbog neočekivane greške."

kde-croatia/kde4/summit/hr/summit/messages/kdeutils/desktop_kdeutils.po

@@ -7 +7 @@
 "Project-Id-Version: desktop_kdeutils 0\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-20 07:35+0200\n"
+"POT-Creation-Date: 2011-05-25 09:41+0200\n"
 "PO-Revision-Date: 2010-02-14 12:30+0100\n"
 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
@@ -28 +28 @@
 
 #. +> trunk stable
-#: ark/app/ark.desktop:74
+#: ark/app/ark.desktop:75
 msgctxt "Name"
 msgid "Ark"
@@ -46 +46 @@
 
 #. +> trunk stable
-#: ark/app/ark_addtoservicemenu.desktop:124
+#: ark/app/ark_addtoservicemenu.desktop:125
 msgctxt "Name"
 msgid "As ZIP Archive"
@@ -52 +52 @@
 
 #. +> trunk stable
-#: ark/app/ark_addtoservicemenu.desktop:181
+#: ark/app/ark_addtoservicemenu.desktop:183
 msgctxt "Name"
 msgid "As RAR Archive"
@@ -58 +58 @@
 
 #. +> trunk stable
-#: ark/app/ark_addtoservicemenu.desktop:238
+#: ark/app/ark_addtoservicemenu.desktop:241
 msgctxt "Name"
 msgid "As ZIP/TAR Archive"
@@ -64 +64 @@
 
 #. +> trunk stable
-#: ark/app/ark_addtoservicemenu.desktop:294
+#: ark/app/ark_addtoservicemenu.desktop:298
 msgctxt "Name"
 msgid "Compress To..."

kde-croatia/kde4/summit/hr/summit/messages/koffice/karbon.po

@@ -5 +5 @@
 "Project-Id-Version: karbon 0\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-04-07 08:11+0200\n"
+"POT-Creation-Date: 2011-05-25 09:41+0200\n"
 "PO-Revision-Date: 2007-01-08 01:49+0100\n"
 "Last-Translator: Renato Pavicic <renato@translator-shop.org>\n"
@@ -55 +55 @@
 #. i18n: ectx: Menu (object_order)
 #. +> trunk stable
-#: data/karbon.rc:16 data/karbon.rc:76
+#: data/karbon.rc:16 data/karbon.rc:78
 msgid "&Order"
 msgstr "&Redoslijed"
@@ -61 +61 @@
 #. i18n: ectx: Menu (object_align)
 #. +> trunk stable
-#: data/karbon.rc:23 data/karbon.rc:83
+#: data/karbon.rc:23 data/karbon.rc:85
 msgid "&Align"
 msgstr "&Poravnanje"
@@ -81 +81 @@
 #. i18n: ectx: Menu (view)
 #. +> trunk stable
-#: data/karbon.rc:50 data/karbon_readonly.rc:17
+#: data/karbon.rc:52 data/karbon_readonly.rc:17
 #, fuzzy
 msgid "&View"
@@ -88 +88 @@
 #. i18n: ectx: Menu (object)
 #. +> trunk stable
-#: data/karbon.rc:73
+#: data/karbon.rc:75
 msgid "&Object"
 msgstr "&Objekt 
"
@@ -94 +94 @@
 #. i18n: ectx: Menu (object_distribute)
 #. +> trunk stable
-#: data/karbon.rc:93
+#: data/karbon.rc:95
 msgid "&Distribute"
 msgstr ""
@@ -100 +100 @@
 #. i18n: ectx: Menu (path)
 #. +> trunk stable
-#: data/karbon.rc:112
+#: data/karbon.rc:114
 #, fuzzy
 msgid "&Path"
@@ -107 +107 @@
 #. i18n: ectx: Menu (effects)
 #. +> trunk stable
-#: data/karbon.rc:126
+#: data/karbon.rc:128
 #, fuzzy
 msgid "Effe&cts"
@@ -114 +114 @@
 #. i18n: ectx: Menu (settings)
 #. +> trunk stable
-#: data/karbon.rc:128
+#: data/karbon.rc:130
 #, fuzzy
 msgid "&Settings"
@@ -121 +121 @@
 #. i18n: ectx: ToolBar (edit_toolbar)
 #. +> trunk stable
-#: data/karbon.rc:136
+#: data/karbon.rc:138
 #, fuzzy
 msgid "Edit"
@@ -128 +128 @@
 #. i18n: ectx: ToolBar (object_toolbar)
 #. +> trunk stable
-#: data/karbon.rc:146
+#: data/karbon.rc:148
 msgid "Object"
 msgstr "Objekt"
@@ -134 +134 @@
 #. i18n: ectx: ToolBar (align_toolbar)
 #. +> trunk stable
-#: data/karbon.rc:155
+#: data/karbon.rc:157
 #, fuzzy
 msgid "Align"
@@ -141 +141 @@
 #. i18n: ectx: ToolBar (Effects)
 #. +> trunk stable
-#: data/karbon.rc:164
+#: data/karbon.rc:166
 msgid "Effects"
 msgstr "Efekti"
@@ -988 +988 @@
 
 #. +> trunk
-#: ui/KarbonView.cpp:703 ui/KarbonView.cpp:1029
+#: ui/KarbonView.cpp:703 ui/KarbonView.cpp:1033
 #, fuzzy
 msgid "Mirror Horizontally"
@@ -994 +994 @@
 
 #. +> trunk
-#: ui/KarbonView.cpp:705 ui/KarbonView.cpp:1025
+#: ui/KarbonView.cpp:705 ui/KarbonView.cpp:1029
 #, fuzzy
 msgid "Mirror Vertically"
@@ -1032 +1032 @@
 msgstr "O&briši"
 
-#. +> trunk stable
-#: ui/KarbonView.cpp:952
+#. +> trunk
+#: ui/KarbonView.cpp:950
+#, fuzzy
+#| msgid "End Time"
+msgid "Edit Guides"
+msgstr "Završno vrijeme:"
+
+#. +> trunk stable
+#: ui/KarbonView.cpp:956
 #, fuzzy
 #| msgid "&Duplicate"
@@ -1041 +1048 @@
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:957
+#: ui/KarbonView.cpp:961
 msgid "Distribute Center (Horizontal)"
 msgstr ""
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:961
+#: ui/KarbonView.cpp:965
 msgid "Distribute Gaps (Horizontal)"
 msgstr ""
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:965
+#: ui/KarbonView.cpp:969
 #, fuzzy
 msgid "Distribute Left Borders"
@@ -1057 +1064 @@
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:969
+#: ui/KarbonView.cpp:973
 #, fuzzy
 msgid "Distribute Right Borders"
@@ -1063 +1070 @@
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:973
+#: ui/KarbonView.cpp:977
 msgid "Distribute Center (Vertical)"
 msgstr ""
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:977
+#: ui/KarbonView.cpp:981
 msgid "Distribute Gaps (Vertical)"
 msgstr ""
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:981
+#: ui/KarbonView.cpp:985
 #, fuzzy
 msgid "Distribute Bottom Borders"
@@ -1079 +1086 @@
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:985
+#: ui/KarbonView.cpp:989
 #, fuzzy
 msgid "Distribute Top Borders"
@@ -1085 +1092 @@
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:989
+#: ui/KarbonView.cpp:993
 msgid "Show Rulers"
 msgstr "P&odnoÅŸje"
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:991
+#: ui/KarbonView.cpp:995
 #, fuzzy
 msgid "Hide Rulers"
@@ -1096 +1103 @@
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:992
+#: ui/KarbonView.cpp:996
 #, fuzzy
 msgid "Shows or hides rulers"
@@ -1102 +1109 @@
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:1003
+#: ui/KarbonView.cpp:1007
 msgid "Snap to Grid"
 msgstr "Poravnaj s rešetkom"
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:1005
+#: ui/KarbonView.cpp:1009
 #, fuzzy
 msgid "Snaps to grid"
@@ -1113 +1120 @@
 
 #. +> trunk
-#: ui/KarbonView.cpp:1017
+#: ui/KarbonView.cpp:1021
 #, fuzzy
 msgid "&Clip Object"
@@ -1119 +1126 @@
 
 #. +> trunk
-#: ui/KarbonView.cpp:1021
+#: ui/KarbonView.cpp:1025
 #, fuzzy
 #| msgid "&Group Objects"
@@ -1126 +1133 @@
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:1036
+#: ui/KarbonView.cpp:1040
 #, fuzzy
 msgid "&Close Path"
@@ -1132 +1139 @@
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:1042
+#: ui/KarbonView.cpp:1046
 msgid "Com&bine Path"
 msgstr ""
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:1048
+#: ui/KarbonView.cpp:1052
 msgid "Se&parate Path"
 msgstr ""
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:1054
+#: ui/KarbonView.cpp:1058
 msgid "Re&verse Path"
 msgstr ""
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:1060
+#: ui/KarbonView.cpp:1064
 msgid "Intersect Paths"
 msgstr ""
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:1066
+#: ui/KarbonView.cpp:1070
 #, fuzzy
 msgid "Subtract Paths"
@@ -1158 +1165 @@
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:1072
+#: ui/KarbonView.cpp:1076
 msgid "Unite Paths"
 msgstr ""
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:1078
+#: ui/KarbonView.cpp:1082
 msgid "Exclude Paths"
 msgstr ""
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:1084
+#: ui/KarbonView.cpp:1088
 #, fuzzy
 #| msgid "Snap to Grid"
@@ -1175 +1182 @@
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:1091
+#: ui/KarbonView.cpp:1095
 msgid "Configure Karbon..."
 msgstr ""
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:1095
+#: ui/KarbonView.cpp:1099
 msgid "Page &Layout..."
 msgstr ""
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:1100
+#: ui/KarbonView.cpp:1104
 #, fuzzy
 #| msgid "Selection"
@@ -1192 +1199 @@
 
 #. +> trunk stable
-#: ui/KarbonView.cpp:1104
+#: ui/KarbonView.cpp:1108
 msgid "Zoom to Drawing"
 msgstr ""

kde-croatia/kde4/summit/hr/summit/messages/koffice/koffice.po

@@ -6 +6 @@
 "Project-Id-Version: koffice 0\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-22 08:40+0200\n"
+"POT-Creation-Date: 2011-05-25 09:41+0200\n"
 "PO-Revision-Date: 2009-09-29 20:45+0200\n"
 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
@@ -4213 +4213 @@
 msgstr "Informacije o dokumentu"
 
+#. +> trunk
+#: pigment/compositeops/KoCompositeOpInversedSubtract.h:37
+#, fuzzy
+msgid "Inverse Subtract"
+msgstr "Informacije o dokumentu"
+
 #. +> trunk stable
 #: pigment/compositeops/KoCompositeOpOver.h:61
@@ -5782 +5788 @@
 
 #. +> trunk
-#: main/KoFindText.cpp:100
+#: main/KoFindText.cpp:101
 #, fuzzy
 msgid "Case Sensitive"
@@ -5788 +5794 @@
 
 #. +> trunk
-#: main/KoFindText.cpp:100
+#: main/KoFindText.cpp:101
 #, fuzzy
 msgid "Match cases when searching"
@@ -5794 +5800 @@
 
 #. +> trunk
-#: main/KoFindText.cpp:101
+#: main/KoFindText.cpp:102
 #, fuzzy
 msgid "Whole Words Only"
@@ -5800 +5806 @@
 
 #. +> trunk
-#: main/KoFindText.cpp:101
+#: main/KoFindText.cpp:102
 #, fuzzy
 msgid "Match only whole words"
@@ -6000 +6006 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:105
+#: pigment/compositeops/KoCompositeOps.h:102
+#, fuzzy
+msgid "Inversed-Subtract"
+msgstr "Informacije o dokumentu"
+
+#. +> trunk
+#: pigment/compositeops/KoCompositeOps.h:106
 #, fuzzy
 msgid "Arcus Tangent"
@@ -6006 +6018 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:106
+#: pigment/compositeops/KoCompositeOps.h:107
 #, fuzzy
 msgid "Difference"
@@ -6012 +6024 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:107
+#: pigment/compositeops/KoCompositeOps.h:108
 #, fuzzy
 msgid "Exclusion"
@@ -6018 +6030 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:108
+#: pigment/compositeops/KoCompositeOps.h:109
 #, fuzzy
 msgid "Equivalence"
@@ -6024 +6036 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:109
+#: pigment/compositeops/KoCompositeOps.h:110
 #, fuzzy
 msgid "Additive-Substractive"
@@ -6030 +6042 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:114
-#, fuzzy
-msgid "Copy Alpha"
-msgstr "Postavi sve"
-
-#. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:139
+#: pigment/compositeops/KoCompositeOps.h:137
 #, fuzzy
 msgid "Copy Red"
@@ -6042 +6048 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:140
+#: pigment/compositeops/KoCompositeOps.h:138
 #, fuzzy
 msgid "Copy Green"
@@ -6048 +6054 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:141
+#: pigment/compositeops/KoCompositeOps.h:139
 #, fuzzy
 msgid "Copy Blue"
@@ -6054 +6060 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:146
+#: pigment/compositeops/KoCompositeOps.h:144
 #, fuzzy
 msgid "Increase Saturation"
@@ -6060 +6066 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:147
+#: pigment/compositeops/KoCompositeOps.h:145
 #, fuzzy
 msgid "Decrease Saturation"
@@ -6066 +6072 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:148
+#: pigment/compositeops/KoCompositeOps.h:146
 #, fuzzy
 msgid "Luminosity"
@@ -6072 +6078 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:149
+#: pigment/compositeops/KoCompositeOps.h:147
 #, fuzzy
 msgid "Increase Luminosity"
@@ -6078 +6084 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:150
+#: pigment/compositeops/KoCompositeOps.h:148
 #, fuzzy
 msgid "Decrease Luminosity"
@@ -6084 +6090 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:152
+#: pigment/compositeops/KoCompositeOps.h:150
 #, fuzzy
 msgid "Color HSI"
@@ -6090 +6096 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:153
+#: pigment/compositeops/KoCompositeOps.h:151
 #, fuzzy
 msgid "Hue HSI"
@@ -6096 +6102 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:154
+#: pigment/compositeops/KoCompositeOps.h:152
 #, fuzzy
 msgid "Saturation HSI"
@@ -6102 +6108 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:155
+#: pigment/compositeops/KoCompositeOps.h:153
 #, fuzzy
 msgid "Increase Saturation HSI"
@@ -6108 +6114 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:156
+#: pigment/compositeops/KoCompositeOps.h:154
 #, fuzzy
 msgid "Decrease Saturation HSI"
@@ -6114 +6120 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:157
+#: pigment/compositeops/KoCompositeOps.h:155
 #, fuzzy
 msgid "Intensity"
@@ -6120 +6126 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:158
+#: pigment/compositeops/KoCompositeOps.h:156
 #, fuzzy
 #| msgid "Change Indent"
@@ -6127 +6133 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:159
+#: pigment/compositeops/KoCompositeOps.h:157
 #, fuzzy
 #| msgid "Change Indent"
@@ -6134 +6140 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:161
+#: pigment/compositeops/KoCompositeOps.h:159
 #, fuzzy
 msgid "Color HSL"
@@ -6140 +6146 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:162
+#: pigment/compositeops/KoCompositeOps.h:160
 #, fuzzy
 msgid "Hue HSL"
@@ -6146 +6152 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:163
+#: pigment/compositeops/KoCompositeOps.h:161
 #, fuzzy
 msgid "Saturation HSL"
@@ -6152 +6158 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:164
+#: pigment/compositeops/KoCompositeOps.h:162
 #, fuzzy
 msgid "Increase Saturation HSL"
@@ -6158 +6164 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:165
+#: pigment/compositeops/KoCompositeOps.h:163
 #, fuzzy
 msgid "Decrease Saturation HSL"
@@ -6164 +6170 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:167
+#: pigment/compositeops/KoCompositeOps.h:165
 #, fuzzy
 msgid "Increase Lightness"
@@ -6170 +6176 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:168
+#: pigment/compositeops/KoCompositeOps.h:166
 #, fuzzy
 msgid "Decrease Lightness"
@@ -6176 +6182 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:170
+#: pigment/compositeops/KoCompositeOps.h:168
 #, fuzzy
 msgid "Color HSV"
@@ -6182 +6188 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:171
+#: pigment/compositeops/KoCompositeOps.h:169
 #, fuzzy
 msgid "Hue HSV"
@@ -6188 +6194 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:172
+#: pigment/compositeops/KoCompositeOps.h:170
 #, fuzzy
 msgid "Saturation HSV"
@@ -6194 +6200 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:173
+#: pigment/compositeops/KoCompositeOps.h:171
 #, fuzzy
 msgid "Increase Saturation HSV"
@@ -6200 +6206 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:174
+#: pigment/compositeops/KoCompositeOps.h:172
 #, fuzzy
 msgid "Decrease Saturation HSV"
@@ -6206 +6212 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:175
+#: pigment/compositeops/KoCompositeOps.h:173
 msgid "Value"
 msgstr "Vrijednost"
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:176
+#: pigment/compositeops/KoCompositeOps.h:174
 #, fuzzy
 msgid "Increase Value"
@@ -6217 +6223 @@
 
 #. +> trunk
-#: pigment/compositeops/KoCompositeOps.h:177
+#: pigment/compositeops/KoCompositeOps.h:175
 #, fuzzy
 msgid "Decrease Value"
@@ -6465 +6471 @@
 msgid "Set miter limit"
 msgstr "došao do internog ograničenja"
+
+#, fuzzy
+#~ msgid "Copy Alpha"
+#~ msgstr "Postavi sve"
 
 #, fuzzy

kde-croatia/kde4/summit/hr/summit/messages/koffice/krita.po

@@ -7 +7 @@
 "Project-Id-Version: krita 0\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-23 09:11+0200\n"
+"POT-Creation-Date: 2011-05-25 09:41+0200\n"
 "PO-Revision-Date: 2011-03-18 18:21+0100\n"
 "Last-Translator: Marko Dimjašević <marko@dimjasevic.net>\n"
@@ -1655 +1655 @@
 #. i18n: ectx: Menu (view_fast_grid_config)
 #. +> trunk stable
-#: krita.rc:53
+#: krita.rc:52
 #, fuzzy
 msgid "Grid Spacing"
@@ -1662 +1662 @@
 #. i18n: ectx: Menu (Image)
 #. +> trunk stable
-#: krita.rc:73 plugins/colorspaces/lms_f32/lms_f32_plugin.rc:3
+#: krita.rc:72 plugins/colorspaces/lms_f32/lms_f32_plugin.rc:3
 #: plugins/extensions/colorspaceconversion/colorspaceconversion.rc:4
 #: plugins/extensions/dockers/trianglecolorselector/trianglecolorselector.rc:4
@@ -1673 +1673 @@
 #. i18n: ectx: Menu (Layer)
 #. +> trunk stable
-#: krita.rc:84 plugins/extensions/bracketing2hdr/bracketing2hdr.rc:4
+#: krita.rc:83 plugins/extensions/bracketing2hdr/bracketing2hdr.rc:4
 #: plugins/extensions/dockers/defaultdockers/kis_layer_box.cpp:310
 #: plugins/extensions/histogram/histogram.rc:4
@@ -1682 +1682 @@
 #. i18n: ectx: Menu (LayerNew)
 #. +> trunk stable
-#: krita.rc:85 plugins/extensions/bracketing2hdr/bracketing2hdr.rc:5
+#: krita.rc:84 plugins/extensions/bracketing2hdr/bracketing2hdr.rc:5
 #, fuzzy
 msgid "New"
@@ -1690 +1690 @@
 #. i18n: ectx: Menu (Select)
 #. +> trunk stable
-#: krita.rc:110 plugins/extensions/colorrange/wdg_colorrange.ui:133
+#: krita.rc:109 plugins/extensions/colorrange/wdg_colorrange.ui:133
 #: plugins/extensions/imagesize/imagesize.rc:12
 #: plugins/extensions/modify_selection/modify_selection.rc:4
@@ -1699 +1699 @@
 #. i18n: ectx: Menu (Filter)
 #. +> trunk stable
-#: krita.rc:124
+#: krita.rc:123
 #, fuzzy
 msgid "Filte&r"
@@ -1706 +1706 @@
 #. i18n: ectx: Menu (Tools)
 #. +> trunk stable
-#: krita.rc:141 plugins/extensions/extensionsmanager/extensionsmanager.rc:4
+#: krita.rc:140 plugins/extensions/extensionsmanager/extensionsmanager.rc:4
 #, fuzzy
 msgid "&Tools"
@@ -1714 +1714 @@
 #. i18n: ectx: Menu (settings)
 #. +> trunk stable
-#: krita.rc:144 plugins/filters/bumpmap/wdgbumpmap.ui:115
+#: krita.rc:143 plugins/filters/bumpmap/wdgbumpmap.ui:115
 msgid "Settings"
 msgstr "Postavke"
@@ -1720 +1720 @@
 #. i18n: ectx: Menu (help)
 #. +> trunk stable
-#: krita.rc:150
+#: krita.rc:151
 #, fuzzy
 msgid "&Help"
@@ -1727 +1727 @@
 #. i18n: ectx: ToolBar (BrushesAndStuff)
 #. +> trunk stable
-#: krita.rc:158
+#: krita.rc:159
 msgid "Brushes and Stuff"
 msgstr ""
@@ -2305 +2305 @@
 #: plugins/extensions/bracketing2hdr/wdgbracketing2hdr.ui:162
 #: plugins/extensions/tonemapping/wdgtonemappingdialog.ui:93
-#: ui/forms/wdgfilterdialog.ui:70 ui/kis_view2.cpp:398
+#: ui/forms/wdgfilterdialog.ui:70 ui/kis_view2.cpp:412
 #, fuzzy
 msgid "Cancel"
@@ -2764 +2764 @@
 
 #. +> trunk stable
-#: plugins/extensions/dockers/advancedcolorselector/kis_shade_selector_line.cpp:155
+#: plugins/extensions/dockers/advancedcolorselector/kis_shade_selector_line.cpp:154
 #, kde-format
 msgid "delta h=%1 s=%2 v=%3 shift h=%4 s=%5 v=%6"
@@ -13978 +13978 @@
 
 #. +> trunk stable
-#: ui/kis_view2.cpp:206
+#: ui/kis_view2.cpp:207
 msgid "Total Refresh"
 msgstr ""
 
 #. +> trunk stable
-#: ui/kis_view2.cpp:211
+#: ui/kis_view2.cpp:212
 #, fuzzy
 msgid "&Create Template From Image..."
@@ -13989 +13989 @@
 
 #. +> trunk stable
-#: ui/kis_view2.cpp:215
+#: ui/kis_view2.cpp:216
 #, fuzzy
 msgid "Load Tutorial"
@@ -13995 +13995 @@
 
 #. +> trunk stable
-#: ui/kis_view2.cpp:264
+#: ui/kis_view2.cpp:265
 #, fuzzy
 msgid "Mirror Image"
@@ -14018 +14018 @@
 msgstr "&Bijela"
 
+#. +> trunk
+#: ui/kis_view2.cpp:286
+#, fuzzy
+msgid "Show Status Bar"
+msgstr "PrikaÅŸi podnoÅŸje"
+
+#. +> trunk
+#: ui/kis_view2.cpp:287
+#, fuzzy
+#| msgid "Show &status bar"
+msgid "Hide Status Bar"
+msgstr "&PrikaÅŸi traku stanja"
+
 #. +> stable
 #: ui/kis_view2.cpp:287
@@ -14024 +14037 @@
 msgstr "&Alat za linije"
 
-#. +> trunk stable
-#: ui/kis_view2.cpp:392
+#. +> trunk
+#: ui/kis_view2.cpp:289
+#, fuzzy
+#| msgid "Show &status bar"
+msgid "Shows or hides the status bar"
+msgstr "&PrikaÅŸi traku stanja"
+
+#. +> trunk
+#: ui/kis_view2.cpp:293
+#, fuzzy
+msgid "Show Canvas Only"
+msgstr "Danas"
+
+#. +> trunk
+#: ui/kis_view2.cpp:294
+#, fuzzy
+msgid "Return to Window"
+msgstr "Podprozor"
+
+#. +> trunk
+#: ui/kis_view2.cpp:295
+#, fuzzy
+msgid "Shows just the canvas or the whole window"
+msgstr "PokaÅŸi ili sakrij traku izbornika u prozoru terminala"
+
+#. +> trunk stable
+#: ui/kis_view2.cpp:406
 #, fuzzy
 msgid "Insert as New Layer"
@@ -14031 +14069 @@
 
 #. +> trunk stable
-#: ui/kis_view2.cpp:393
+#: ui/kis_view2.cpp:407
 #, fuzzy
 msgid "Insert as New Layers"
@@ -14037 +14075 @@
 
 #. +> trunk stable
-#: ui/kis_view2.cpp:395
+#: ui/kis_view2.cpp:409
 msgid "Open in New Document"
 msgstr ""
 
 #. +> trunk stable
-#: ui/kis_view2.cpp:396
+#: ui/kis_view2.cpp:410
 msgid "Open in New Documents"
 msgstr ""
 
 #. +> trunk stable
-#: ui/kis_view2.cpp:606
+#: ui/kis_view2.cpp:620
 #, fuzzy
 msgid "Edit Palette..."
@@ -14053 +14091 @@
 
 #. +> trunk stable
-#: ui/kis_view2.cpp:721 ui/kis_view2.cpp:724
+#: ui/kis_view2.cpp:735 ui/kis_view2.cpp:738
 #, fuzzy
 msgid "Edit Palette"

kde-croatia/kde4/summit/hr/summit/messages/koffice/kword.po

@@ -6 +6 @@
 "Project-Id-Version: kword 0\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-21 08:10+0200\n"
+"POT-Creation-Date: 2011-05-25 09:42+0200\n"
 "PO-Revision-Date: 2009-09-29 21:20+0200\n"
 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n"
@@ -648 +648 @@
 #. i18n: ectx: property (text), widget (QPushButton, createButton)
 #. +> trunk stable
-#: part/dialogs/KWStartupWidget.ui:102 part/KWView.cpp:330
+#: part/dialogs/KWStartupWidget.ui:102 part/KWView.cpp:334
 msgid "Create"
 msgstr "Napravi"
@@ -753 +753 @@
 #. +> trunk stable
 #: part/dialogs/KWStatisticsDialog.cpp:29
-#: part/dockers/KWStatisticsDocker.cpp:36 part/KWView.cpp:404
+#: part/dockers/KWStatisticsDocker.cpp:36 part/KWView.cpp:408
 msgid "Statistics"
 msgstr "Statistike"
@@ -1567 +1567 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:256
+#: part/KWView.cpp:260
 #, fuzzy
 msgid "Frame/Frameset Properties"
@@ -1573 +1573 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:258
+#: part/KWView.cpp:262
 #, fuzzy
 msgid "Alter frameset properties"
@@ -1585 +1585 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:266
+#: part/KWView.cpp:270
 msgid "Page Break"
 msgstr "Prijelom stranice"
 
 #. +> trunk stable
-#: part/KWView.cpp:267
+#: part/KWView.cpp:271
 msgid "Force the remainder of the text into the next page"
 msgstr ""
 
 #. +> trunk stable
-#: part/KWView.cpp:268
+#: part/KWView.cpp:272
 msgid "All text after this point will be moved into the next page."
 msgstr ""
 
 #. +> trunk stable
-#: part/KWView.cpp:270
+#: part/KWView.cpp:274
 msgid "Enable Document Headers"
 msgstr "Omogući zaglavlja dokumenta"
 
 #. +> trunk stable
-#: part/KWView.cpp:272
+#: part/KWView.cpp:276
 msgid "Disable Document Headers"
 msgstr "Onemogući zaglavlja dokumenta"
 
 #. +> trunk stable
-#: part/KWView.cpp:273
+#: part/KWView.cpp:277
 #, fuzzy
 msgid "Shows and hides header display"
@@ -1616 +1616 @@
 
 #. +> trunk
-#: part/KWView.cpp:274
+#: part/KWView.cpp:278
 msgid "Selecting this option toggles the display of headers in Words.<br/><br/>Headers are special frames at the top of each page which can contain page numbers or other information."
 msgstr ""
@@ -1631 +1631 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:279
+#: part/KWView.cpp:283
 msgid "Enable Document Footers"
 msgstr "Omogući podnoÅŸja dokumenta"
 
 #. +> trunk stable
-#: part/KWView.cpp:281
+#: part/KWView.cpp:285
 msgid "Disable Document Footers"
 msgstr "Omogući podnoÅŸja dokumenta"
 
 #. +> trunk stable
-#: part/KWView.cpp:282
+#: part/KWView.cpp:286
 #, fuzzy
 msgid "Shows and hides footer display"
@@ -1647 +1647 @@
 
 #. +> trunk
-#: part/KWView.cpp:283
+#: part/KWView.cpp:287
 msgid "Selecting this option toggles the display of footers in Words. <br/><br/>Footers are special frames at the bottom of each page which can contain page numbers or other information."
 msgstr ""
@@ -1662 +1662 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:288
+#: part/KWView.cpp:292
 #, fuzzy
 msgid "Snap to Grid"
@@ -1668 +1668 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:293
+#: part/KWView.cpp:297
 #, fuzzy
 msgid "Raise Frame"
@@ -1680 +1680 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:296
+#: part/KWView.cpp:300
 #, fuzzy
 msgid "Raise the currently selected frame so that it appears above all the other frames"
@@ -1692 +1692 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:298
+#: part/KWView.cpp:302
 msgid "Raise the currently selected frame so that it appears above all the other frames. This is only useful if frames overlap each other. If multiple frames are selected they are all raised in turn."
 msgstr ""
@@ -1702 +1702 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:303
+#: part/KWView.cpp:307
 #, fuzzy
 msgid "Lower Frame"
@@ -1714 +1714 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:306
+#: part/KWView.cpp:310
 msgid "Lower the currently selected frame so that it disappears under any frame that overlaps it"
 msgstr ""
@@ -1725 +1725 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:308
+#: part/KWView.cpp:312
 msgid "Lower the currently selected frame so that it disappears under any frame that overlaps it. If multiple frames are selected they are all lowered in turn."
 msgstr ""
@@ -1735 +1735 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:312
+#: part/KWView.cpp:316
 msgid "Bring to Front"
 msgstr "Stavi ispred"
 
 #. +> trunk stable
-#: part/KWView.cpp:316
+#: part/KWView.cpp:320
 msgid "Send to Back"
 msgstr "Pošalji unazad"
 
 #. +> trunk stable
-#: part/KWView.cpp:320
+#: part/KWView.cpp:324
 msgid "Variable"
 msgstr "Varijabla"
 
 #. +> trunk stable
-#: part/KWView.cpp:338
+#: part/KWView.cpp:342
 msgid "Bookmark..."
 msgstr "Oznaka 
"
 
 #. +> trunk stable
-#: part/KWView.cpp:343
+#: part/KWView.cpp:347
 #, fuzzy
 msgid "Select Bookmark..."
@@ -1761 +1761 @@
 
 #. +> trunk
-#: part/KWView.cpp:344
+#: part/KWView.cpp:348
 #, fuzzy
 msgid "Bookmark"
@@ -1767 +1767 @@
 
 #. +> trunk
-#: part/KWView.cpp:350
+#: part/KWView.cpp:354
 #, fuzzy
 msgid "Picture..."
@@ -1778 +1778 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:351
+#: part/KWView.cpp:355
 msgid "Insert a picture into document"
 msgstr ""
@@ -1789 +1789 @@
 
 #. +> trunk
-#: part/KWView.cpp:355
+#: part/KWView.cpp:359
 msgid "Footnote/Endnote..."
 msgstr ""
 
 #. +> trunk
-#: part/KWView.cpp:356
+#: part/KWView.cpp:360
 #, fuzzy
 msgid "Insert a footnote referencing the selected text"
@@ -1800 +1800 @@
 
 #. +> trunk
-#: part/KWView.cpp:360
+#: part/KWView.cpp:363
+#, fuzzy
+msgid "Anchor to Text"
+msgstr "Tekst objave"
+
+#. +> trunk
+#: part/KWView.cpp:364
 #, fuzzy
 msgid "Page Borders"
@@ -1817 +1823 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:361
+#: part/KWView.cpp:365
 msgid "Turns the border display on and off"
 msgstr ""
@@ -1826 +1832 @@
 msgstr ""
 
-#. +> trunk
-#: part/KWView.cpp:363
-#, fuzzy
-msgid "Anchor to Text"
-msgstr "Tekst objave"
-
-#. +> trunk stable
-#: part/KWView.cpp:366
+#. +> trunk stable
+#: part/KWView.cpp:370
 msgid "Turns the border display on and off.<br/><br/>The borders are never printed. This option is useful to see how the document will appear on the printed page."
 msgstr ""
 
 #. +> trunk stable
-#: part/KWView.cpp:368
+#: part/KWView.cpp:372
 #, fuzzy
 #| msgid "Page &Layout..."
@@ -1845 +1845 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:370
+#: part/KWView.cpp:374
 msgid "Change properties of entire page"
 msgstr "Promijeni svojstva cijele stranice"
 
 #. +> trunk stable
-#: part/KWView.cpp:371
+#: part/KWView.cpp:375
 msgid "Change properties of the entire page.<p>Currently you can change paper size, paper orientation, header and footer sizes, and column settings.</p>"
 msgstr ""
 
 #. +> trunk stable
-#: part/KWView.cpp:375
+#: part/KWView.cpp:379
 #, fuzzy
 msgid "Semantic Stylesheets..."
@@ -1861 +1861 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:377
+#: part/KWView.cpp:381
 msgid "Modify and add semantic stylesheets"
 msgstr ""
 
 #. +> trunk stable
-#: part/KWView.cpp:378
+#: part/KWView.cpp:382
 msgid "Stylesheets are used to format contact, event, and location information which is stored in Rdf"
 msgstr ""
 
 #. +> trunk stable
-#: part/KWView.cpp:382
+#: part/KWView.cpp:386
 #, fuzzy
 msgid "Make inline"
@@ -1877 +1877 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:383
+#: part/KWView.cpp:387
 #, fuzzy
 msgid "Convert current frame to an inline frame"
@@ -1889 +1889 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:384
+#: part/KWView.cpp:388
 msgid "Convert the current frame to an inline frame.<br><br>Place the inline frame within the text at the point nearest to the frames current position."
 msgstr ""
@@ -1899 +1899 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:388
+#: part/KWView.cpp:392
 #, fuzzy
 msgid "Previous Page"
@@ -1905 +1905 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:392
+#: part/KWView.cpp:396
 #, fuzzy
 msgid "Next Page"
@@ -1917 +1917 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:406
+#: part/KWView.cpp:410
 msgid "Sentence, word and letter counts for this document"
 msgstr ""
 
 #. +> trunk stable
-#: part/KWView.cpp:407
+#: part/KWView.cpp:411
 msgid "Information on the number of letters, words, syllables and sentences for this document.<p>Evaluates readability using the Flesch reading score.</p>"
 msgstr ""
 
 #. +> trunk stable
-#: part/KWView.cpp:410
+#: part/KWView.cpp:414
 msgid "Show Rulers"
 msgstr "P&odnoÅŸje"
 
 #. +> trunk stable
-#: part/KWView.cpp:412
+#: part/KWView.cpp:416
 #, fuzzy
 msgid "Shows or hides rulers"
@@ -1938 +1938 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:413
+#: part/KWView.cpp:417
 msgid "The rulers are the white measuring spaces top and left of the document. The rulers show the position and width of pages and of frames and can be used to position tabulators among others.<p>Uncheck this to disable the rulers from being displayed.</p>"
 msgstr ""
@@ -1948 +1948 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:421
+#: part/KWView.cpp:425
 #, fuzzy
 msgid "Page..."
@@ -1954 +1954 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:425
+#: part/KWView.cpp:429
 msgid "Delete Page"
 msgstr "Izbriši tabelu"
 
 #. +> trunk stable
-#: part/KWView.cpp:432
+#: part/KWView.cpp:436
 #, fuzzy
 #| msgid "&Formatting Characters"
@@ -1966 +1966 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:436
+#: part/KWView.cpp:440
 msgid "Toggle the display of non-printing characters"
 msgstr ""
 
 #. +> trunk
-#: part/KWView.cpp:437
+#: part/KWView.cpp:441
 msgid "Toggle the display of non-printing characters.<br/><br/>When this is enabled, Words shows you tabs, spaces, carriage returns and other non-printing characters."
 msgstr ""
@@ -1981 +1981 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:440
+#: part/KWView.cpp:444
 #, fuzzy
 msgid "Select All Frames"
@@ -1995 +1995 @@
 #: part/KWView.cpp:445
 #, fuzzy
+msgid "Create Custom Outline"
+msgstr "Napravi &tabelu"
+
+#. +> trunk stable
+#: part/KWView.cpp:447
+msgid "Create a custom vector outline that text will run around"
+msgstr ""
+
+#. +> trunk stable
+#: part/KWView.cpp:448
+msgid "Text normally runs around the content of a shape, when you want a custom outline that is independent of the content you can create one and alter it with the vector tools"
+msgstr ""
+
+#. +> trunk stable
+#: part/KWView.cpp:449
+#, fuzzy
 msgid "Delete"
 msgstr "Izbriši Red"
 
 #. +> trunk stable
-#: part/KWView.cpp:445
-#, fuzzy
-msgid "Create Custom Outline"
-msgstr "Napravi &tabelu"
-
-#. +> trunk stable
-#: part/KWView.cpp:447
-msgid "Create a custom vector outline that text will run around"
-msgstr ""
-
-#. +> trunk stable
-#: part/KWView.cpp:448
-msgid "Text normally runs around the content of a shape, when you want a custom outline that is independent of the content you can create one and alter it with the vector tools"
-msgstr ""
-
-#. +> trunk stable
-#: part/KWView.cpp:458 part/KWView.cpp:1226
+#: part/KWView.cpp:459
+#, fuzzy
+msgid "Add Text on Shape"
+msgstr "Dodaj tekst&ualnu oznaku"
+
+#. +> trunk stable
+#: part/KWView.cpp:462 part/KWView.cpp:1230
 #, fuzzy
 msgid "Create Linked Copy"
@@ -2021 +2027 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:459
-#, fuzzy
-msgid "Add Text on Shape"
-msgstr "Dodaj tekst&ualnu oznaku"
-
-#. +> trunk stable
 #: part/KWView.cpp:1224
 #, fuzzy
@@ -2033 +2033 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:460
+#: part/KWView.cpp:464
 msgid "Create a copy of the current frame, always showing the same contents"
 msgstr ""
@@ -2043 +2043 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:461
+#: part/KWView.cpp:465
 msgid "Create a copy of the current frame, that remains linked to it. This means they always show the same contents: modifying the contents in such a frame will update all its linked copies."
 msgstr ""
@@ -2053 +2053 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:464
+#: part/KWView.cpp:468
 #, fuzzy
 msgid "Create Frame-clip"
@@ -2065 +2065 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:468
+#: part/KWView.cpp:472
 #, fuzzy
 msgid "Remove Frame-clip"
@@ -2077 +2077 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:472
+#: part/KWView.cpp:476
 #, fuzzy
 msgid "Show Status Bar"
@@ -2083 +2083 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:473
+#: part/KWView.cpp:477
 #, fuzzy
 #| msgid "Show &status bar"
@@ -2090 +2090 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:474
+#: part/KWView.cpp:478
 #, fuzzy
 #| msgid "Show &status bar"
@@ -2097 +2097 @@
 
 #. +> trunk stable
-#: part/KWView.cpp:1165
+#: part/KWView.cpp:1169
 msgid "Please select at least one non-locked shape and try again"
 msgstr ""

kde-croatia/kde4/summit/hr/summit/messages/playground-base/desktop_playground-base.po

@@ -9 +9 @@
 "Project-Id-Version: desktop files\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-16 09:02+0200\n"
+"POT-Creation-Date: 2011-05-25 09:42+0200\n"
 "PO-Revision-Date: 2010-04-30 19:05+0200\n"
 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
@@ -1092 +1092 @@
 
 #. +> trunk
-#: plasma/applets/dataengines_tasks/plasma-applet-dataengines_tasks.desktop:8
+#: plasma/applets/dataengines_tasks/plasma-applet-dataengines_tasks.desktop:9
 msgctxt "Comment"
 msgid "Applet displaying tasks using dataengines"

kde-croatia/kde4/summit/hr/summit/messages/playground-multimedia/desktop_playground-multimedia_plasma-mediacenter.po

@@ -9 +9 @@
 "Project-Id-Version: desktop files\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-05-23 09:11+0200\n"
+"POT-Creation-Date: 2011-05-25 09:42+0200\n"
 "PO-Revision-Date: 2010-04-30 19:05+0200\n"
 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n"
@@ -259 +259 @@
 
 #. +> trunk
+#: dataengines/mediacentercontrol/plasma-engine-mediacentercontrol.desktop:2
+#, fuzzy
+msgctxt "Name"
+msgid "MediaCenterControl"
+msgstr "MultiMedijaUpravitelj"
+
+#. +> trunk
+#: dataengines/mediacentercontrol/plasma-engine-mediacentercontrol.desktop:3
+#, fuzzy
+msgctxt "Comment"
+msgid " controlling the MediaCenter"
+msgstr "Upravljanje sjednicama."
+
+#. +> trunk
 #: dataengines/picasa/plasma-engine-picasa.desktop:2
 #, fuzzy