Changeset 1036 for kde-croatia
- Timestamp:
- May 26, 2011, 3:08:15 AM (14 years ago)
- Location:
- kde-croatia/kde4/summit/hr/summit/messages
- Files:
-
- 33 edited
Legend:
- Unmodified
- Added
- Removed
-
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/extragear-base/plasma_applet_networkmanagement.po ¶
r1027 r1036 7 7 "Project-Id-Version: \n" 8 8 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 9 "POT-Creation-Date: 2011-05-2 0 07:30+0200\n"9 "POT-Creation-Date: 2011-05-25 09:36+0200\n" 10 10 "PO-Revision-Date: 2011-03-03 22:15+0100\n" 11 11 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n" … … 324 324 325 325 #. +> trunk 326 #: nmpopup.cpp:88 nmpopup.cpp:75 2326 #: nmpopup.cpp:88 nmpopup.cpp:758 327 327 msgctxt "title on the LHS of the plasmoid" 328 328 msgid "<h3>Interfaces</h3>" … … 388 388 389 389 #. +> trunk 390 #: nmpopup.cpp:6 69390 #: nmpopup.cpp:675 391 391 msgctxt "pressed show more button" 392 392 msgid "Show Less..." … … 394 394 395 395 #. +> trunk 396 #: nmpopup.cpp:6 74396 #: nmpopup.cpp:680 397 397 msgctxt "unpressed show more button" 398 398 msgid "Show More..." -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/extragear-graphics/digikam.po ¶
r1031 r1036 7 7 "Project-Id-Version: \n" 8 8 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 9 "POT-Creation-Date: 2011-05-2 2 08:35+0200\n"9 "POT-Creation-Date: 2011-05-25 09:36+0200\n" 10 10 "PO-Revision-Date: 2011-03-11 10:04+0100\n" 11 11 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n" … … 3523 3523 3524 3524 #. +> trunk 3525 #: digikam/views/digikamview.cpp:881 libs/database/schemaupdater.cpp:96 53525 #: digikam/views/digikamview.cpp:881 libs/database/schemaupdater.cpp:964 3526 3526 #, fuzzy 3527 3527 msgid "Last Search" … … 6851 6851 6852 6852 #. +> trunk 6853 #: libs/database/schemaupdater.cpp:21 16853 #: libs/database/schemaupdater.cpp:210 6854 6854 msgid "The database is not valid: the \"DBVersion\" setting does not exist. The current database schema version cannot be verified. Try to start with an empty database. " 6855 6855 msgstr "" 6856 6856 6857 6857 #. +> trunk 6858 #: libs/database/schemaupdater.cpp:2 406858 #: libs/database/schemaupdater.cpp:239 6859 6859 msgid "The database has been used with a more recent version of digiKam and has been updated to a database schema which cannot be used with this version. (This means this digiKam version is too old, or the database format is too recent.) Please use the more recent version of digiKam that you used before. " 6860 6860 msgstr "" 6861 6861 6862 6862 #. +> trunk 6863 #: libs/database/schemaupdater.cpp:31 26863 #: libs/database/schemaupdater.cpp:311 6864 6864 #: libs/database/thumbnailschemaupdater.cpp:173 6865 6865 msgid "" … … 6869 6869 6870 6870 #. +> trunk 6871 #: libs/database/schemaupdater.cpp:33 46871 #: libs/database/schemaupdater.cpp:333 6872 6872 #, kde-format 6873 6873 msgid "Failed to open a database transaction on your database file \"%1\". This is unusual. Please check that you can access the file and no other process has currently locked the file. If the problem persists you can get help from the digikam-devel@kde.org mailing list. As well, please have a look at what digiKam prints on the console. " … … 6875 6875 6876 6876 #. +> trunk 6877 #: libs/database/schemaupdater.cpp:39 16877 #: libs/database/schemaupdater.cpp:390 6878 6878 #, kde-format 6879 6879 msgid "The schema updating process from version 4 to 6 failed, caused by an error that we did not expect. You can try to discard your old database and start with an empty one. (In this case, please move the database files \"%1\" and \"%2\" from the directory \"%3\"). More probably you will want to report this error to the digikam-devel@kde.org mailing list. As well, please have a look at what digiKam prints on the console. " … … 6881 6881 6882 6882 #. +> trunk 6883 #: libs/database/schemaupdater.cpp:41 96883 #: libs/database/schemaupdater.cpp:418 6884 6884 msgid "Failed to update the database schema from version 5 to version 6. Please read the error messages printed on the console and report this error as a bug at bugs.kde.org. " 6885 6885 msgstr "" 6886 6886 6887 6887 #. +> trunk 6888 #: libs/database/schemaupdater.cpp:57 86888 #: libs/database/schemaupdater.cpp:577 6889 6889 msgid "The database update action cannot be found. Please ensure that the dbconfig.xml file of the current version of digiKam is installed at the correct place. " 6890 6890 msgstr "" 6891 6891 6892 6892 #. +> trunk 6893 #: libs/database/schemaupdater.cpp:59 76893 #: libs/database/schemaupdater.cpp:596 6894 6894 msgid "Updated schema to version 6." 6895 6895 msgstr "" 6896 6896 6897 6897 #. +> trunk 6898 #: libs/database/schemaupdater.cpp:62 46898 #: libs/database/schemaupdater.cpp:623 6899 6899 #, kde-format 6900 6900 msgid "Failed to copy the old database file (\"%1\") to its new location (\"%2\"). Error message: \"%3\". Please make sure that the file can be copied, or delete it." … … 6902 6902 6903 6903 #. +> trunk 6904 #: libs/database/schemaupdater.cpp:64 46904 #: libs/database/schemaupdater.cpp:643 6905 6905 msgid "Copied database file" 6906 6906 msgstr "" 6907 6907 6908 6908 #. +> trunk 6909 #: libs/database/schemaupdater.cpp:64 96909 #: libs/database/schemaupdater.cpp:648 6910 6910 #, kde-format 6911 6911 msgid "The old database file (\"%1\") has been copied to the new location (\"%2\") but it cannot be opened. Please delete both files and try again, starting with an empty database. " … … 6913 6913 6914 6914 #. +> trunk 6915 #: libs/database/schemaupdater.cpp:66 96915 #: libs/database/schemaupdater.cpp:668 6916 6916 msgid "Opened new database file" 6917 6917 msgstr "" 6918 6918 6919 6919 #. +> trunk 6920 #: libs/database/schemaupdater.cpp:6 906920 #: libs/database/schemaupdater.cpp:689 6921 6921 #, kde-format 6922 6922 msgid "Could not update from the old SQLite2 file (\"%1\"). Please delete this file and try again, starting with an empty database. " … … 6924 6924 6925 6925 #. +> trunk 6926 #: libs/database/schemaupdater.cpp:70 66926 #: libs/database/schemaupdater.cpp:705 6927 6927 msgid "Updated from 0.7 database" 6928 6928 msgstr "" 6929 6929 6930 6930 #. +> trunk 6931 #: libs/database/schemaupdater.cpp:79 46931 #: libs/database/schemaupdater.cpp:793 6932 6932 msgid "Prepared table creation" 6933 6933 msgstr "" 6934 6934 6935 6935 #. +> trunk 6936 #: libs/database/schemaupdater.cpp:81 36936 #: libs/database/schemaupdater.cpp:812 6937 6937 msgid "Created tables" 6938 6938 msgstr "" 6939 6939 6940 6940 #. +> trunk 6941 #: libs/database/schemaupdater.cpp:82 66941 #: libs/database/schemaupdater.cpp:825 6942 6942 msgid "No album library path has been found in the configuration file. Giving up the schema updating process. Please try with an empty database, or repair your configuration." 6943 6943 msgstr "" 6944 6944 6945 6945 #. +> trunk 6946 #: libs/database/schemaupdater.cpp:84 76946 #: libs/database/schemaupdater.cpp:846 6947 6947 #, kde-format 6948 6948 msgid "There was an error associating your albumLibraryPath (\"%1\") with a storage volume of your system. This problem may indicate that there is a problem with your installation. If you are working on Linux, check that HAL is installed and running. In any case, you can seek advice from the digikam-devel@kde.org mailing list. The database updating process will now be aborted because we do not want to create a new database based on false assumptions from a broken installation." … … 6950 6950 6951 6951 #. +> trunk 6952 #: libs/database/schemaupdater.cpp:87 46952 #: libs/database/schemaupdater.cpp:873 6953 6953 msgid "Configured one album root" 6954 6954 msgstr "" 6955 6955 6956 6956 #. +> trunk 6957 #: libs/database/schemaupdater.cpp: 9006957 #: libs/database/schemaupdater.cpp:899 6958 6958 msgid "Imported albums" 6959 6959 msgstr "" 6960 6960 6961 6961 #. +> trunk 6962 #: libs/database/schemaupdater.cpp:93 66962 #: libs/database/schemaupdater.cpp:935 6963 6963 msgid "Imported images information" 6964 6964 msgstr "" 6965 6965 6966 6966 #. +> trunk 6967 #: libs/database/schemaupdater.cpp:96 76967 #: libs/database/schemaupdater.cpp:966 6968 6968 #, fuzzy 6969 6969 msgid "Last Search (0.9)" … … 6971 6971 6972 6972 #. +> trunk 6973 #: libs/database/schemaupdater.cpp:102 46973 #: libs/database/schemaupdater.cpp:1023 6974 6974 msgid "Initialized and imported file suffix filter" 6975 6975 msgstr "" 6976 6976 6977 6977 #. +> trunk 6978 #: libs/database/schemaupdater.cpp:104 66978 #: libs/database/schemaupdater.cpp:1045 6979 6979 msgid "Did the initial full scan" 6980 6980 msgstr "" 6981 6981 6982 6982 #. +> trunk 6983 #: libs/database/schemaupdater.cpp:10 706983 #: libs/database/schemaupdater.cpp:1069 6984 6984 msgid "Imported creation dates" 6985 6985 msgstr "" 6986 6986 6987 6987 #. +> trunk 6988 #: libs/database/schemaupdater.cpp:1 1006988 #: libs/database/schemaupdater.cpp:1099 6989 6989 msgid "Imported comments" 6990 6990 msgstr "" 6991 6991 6992 6992 #. +> trunk 6993 #: libs/database/schemaupdater.cpp:112 66993 #: libs/database/schemaupdater.cpp:1125 6994 6994 msgid "Imported ratings" 6995 6995 msgstr "" 6996 6996 6997 6997 #. +> trunk 6998 #: libs/database/schemaupdater.cpp:113 76998 #: libs/database/schemaupdater.cpp:1136 6999 6999 msgid "Dropped v3 tables" 7000 7000 msgstr "" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/extragear-kdevelop/kdevcmake.po ¶
r1016 r1036 6 6 "Project-Id-Version: \n" 7 7 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 8 "POT-Creation-Date: 2011-05- 12 09:39+0200\n"8 "POT-Creation-Date: 2011-05-25 09:36+0200\n" 9 9 "PO-Revision-Date: 2010-01-24 16:58+0100\n" 10 10 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n" … … 319 319 320 320 #. +> trunk 321 #: cmakemanager.cpp:141 7321 #: cmakemanager.cpp:1418 322 322 #, kde-format 323 323 msgid "Modify target '%2' as follows:" … … 325 325 326 326 #. +> trunk 327 #: cmakemanager.cpp:142 4327 #: cmakemanager.cpp:1425 328 328 #, fuzzy 329 329 msgid "CMakeLists changes failed." … … 337 337 338 338 #. +> trunk 339 #: cmakemanager.cpp:143 3339 #: cmakemanager.cpp:1434 340 340 #, fuzzy, kde-format 341 341 msgid "Rename '%1' to '%2':" … … 343 343 344 344 #. +> trunk 345 #: cmakemanager.cpp:145 2345 #: cmakemanager.cpp:1453 346 346 msgid "Changes to CMakeLists failed, abort rename?" 347 347 msgstr "" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/desktop_extragear-multimedia_amarok.po ¶
r1031 r1036 7 7 "Project-Id-Version: desktop files\n" 8 8 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 9 "POT-Creation-Date: 2011-05-2 2 08:35+0200\n"9 "POT-Creation-Date: 2011-05-25 09:37+0200\n" 10 10 "PO-Revision-Date: 2010-07-08 15:31+0200\n" 11 11 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n" … … 78 78 79 79 #. +> trunk 80 #: playground/src/context/engines/jsengine/metadata.desktop:4 280 #: playground/src/context/engines/jsengine/metadata.desktop:43 81 81 msgctxt "Comment" 82 82 msgid "Javascript Sample Engine" … … 322 322 323 323 #. +> trunk 324 #: src/context/scriptengine/javascript/amarok-scriptengine-applet-simple-javascript.desktop:4 6324 #: src/context/scriptengine/javascript/amarok-scriptengine-applet-simple-javascript.desktop:47 325 325 msgctxt "Comment" 326 326 msgid "Native Amarok applet written in JavaScript" … … 372 372 373 373 #. +> trunk 374 #: src/core-impl/collections/audiocd/amarok_collection-audiocdcollection.desktop: 49374 #: src/core-impl/collections/audiocd/amarok_collection-audiocdcollection.desktop:50 375 375 msgctxt "Comment" 376 376 msgid "AudioCd collection plugin for Amarok" … … 432 432 433 433 #. +> trunk 434 #: src/core-impl/collections/db/sql/mysqlecollection/amarok_collection-mysqlecollection.desktop:4 8435 #: src/core-impl/collections/db/sql/mysqlservercollection/amarok_collection-mysqlservercollection.desktop:4 8434 #: src/core-impl/collections/db/sql/mysqlecollection/amarok_collection-mysqlecollection.desktop:49 435 #: src/core-impl/collections/db/sql/mysqlservercollection/amarok_collection-mysqlservercollection.desktop:49 436 436 msgctxt "Comment" 437 437 msgid "Collection plugin for Amarok" … … 494 494 495 495 #. +> trunk 496 #: src/core-impl/collections/playdarcollection/amarok_collection-playdarcollection.desktop:2 8496 #: src/core-impl/collections/playdarcollection/amarok_collection-playdarcollection.desktop:29 497 497 msgctxt "Comment" 498 498 msgid "Music that Playdar can find" … … 524 524 525 525 #. +> trunk 526 #: src/data/amarok.notifyrc:5 0526 #: src/data/amarok.notifyrc:51 527 527 msgctxt "Name" 528 528 msgid "Track Change" … … 530 530 531 531 #. +> trunk 532 #: src/data/amarok.notifyrc:9 2532 #: src/data/amarok.notifyrc:94 533 533 msgctxt "Comment" 534 534 msgid "Amarok changed to a new track" … … 542 542 543 543 #. +> trunk 544 #: src/services/ampache/amarok_service_ampache.desktop:5 4544 #: src/services/ampache/amarok_service_ampache.desktop:55 545 545 msgctxt "Comment" 546 546 msgid "Listen to music from an Ampache server" … … 566 566 567 567 #. +> trunk 568 #: src/services/gpodder/amarok_service_gpodder.desktop:2 4568 #: src/services/gpodder/amarok_service_gpodder.desktop:26 569 569 #, fuzzy 570 570 msgctxt "Comment" … … 582 582 583 583 #. +> trunk 584 #: src/services/jamendo/amarok_service_jamendo.desktop:5 6584 #: src/services/jamendo/amarok_service_jamendo.desktop:57 585 585 msgctxt "Comment" 586 586 msgid "Listen to and download music uploaded by independent artists" … … 594 594 595 595 #. +> trunk 596 #: src/services/lastfm/amarok_service_lastfm.desktop:5 5596 #: src/services/lastfm/amarok_service_lastfm.desktop:56 597 597 msgctxt "Comment" 598 598 msgid "A service that integrates Last.fm functionality into Amarok" … … 642 642 643 643 #. +> trunk 644 #: src/services/mp3tunes/amarok_service_mp3tunes.desktop:4 4644 #: src/services/mp3tunes/amarok_service_mp3tunes.desktop:45 645 645 msgctxt "Comment" 646 646 msgid "Browse and listen to the music stored in your MP3tunes account" … … 655 655 656 656 #. +> trunk 657 #: src/services/mp3tunes/amarok_service_mp3tunes_config.desktop: 49657 #: src/services/mp3tunes/amarok_service_mp3tunes_config.desktop:50 658 658 msgctxt "Comment" 659 659 msgid "Configure mp3tunes credentials" … … 667 667 668 668 #. +> trunk 669 #: src/services/opmldirectory/amarok_service_opmldirectory.desktop:5 2669 #: src/services/opmldirectory/amarok_service_opmldirectory.desktop:53 670 670 msgctxt "Comment" 671 671 msgid "Browse and subscribe to a huge list of podcasts" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/desktop_extragear-multimedia_k3b.po ¶
r1031 r1036 8 8 "Project-Id-Version: desktop files\n" 9 9 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 10 "POT-Creation-Date: 2011-05-2 2 08:35+0200\n"10 "POT-Creation-Date: 2011-05-25 09:37+0200\n" 11 11 "PO-Revision-Date: 2011-05-21 13:00+0200\n" 12 12 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" … … 29 29 30 30 #. +> trunk stable 31 #: k3bsetup/k3bsetup.actions:4 131 #: k3bsetup/k3bsetup.actions:42 32 32 msgctxt "Description" 33 33 msgid "Authentication is required to update permissions of devices and programs" … … 41 41 42 42 #. +> trunk stable 43 #: k3bsetup/k3bsetup.desktop:4 643 #: k3bsetup/k3bsetup.desktop:47 44 44 msgctxt "Keywords" 45 45 msgid "K3bSetup,k3bsetup" … … 47 47 48 48 #. +> trunk stable 49 #: k3bsetup/k3bsetup.desktop:9 049 #: k3bsetup/k3bsetup.desktop:92 50 50 msgctxt "Name" 51 51 msgid "K3bSetup" … … 53 53 54 54 #. +> trunk stable 55 #: k3bsetup/k3bsetup.desktop:15 755 #: k3bsetup/k3bsetup.desktop:159 56 56 msgctxt "GenericName" 57 57 msgid "CD/DVD/BD Burning Setup" … … 263 263 264 264 #. +> trunk stable 265 #: plugins/project/audiometainforenamer/k3baudiometainforenamerplugin.desktop:4 1265 #: plugins/project/audiometainforenamer/k3baudiometainforenamerplugin.desktop:42 266 266 msgctxt "Comment" 267 267 msgid "Plugin to rename audio files in a data project based on the meta info." … … 275 275 276 276 #. +> trunk stable 277 #: plugins/project/audioprojectcddb/k3baudioprojectcddbplugin.desktop:4 5277 #: plugins/project/audioprojectcddb/k3baudioprojectcddbplugin.desktop:46 278 278 msgctxt "Comment" 279 279 msgid "Plugin to query a cddb server for information about an audio project." … … 282 282 # pmap: =/nom=K3b/gen=K3b-a/dat=K3b-u/aku=K3b/lok=K3b-u/ins=K3b-om/_r=m/_b=j/ 283 283 #. +> trunk stable 284 #: src/k3b-cue.desktop:7 src/k3b-iso.desktop:7 src/k3b.desktop:9 3284 #: src/k3b-cue.desktop:7 src/k3b-iso.desktop:7 src/k3b.desktop:95 285 285 msgctxt "Name" 286 286 msgid "K3b" … … 294 294 295 295 #. +> trunk stable 296 #: src/k3b.desktop: 49296 #: src/k3b.desktop:50 297 297 msgctxt "Comment" 298 298 msgid "Disk writing program" … … 348 348 349 349 #. +> trunk 350 #: src/k3b.notifyrc:42 6350 #: src/k3b.notifyrc:428 351 351 msgctxt "Comment" 352 352 msgid "K3b is currently busy and cannot start any other operations" … … 354 354 355 355 #. +> trunk 356 #: src/k3b.notifyrc:4 49356 #: src/k3b.notifyrc:452 357 357 msgctxt "Name" 358 358 msgid "No problems found" … … 360 360 361 361 #. +> trunk 362 #: src/k3b.notifyrc:4 69362 #: src/k3b.notifyrc:474 363 363 msgctxt "Comment" 364 364 msgid "No problems found in system configuration" … … 366 366 367 367 #. +> trunk 368 #: src/k3b.notifyrc:49 2368 #: src/k3b.notifyrc:498 369 369 msgctxt "Name" 370 370 msgid "Mount/unmount failed" … … 372 372 373 373 #. +> trunk 374 #: src/k3b.notifyrc:51 0374 #: src/k3b.notifyrc:518 375 375 msgctxt "Comment" 376 376 msgid "Medium cannot be mount or unmounted" … … 378 378 379 379 #. +> trunk 380 #: src/k3b.notifyrc:5 32380 #: src/k3b.notifyrc:541 381 381 msgctxt "Name" 382 382 msgid "Track data not found" … … 384 384 385 385 #. +> trunk 386 #: src/k3b.notifyrc:5 50386 #: src/k3b.notifyrc:561 387 387 msgctxt "Comment" 388 388 msgid "Track information has not been found in the online database" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/desktop_extragear-multimedia_kmid.po ¶
r1031 r1036 6 6 "Project-Id-Version: desktop files\n" 7 7 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 8 "POT-Creation-Date: 2011-05-2 2 08:35+0200\n"8 "POT-Creation-Date: 2011-05-25 09:37+0200\n" 9 9 "PO-Revision-Date: 2010-01-24 16:33+0100\n" 10 10 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n" … … 27 27 28 28 #. +> trunk 29 #: alsa/kmid_alsa.desktop:4 629 #: alsa/kmid_alsa.desktop:47 30 30 msgctxt "Comment" 31 31 msgid "ALSA sequencer backend" … … 40 40 41 41 #. +> trunk 42 #: dummy/kmid_dummy.desktop:4 442 #: dummy/kmid_dummy.desktop:45 43 43 #, fuzzy 44 44 msgctxt "Comment" … … 54 54 55 55 #. +> trunk 56 #: examples/kmidtest/kmidtest.desktop:3 156 #: examples/kmidtest/kmidtest.desktop:32 57 57 #, fuzzy 58 58 msgctxt "GenericName" … … 75 75 76 76 #. +> trunk 77 #: mac/kmid_mac.desktop:4 477 #: mac/kmid_mac.desktop:45 78 78 #, fuzzy 79 79 msgctxt "Comment" … … 102 102 103 103 #. +> trunk 104 #: src/kmid_part.desktop:4 0104 #: src/kmid_part.desktop:41 105 105 #, fuzzy 106 106 msgctxt "GenericName" … … 116 116 117 117 #. +> trunk 118 #: win/kmid_win.desktop:4 4118 #: win/kmid_win.desktop:45 119 119 #, fuzzy 120 120 msgctxt "Comment" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/desktop_extragear-multimedia_kplayer.po ¶
r1031 r1036 6 6 "Project-Id-Version: desktop files\n" 7 7 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 8 "POT-Creation-Date: 2011-05-2 2 08:35+0200\n"8 "POT-Creation-Date: 2011-05-25 09:37+0200\n" 9 9 "PO-Revision-Date: 2010-01-24 16:33+0100\n" 10 10 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n" … … 70 70 71 71 #. +> trunk 72 #: kplayer/kplayer.desktop:3 3kplayer/kplayerpart.desktop:572 #: kplayer/kplayer.desktop:34 kplayer/kplayerpart.desktop:5 73 73 msgctxt "Name" 74 74 msgid "KPlayer" … … 76 76 77 77 #. +> trunk 78 #: kplayer/kplayer.desktop:8 278 #: kplayer/kplayer.desktop:83 79 79 #, fuzzy 80 80 msgctxt "GenericName" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/k3b.po ¶
r1035 r1036 7 7 "Project-Id-Version: \n" 8 8 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 9 "POT-Creation-Date: 2011-05- 04 11:04+0200\n"9 "POT-Creation-Date: 2011-05-25 09:37+0200\n" 10 10 "PO-Revision-Date: 2011-05-21 13:34+0200\n" 11 11 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" … … 15 15 "Content-Transfer-Encoding: 8bit\n" 16 16 "Language: hr\n" 17 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" 18 "=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 17 "Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" 19 18 "X-Generator: Lokalize 1.2\n" 20 19 "X-Environment: kde\n" … … 54 53 #. +> trunk stable 55 54 #: ../plugins/decoder/flac/k3bflacdecoder.cpp:369 56 #| msgid "FLAC"57 55 msgid "FLAC" 58 56 msgstr "FLAC" … … 276 274 #: ../plugins/encoder/external/base_k3bexternalencoderconfigwidget.ui:22 277 275 msgid "" 278 "<p>This dialog can be used to setup external command line applications as " 279 "audio encoders. These can then be used by K3b to encode audio data (Tracks " 280 "from an audio CD or the titles from an audio project) to formats that are " 281 "normally not supported (i.e. no encoder plugin exists).\n" 282 "<p>K3b comes with a selection of predefined external applications that " 283 "depends on the installed applications." 276 "<p>This dialog can be used to setup external command line applications as audio encoders. These can then be used by K3b to encode audio data (Tracks from an audio CD or the titles from an audio project) to formats that are normally not supported (i.e. no encoder plugin exists).\n" 277 "<p>K3b comes with a selection of predefined external applications that depends on the installed applications." 284 278 msgstr "" 285 279 … … 353 347 #, no-c-format 354 348 msgid "" 355 "Please insert the command used to encode the audio data. The command has to " 356 "read raw little endian (see <em>Swap Byte Order</em>) 16-bit stereo audio " 357 "frames from stdin.\n" 349 "Please insert the command used to encode the audio data. The command has to read raw little endian (see <em>Swap Byte Order</em>) 16-bit stereo audio frames from stdin.\n" 358 350 "<p>The following strings will be replaced by K3b:<br>\n" 359 "<b>%f</b> - The filename of the resulting file. This is where the command has " 360 "to write its output to.<br>\n" 361 "<em>The following refer to metadata stored for example in the ID3 tag of an " 362 "mp3 file (Be aware that these values might be empty).</em><br>\n" 351 "<b>%f</b> - The filename of the resulting file. This is where the command has to write its output to.<br>\n" 352 "<em>The following refer to metadata stored for example in the ID3 tag of an mp3 file (Be aware that these values might be empty).</em><br>\n" 363 353 "<b>%t</b> - Title<br>\n" 364 354 "<b>%a</b> - Artist<br>\n" … … 391 381 #: ../plugins/encoder/external/base_k3bexternalencodereditwidget.ui:119 392 382 msgid "" 393 "<p> If this option is checked K3b will swap the byte order of the input data. " 394 "Thus, the command has to read big endian audio frames.\n" 395 "<p>If the resulting audio file sounds bad it is highly likely that the byte " 396 "order is wrong and this option has to be checked." 383 "<p> If this option is checked K3b will swap the byte order of the input data. Thus, the command has to read big endian audio frames.\n" 384 "<p>If the resulting audio file sounds bad it is highly likely that the byte order is wrong and this option has to be checked." 397 385 msgstr "" 398 386 … … 412 400 #. +> trunk stable 413 401 #: ../plugins/encoder/external/base_k3bexternalencodereditwidget.ui:132 414 msgid "" 415 "<p>If this option is checked K3b will write a wave header. This is useful in " 416 "case the encoder application cannot read plain raw audio data." 402 msgid "<p>If this option is checked K3b will write a wave header. This is useful in case the encoder application cannot read plain raw audio data." 417 403 msgstr "" 418 404 … … 588 574 #: ../plugins/encoder/lame/base_k3blameencodersettingswidget.ui:267 589 575 msgid "" 590 "<p>Bitrate is of course the main influence on quality. The higher the " 591 "bitrate, the higher the quality. But for a given bitrate, we have a choice of " 592 "algorithms to determine the best scalefactors and huffman encoding (noise " 593 "shaping).\n" 576 "<p>Bitrate is of course the main influence on quality. The higher the bitrate, the higher the quality. But for a given bitrate, we have a choice of algorithms to determine the best scalefactors and huffman encoding (noise shaping).\n" 594 577 "<p>The quality increases from 0 to 9 while the encoding speed drops.\n" 595 578 "<p>9 uses the slowest & best possible version of all algorithms.\n" 596 "<p><b>7 is the recommended setting</b> while 4 still produced reasonable " 597 "quality at good speed.\n" 598 "<p>0 disables almost all algorithms including psy-model resulting in poor " 599 "quality.\n" 579 "<p><b>7 is the recommended setting</b> while 4 still produced reasonable quality at good speed.\n" 580 "<p>0 disables almost all algorithms including psy-model resulting in poor quality.\n" 600 581 "<p><b>This setting has no influence on the size of the resulting file.</b>" 601 582 msgstr "" … … 641 622 #: ../plugins/encoder/lame/base_k3blameencodersettingswidget.ui:347 642 623 msgid "" 643 "<p>If this option is checked, LAME will enforce the 7680 bit limitation on " 644 "total frame size.<br>\n" 645 "This results in many wasted bits for high bitrate encodings but will ensure " 646 "strict ISO compatibility. This compatibility might be important for hardware " 647 "players." 624 "<p>If this option is checked, LAME will enforce the 7680 bit limitation on total frame size.<br>\n" 625 "This results in many wasted bits for high bitrate encodings but will ensure strict ISO compatibility. This compatibility might be important for hardware players." 648 626 msgstr "" 649 627 … … 663 641 #. +> trunk stable 664 642 #: ../plugins/encoder/lame/base_k3blameencodersettingswidget.ui:360 665 msgid "" 666 "<p>If this option is checked, a cyclic redundancy check (CRC) code will be " 667 "added to each frame, allowing transmission errors that could occur on the MP3 " 668 "stream to be detected; however, it takes 16 bits per frame that would " 669 "otherwise be used for encoding, thus slightly reducing the sound quality." 643 msgid "<p>If this option is checked, a cyclic redundancy check (CRC) code will be added to each frame, allowing transmission errors that could occur on the MP3 stream to be detected; however, it takes 16 bits per frame that would otherwise be used for encoding, thus slightly reducing the sound quality." 670 644 msgstr "" 671 645 … … 742 716 "<p>Select the channel mode of the resulting Mp3 file:\n" 743 717 "<p><b>Stereo</b><br>\n" 744 "In this mode, the encoder makes no use of potential correlations between the " 745 "two input channels; it can, however, negotiate the bit demand between both " 746 "channel, i.e. give one channel more bits if the other contains silence or " 747 "needs fewer bits because of a lower complexity.\n" 718 "In this mode, the encoder makes no use of potential correlations between the two input channels; it can, however, negotiate the bit demand between both channel, i.e. give one channel more bits if the other contains silence or needs fewer bits because of a lower complexity.\n" 748 719 "<p><b>Joint-Stereo</b><br>\n" 749 "In this mode, the encoder will make use of correlations between both channels." 750 " The signal will be matrixed into a sum (\"mid\"), computed by L+R, and " 751 "difference (\"side\") signal, computed by L-R, and more bits are allocated to " 752 "the mid channel. This will effectively increase the bandwidth if the signal " 753 "does not have too much stereo separation, thus giving a significant gain in " 754 "encoding quality.\n" 720 "In this mode, the encoder will make use of correlations between both channels. The signal will be matrixed into a sum (\"mid\"), computed by L+R, and difference (\"side\") signal, computed by L-R, and more bits are allocated to the mid channel. This will effectively increase the bandwidth if the signal does not have too much stereo separation, thus giving a significant gain in encoding quality.\n" 755 721 "<p><b>Mono</b><br>\n" 756 "The input will be encoded as a mono signal. If it was a stereo signal, it " 757 "will be downsampled to mono. The downmix is calculated as the sum of the left " 758 "and right channel, attenuated by 6 dB." 722 "The input will be encoded as a mono signal. If it was a stereo signal, it will be downsampled to mono. The downmix is calculated as the sum of the left and right channel, attenuated by 6 dB." 759 723 msgstr "" 760 724 … … 856 820 #. +> trunk stable 857 821 #: ../plugins/encoder/ogg/base_k3boggvorbisencodersettingswidget.ui:32 858 msgid "" 859 "<p>Vorbis' audio quality is not best measured in kilobits per second, but on " 860 "a scale from -1 to 10 called \"quality\". <p>For now, quality -1 is roughly " 861 "equivalent to 45kbps average, 5 is roughly 160kbps, and 10 gives about " 862 "400kbps. Most people seeking very-near-CD-quality audio encode at a quality " 863 "of 5 or, for lossless stereo coupling, 6. The default setting is quality 3, " 864 "which at approximately 110kbps gives a smaller filesize and significantly " 865 "better fidelity than .mp3 compression at 128kbps. <p><em>This explanation was " 866 "copied from the www.vorbis.com FAQ.</em>" 822 msgid "<p>Vorbis' audio quality is not best measured in kilobits per second, but on a scale from -1 to 10 called \"quality\". <p>For now, quality -1 is roughly equivalent to 45kbps average, 5 is roughly 160kbps, and 10 gives about 400kbps. Most people seeking very-near-CD-quality audio encode at a quality of 5 or, for lossless stereo coupling, 6. The default setting is quality 3, which at approximately 110kbps gives a smaller filesize and significantly better fidelity than .mp3 compression at 128kbps. <p><em>This explanation was copied from the www.vorbis.com FAQ.</em>" 867 823 msgstr "" 868 824 … … 914 870 #. +> trunk stable 915 871 #: ../plugins/encoder/ogg/k3boggvorbisencoderconfigwidget.cpp:64 916 msgid "" 917 "<p>Vorbis' audio quality is not best measured in kilobits per second, but on " 918 "a scale from -1 to 10 called <em>quality</em>.<p>For now, quality -1 is " 919 "roughly equivalent to 45kbps average, 5 is roughly 160kbps, and 10 gives " 920 "about 400kbps. Most people seeking very-near-CD-quality audio encode at a " 921 "quality of 5 or, for lossless stereo coupling, 6. The quality 3 gives, at " 922 "approximately 110kbps a smaller filesize and significantly better fidelity " 923 "than .mp3 compression at 128kbps.<p><em>This explanation is based on the one " 924 "from the www.vorbis.com FAQ.</em>" 872 msgid "<p>Vorbis' audio quality is not best measured in kilobits per second, but on a scale from -1 to 10 called <em>quality</em>.<p>For now, quality -1 is roughly equivalent to 45kbps average, 5 is roughly 160kbps, and 10 gives about 400kbps. Most people seeking very-near-CD-quality audio encode at a quality of 5 or, for lossless stereo coupling, 6. The quality 3 gives, at approximately 110kbps a smaller filesize and significantly better fidelity than .mp3 compression at 128kbps.<p><em>This explanation is based on the one from the www.vorbis.com FAQ.</em>" 925 873 msgstr "" 926 874 … … 947 895 #: ../plugins/encoder/sox/base_k3bsoxencoderconfigwidget.ui:63 948 896 msgid "" 949 "<p>The sample data encoding is signed linear (2's complement), unsigned " 950 "linear, u-law (logarithmic), A-law (logarithmic), ADPCM, IMA_ADPCM, GSM, or " 951 "Floating-point.</p>\n" 952 "<p><b>U-law</b> (actually shorthand for mu-law) and <b>A-law</b> are the U.S. " 953 "and international standards for logarithmic telephone sound compression. When " 954 "uncompressed u-law has roughly the precision of 14-bit PCM audio and A-law " 955 "has roughly the precision of 13-bit PCM audio. A-law and u-law data is " 956 "sometimes encoded using a reversed bit-ordering (i.e. MSB becomes LSB).<br> <" 957 "b>ADPCM </b> is a form of sound compression that has a good compromise " 958 "between good sound quality and fast encoding/decoding time. It is used for " 959 "telephone sound compression and places where full fidelity is not as " 960 "important. When uncompressed it has roughly the precision of 16-bit PCM audio." 961 " Popular versions of ADPCM include G.726, MS ADPCM, and IMA ADPCM. It has " 962 "different meanings in different file handlers. In .wav files it represents MS " 963 "ADPCM files, in all others it means G.726 ADPCM. <br> <b>IMA ADPCM</b> is a " 964 "specific form of ADPCM compression, slightly simpler and slightly lower " 965 "fidelity than Microsoft's flavor of ADPCM. IMA ADPCM is also called DVI ADPCM." 966 "<br> <b>GSM</b> is a standard used for telephone sound compression in " 967 "European countries and is gaining popularity because of its good quality. It " 968 "is usually CPU intensive to work with GSM audio data.</p> <p><em>Description " 969 "based on the SoX manpage</em></p>" 897 "<p>The sample data encoding is signed linear (2's complement), unsigned linear, u-law (logarithmic), A-law (logarithmic), ADPCM, IMA_ADPCM, GSM, or Floating-point.</p>\n" 898 "<p><b>U-law</b> (actually shorthand for mu-law) and <b>A-law</b> are the U.S. and international standards for logarithmic telephone sound compression. When uncompressed u-law has roughly the precision of 14-bit PCM audio and A-law has roughly the precision of 13-bit PCM audio. A-law and u-law data is sometimes encoded using a reversed bit-ordering (i.e. MSB becomes LSB).<br> <b>ADPCM </b> is a form of sound compression that has a good compromise between good sound quality and fast encoding/decoding time. It is used for telephone sound compression and places where full fidelity is not as important. When uncompressed it has roughly the precision of 16-bit PCM audio. Popular versions of ADPCM include G.726, MS ADPCM, and IMA ADPCM. It has different meanings in different file handlers. In .wav files it represents MS ADPCM files, in all others it means G.726 ADPCM. <br> <b>IMA ADPCM</b> is a specific form of ADPCM compression, slightly simpler and slightly lower fidelity than Microsoft's flavor of ADPCM. IMA ADPCM is also called DVI ADPCM.<br> <b>GSM</b> is a standard used for telephone sound compression in European countries and is gaining popularity because of its good quality. It is usually CPU intensive to work with GSM audio data.</p> <p><em>Description based on the SoX manpage</em></p>" 970 899 msgstr "" 971 900 … … 1213 1142 #. +> trunk stable 1214 1143 #: ../plugins/project/audiometainforenamer/k3baudiometainforenamerplugin.cpp:146 1215 msgid "" 1216 "<qt>This specifies how the files should be renamed. Currently only the " 1217 "special strings <em>%a</em> (Artist), <em>%n</em> (Track number), and <em>%t<" 1218 "/em> (Title) are supported." 1144 msgid "<qt>This specifies how the files should be renamed. Currently only the special strings <em>%a</em> (Artist), <em>%n</em> (Track number), and <em>%t</em> (Title) are supported." 1219 1145 msgstr "" 1220 1146 … … 1811 1737 #: k3bappdevicemanager.cpp:289 1812 1738 #, kde-format 1813 msgid "" 1814 "<p>Please enter the preferred read speed for <b>%1</b>. This speed will be " 1815 "used for the currently mounted medium.<p>This is especially useful to slow " 1816 "down the drive when watching movies which are read directly from the drive " 1817 "and the spinning noise is intrusive.<p>Be aware that this has no influence on " 1818 "K3b since it will change the reading speed again when copying CDs or DVDs." 1739 msgid "<p>Please enter the preferred read speed for <b>%1</b>. This speed will be used for the currently mounted medium.<p>This is especially useful to slow down the drive when watching movies which are read directly from the drive and the spinning noise is intrusive.<p>Be aware that this has no influence on K3b since it will change the reading speed again when copying CDs or DVDs." 1819 1740 msgstr "" 1820 1741 … … 1902 1823 #. +> trunk stable 1903 1824 #: k3bdatamodewidget.cpp:38 1904 msgid "" 1905 "<p><b>Data Mode</b><p>Data tracks may be written in two different modes:</p><" 1906 "p><b>Auto</b><br>Let K3b select the best suited data mode.</p><p><b>Mode 1</b>" 1907 "<br>This is the <em>original</em> writing mode as introduced in the <em>" 1908 "Yellow Book</em> standard. It is the preferred mode when writing pure data " 1909 "CDs.</p><p><b>Mode 2</b><br>To be exact <em>XA Mode 2 Form 1</em>, but since " 1910 "the other modes are rarely used it is common to refer to it as <em>Mode 2</em>" 1911 ".</p><p><b>Be aware:</b> Do not mix different modes on one CD. Some older " 1912 "drives may have problems reading mode 1 multisession CDs." 1825 msgid "<p><b>Data Mode</b><p>Data tracks may be written in two different modes:</p><p><b>Auto</b><br>Let K3b select the best suited data mode.</p><p><b>Mode 1</b><br>This is the <em>original</em> writing mode as introduced in the <em>Yellow Book</em> standard. It is the preferred mode when writing pure data CDs.</p><p><b>Mode 2</b><br>To be exact <em>XA Mode 2 Form 1</em>, but since the other modes are rarely used it is common to refer to it as <em>Mode 2</em>.</p><p><b>Be aware:</b> Do not mix different modes on one CD. Some older drives may have problems reading mode 1 multisession CDs." 1913 1826 msgstr "" 1914 1827 … … 1957 1870 #. +> trunk stable 1958 1871 #: k3bdirview.cpp:206 1959 msgid "" 1960 "K3b uses vcdxrip from the vcdimager package to rip Video CDs. Please make " 1961 "sure it is installed." 1872 msgid "K3b uses vcdxrip from the vcdimager package to rip Video CDs. Please make sure it is installed." 1962 1873 msgstr "" 1963 1874 … … 1981 1892 #: k3bdirview.cpp:257 1982 1893 #, kde-format 1983 msgid "" 1984 "<p>K3b was unable to unmount medium <b>%1</b> in device <em>%2 - %3</em>" 1985 msgstr "" 1986 "<p>K3b nije mogao demontirati medij <b>%1</b> u ureÄaju <em>%2 â %3</em>" 1894 msgid "<p>K3b was unable to unmount medium <b>%1</b> in device <em>%2 - %3</em>" 1895 msgstr "<p>K3b nije mogao demontirati medij <b>%1</b> u ureÄaju <em>%2 â %3</em>" 1987 1896 1988 1897 #. +> trunk stable … … 2140 2049 #. +> trunk stable 2141 2050 #: k3bdiskinfoview.cpp:300 k3bdiskinfoview.cpp:302 k3bdiskinfoview.cpp:306 2142 #: projects/k3bfillstatusdisplay.cpp:188 projects/k3bfillstatusdisplay.cpp:191 2143 #: projects/k3bfillstatusdisplay.cpp:196 2051 #: projects/k3bfillstatusdisplay.cpp:180 projects/k3bfillstatusdisplay.cpp:188 2052 #: projects/k3bfillstatusdisplay.cpp:191 projects/k3bfillstatusdisplay.cpp:196 2053 #: projects/k3bfillstatusdisplay.cpp:849 2144 2054 #, kde-format 2145 2055 msgid "%1 min" … … 2451 2361 #. +> trunk stable 2452 2362 #: k3binteractiondialog.cpp:205 2453 msgid "" 2454 "<p>Load a set of settings either from the default K3b settings, settings " 2455 "saved before, or the last used ones." 2363 msgid "<p>Load a set of settings either from the default K3b settings, settings saved before, or the last used ones." 2456 2364 msgstr "" 2457 2365 2458 2366 #. +> trunk stable 2459 2367 #: k3binteractiondialog.cpp:207 2460 msgid "" 2461 "<p>Saves the current settings of the action dialog.<p>These settings can be " 2462 "loaded with the <em>Load saved settings</em> button.<p><b>The K3b defaults " 2463 "are not overwritten by this.</b>" 2368 msgid "<p>Saves the current settings of the action dialog.<p>These settings can be loaded with the <em>Load saved settings</em> button.<p><b>The K3b defaults are not overwritten by this.</b>" 2464 2369 msgstr "" 2465 2370 … … 2471 2376 #. +> stable 2472 2377 #: k3binteractiondialog.cpp:288 2473 msgid "" 2474 "<p>K3b handles three sets of settings in action dialogs: the defaults, the " 2475 "saved settings, and the last used settings. Please choose which of these sets " 2476 "should be loaded if an action dialog is opened again.<p><em>Be aware that " 2477 "this choice can always be changed from the K3b configuration dialog.</em>" 2378 msgid "<p>K3b handles three sets of settings in action dialogs: the defaults, the saved settings, and the last used settings. Please choose which of these sets should be loaded if an action dialog is opened again.<p><em>Be aware that this choice can always be changed from the K3b configuration dialog.</em>" 2478 2379 msgstr "" 2479 2380 … … 2586 2487 #: k3blsofwrapperdialog.cpp:73 2587 2488 #, kde-format 2588 msgid "" 2589 "<p>Device <b>'%1'</b> is already in use by other applications (<em>%2</em>).<" 2590 "p>It is highly recommended to quit those before continuing. Otherwise K3b " 2591 "might not be able to fully access the device.<p><em>Hint: Sometimes shutting " 2592 "down an application does not happen instantly. In that case you might have to " 2593 "use the '%3' button." 2594 msgstr "" 2595 2596 #. +> trunk stable 2489 msgid "<p>Device <b>'%1'</b> is already in use by other applications (<em>%2</em>).<p>It is highly recommended to quit those before continuing. Otherwise K3b might not be able to fully access the device.<p><em>Hint: Sometimes shutting down an application does not happen instantly. In that case you might have to use the '%3' button." 2490 msgstr "" 2491 2492 #. +> trunk 2493 #: k3blsofwrapperdialog.cpp:101 2494 #, fuzzy, kde-format 2495 msgid "<p>Do you really want K3b to kill the following processes: <em>%1</em>?</p>" 2496 msgstr "<qt>Da li zaista ÅŸelite da obriÅ¡ete zabeleÅ¡ku <b>%1</b>?</qt>" 2497 2498 #. +> stable 2597 2499 #: k3blsofwrapperdialog.cpp:101 2598 2500 msgid "<p>Do you really want K3b to kill the following processes: <em>" … … 2831 2733 #. +> trunk stable 2832 2734 #: k3bsystemproblemdialog.cpp:200 2833 msgid "" 2834 "K3b did not find an optical writing device in your system. Thus, you will not " 2835 "be able to burn CDs or DVDs. However, you can still use other K3b features " 2836 "such as audio track extraction, audio transcoding or ISO9660 image creation." 2735 msgid "K3b did not find an optical writing device in your system. Thus, you will not be able to burn CDs or DVDs. However, you can still use other K3b features such as audio track extraction, audio transcoding or ISO9660 image creation." 2837 2736 msgstr "" 2838 2737 … … 2864 2763 #. +> trunk stable 2865 2764 #: k3bsystemproblemdialog.cpp:219 2866 msgid "" 2867 "Although K3b supports all cdrtools versions since 1.10 it is highly " 2868 "recommended to at least use version 2.0." 2765 msgid "Although K3b supports all cdrtools versions since 1.10 it is highly recommended to at least use version 2.0." 2869 2766 msgstr "" 2870 2767 … … 2883 2780 #: k3bsystemproblemdialog.cpp:240 2884 2781 #, kde-format 2885 msgid "" 2886 "Since Linux kernel 2.6.8 %1 will not work when run suid root for security " 2887 "reasons anymore." 2782 msgid "Since Linux kernel 2.6.8 %1 will not work when run suid root for security reasons anymore." 2888 2783 msgstr "" 2889 2784 … … 2896 2791 #. +> trunk stable 2897 2792 #: k3bsystemproblemdialog.cpp:251 2898 msgid "" 2899 "It is highly recommended to configure cdrecord to run with root privileges, " 2900 "as then cdrecord runs with high priority that increases the overall stability " 2901 "of the burning process. As well as this, it allows the size of the burning " 2902 "buffer to be changed, and a lot of user problems can be solved this way." 2793 msgid "It is highly recommended to configure cdrecord to run with root privileges, as then cdrecord runs with high priority that increases the overall stability of the burning process. As well as this, it allows the size of the burning buffer to be changed, and a lot of user problems can be solved this way." 2903 2794 msgstr "" 2904 2795 … … 2915 2806 #. +> trunk stable 2916 2807 #: k3bsystemproblemdialog.cpp:276 2917 msgid "" 2918 "It is highly recommended to configure cdrdao to run with root privileges to " 2919 "increase the overall stability of the burning process." 2808 msgid "It is highly recommended to configure cdrdao to run with root privileges to increase the overall stability of the burning process." 2920 2809 msgstr "" 2921 2810 2922 2811 #. +> trunk stable 2923 2812 #: k3bsystemproblemdialog.cpp:291 2924 msgid "" 2925 "K3b uses growisofs to actually write DVDs. Without growisofs you will not be " 2926 "able to write DVDs. Make sure to install at least version 5.10." 2813 msgid "K3b uses growisofs to actually write DVDs. Without growisofs you will not be able to write DVDs. Make sure to install at least version 5.10." 2927 2814 msgstr "" 2928 2815 … … 2934 2821 #. +> trunk stable 2935 2822 #: k3bsystemproblemdialog.cpp:300 2936 msgid "" 2937 "K3b needs at least growisofs version 5.10 to write DVDs. All older versions " 2938 "will not work and K3b will refuse to use them." 2823 msgid "K3b needs at least growisofs version 5.10 to write DVDs. All older versions will not work and K3b will refuse to use them." 2939 2824 msgstr "" 2940 2825 … … 2948 2833 #. +> trunk stable 2949 2834 #: k3bsystemproblemdialog.cpp:307 2950 msgid "" 2951 "K3b will not be able to copy DVDs on-the-fly or write a DVD+RW in multiple " 2952 "sessions using a growisofs version older than 5.12." 2835 msgid "K3b will not be able to copy DVDs on-the-fly or write a DVD+RW in multiple sessions using a growisofs version older than 5.12." 2953 2836 msgstr "" 2954 2837 2955 2838 #. +> trunk stable 2956 2839 #: k3bsystemproblemdialog.cpp:315 2957 msgid "" 2958 "It is highly recommended to use growisofs 7.0 or higher. K3b will not be able " 2959 "to write a DVD+RW in multiple sessions using a growisofs version older than 7." 2960 "0." 2840 msgid "It is highly recommended to use growisofs 7.0 or higher. K3b will not be able to write a DVD+RW in multiple sessions using a growisofs version older than 7.0." 2961 2841 msgstr "" 2962 2842 … … 2968 2848 #. +> trunk stable 2969 2849 #: k3bsystemproblemdialog.cpp:349 2970 msgid "" 2971 "K3b needs at least mkisofs version 1.14. Older versions may introduce " 2972 "problems when creating data projects." 2850 msgid "K3b needs at least mkisofs version 1.14. Older versions may introduce problems when creating data projects." 2973 2851 msgstr "" 2974 2852 … … 2981 2859 #. +> trunk stable 2982 2860 #: k3bsystemproblemdialog.cpp:375 2983 msgid "" 2984 "K3b is not able to unmount automounted devices. Thus, especially DVD+RW " 2985 "rewriting might fail. There is no need to report this as a bug or feature " 2986 "wish; it is not possible to solve this problem from within K3b." 2861 msgid "K3b is not able to unmount automounted devices. Thus, especially DVD+RW rewriting might fail. There is no need to report this as a bug or feature wish; it is not possible to solve this problem from within K3b." 2987 2862 msgstr "" 2988 2863 2989 2864 #. +> trunk stable 2990 2865 #: k3bsystemproblemdialog.cpp:379 2991 msgid "" 2992 "Replace the automounting entries in /etc/fstab with old-fashioned ones or use " 2993 "a user-space mounting solution like pmount or ivman." 2866 msgid "Replace the automounting entries in /etc/fstab with old-fashioned ones or use a user-space mounting solution like pmount or ivman." 2994 2867 msgstr "" 2995 2868 … … 3001 2874 #. +> trunk stable 3002 2875 #: k3bsystemproblemdialog.cpp:389 3003 msgid "" 3004 "Your kernel does not support writing without SCSI emulation but there is at " 3005 "least one writer in your system not configured to use SCSI emulation." 2876 msgid "Your kernel does not support writing without SCSI emulation but there is at least one writer in your system not configured to use SCSI emulation." 3006 2877 msgstr "" 3007 2878 3008 2879 #. +> trunk stable 3009 2880 #: k3bsystemproblemdialog.cpp:393 3010 msgid "" 3011 "The best and recommended solution is to enable ide-scsi (SCSI emulation) for " 3012 "all devices. This way you will not have any problems. Be aware that you may " 3013 "still enable DMA on ide-scsi emulated drives." 2881 msgid "The best and recommended solution is to enable ide-scsi (SCSI emulation) for all devices. This way you will not have any problems. Be aware that you may still enable DMA on ide-scsi emulated drives." 3014 2882 msgstr "" 3015 2883 … … 3023 2891 #: k3bsystemproblemdialog.cpp:410 k3bsystemproblemdialog.cpp:431 3024 2892 #, kde-format 3025 msgid "" 3026 "The configured version of %1 does not support writing to ATAPI devices " 3027 "without SCSI emulation and there is at least one writer in your system not " 3028 "configured to use SCSI emulation." 2893 msgid "The configured version of %1 does not support writing to ATAPI devices without SCSI emulation and there is at least one writer in your system not configured to use SCSI emulation." 3029 2894 msgstr "" 3030 2895 … … 3032 2897 #: k3bsystemproblemdialog.cpp:415 k3bsystemproblemdialog.cpp:439 3033 2898 #, kde-format 3034 msgid "" 3035 "The best, and recommended, solution is to use ide-scsi (SCSI emulation) for " 3036 "all writer devices: this way you will not have any problems; or, you can " 3037 "install (or select as the default) a more recent version of %1." 2899 msgid "The best, and recommended, solution is to use ide-scsi (SCSI emulation) for all writer devices: this way you will not have any problems; or, you can install (or select as the default) a more recent version of %1." 3038 2900 msgstr "" 3039 2901 … … 3041 2903 #: k3bsystemproblemdialog.cpp:414 3042 2904 #, kde-format 3043 msgid "" 3044 "The best and recommended solution is to enable ide-scsi (SCSI emulation) for " 3045 "all devices. This way you will not have any problems. Or you install (or " 3046 "select as the default) a more recent version of %1." 2905 msgid "The best and recommended solution is to enable ide-scsi (SCSI emulation) for all devices. This way you will not have any problems. Or you install (or select as the default) a more recent version of %1." 3047 2906 msgstr "" 3048 2907 3049 2908 #. +> trunk stable 3050 2909 #: k3bsystemproblemdialog.cpp:437 3051 msgid "" 3052 "Install cdrdao >= 1.1.8 which supports writing to ATAPI devices directly." 2910 msgid "Install cdrdao >= 1.1.8 which supports writing to ATAPI devices directly." 3053 2911 msgstr "" 3054 2912 3055 2913 #. +> trunk stable 3056 2914 #: k3bsystemproblemdialog.cpp:453 3057 msgid "" 3058 "K3b will not be able to write DVD-R Dual Layer media using a growisofs " 3059 "version older than 6.0." 2915 msgid "K3b will not be able to write DVD-R Dual Layer media using a growisofs version older than 6.0." 3060 2916 msgstr "" 3061 2917 … … 3074 2930 #: k3bsystemproblemdialog.cpp:468 3075 2931 #, kde-format 3076 msgid "" 3077 "K3b needs write access to all the devices to perform certain tasks. Without " 3078 "it you might encounter problems with %1 - %2" 2932 msgid "K3b needs write access to all the devices to perform certain tasks. Without it you might encounter problems with %1 - %2" 3079 2933 msgstr "" 3080 2934 … … 3082 2936 #: k3bsystemproblemdialog.cpp:470 3083 2937 #, kde-format 3084 msgid "" 3085 "Make sure you have write access to %1. In case you are not using devfs or " 3086 "udev click \"Modify Permissions...\" and setup permissions by hand." 2938 msgid "Make sure you have write access to %1. In case you are not using devfs or udev click \"Modify Permissions...\" and setup permissions by hand." 3087 2939 msgstr "" 3088 2940 … … 3095 2947 #. +> trunk stable 3096 2948 #: k3bsystemproblemdialog.cpp:477 3097 msgid "" 3098 "With most modern CD/DVD/BD devices enabling DMA highly increases read/write " 3099 "performance. If you experience very low writing speeds this is probably the " 3100 "cause." 2949 msgid "With most modern CD/DVD/BD devices enabling DMA highly increases read/write performance. If you experience very low writing speeds this is probably the cause." 3101 2950 msgstr "" 3102 2951 … … 3115 2964 #. +> trunk stable 3116 2965 #: k3bsystemproblemdialog.cpp:496 3117 msgid "" 3118 "Sometimes it may be necessary to specify user parameters in addition to the " 3119 "parameters generated by K3b. This is simply a warning to make sure that these " 3120 "parameters are really wanted and will not be part of some bug report." 2966 msgid "Sometimes it may be necessary to specify user parameters in addition to the parameters generated by K3b. This is simply a warning to make sure that these parameters are really wanted and will not be part of some bug report." 3121 2967 msgstr "" 3122 2968 … … 3124 2970 #: k3bsystemproblemdialog.cpp:499 3125 2971 #, kde-format 3126 msgid "" 3127 "To remove the user parameters for the external program %1 open the K3b " 3128 "settings page 'Programs' and choose the tab 'User Parameters'." 2972 msgid "To remove the user parameters for the external program %1 open the K3b settings page 'Programs' and choose the tab 'User Parameters'." 3129 2973 msgstr "" 3130 2974 … … 3136 2980 #. +> trunk stable 3137 2981 #: k3bsystemproblemdialog.cpp:521 3138 msgid "" 3139 "K3b could not load or find the MP3 decoder plugin. This means that you will " 3140 "not be able to create Audio CDs from MP3 files. Many Linux distributions do " 3141 "not include MP3 support for legal reasons." 2982 msgid "K3b could not load or find the MP3 decoder plugin. This means that you will not be able to create Audio CDs from MP3 files. Many Linux distributions do not include MP3 support for legal reasons." 3142 2983 msgstr "" 3143 2984 3144 2985 #. +> trunk stable 3145 2986 #: k3bsystemproblemdialog.cpp:524 3146 msgid "" 3147 "To enable MP3 support, please install the MAD MP3 decoding library as well as " 3148 "the K3b MAD MP3 decoder plugin (the latter may already be installed but not " 3149 "functional due to the missing libmad). Some distributions allow installation " 3150 "of MP3 support via an online update tool." 2987 msgid "To enable MP3 support, please install the MAD MP3 decoding library as well as the K3b MAD MP3 decoder plugin (the latter may already be installed but not functional due to the missing libmad). Some distributions allow installation of MP3 support via an online update tool." 3151 2988 msgstr "" 3152 2989 … … 3158 2995 #. +> trunk stable 3159 2996 #: k3bsystemproblemdialog.cpp:540 3160 msgid "" 3161 "Your system's locale charset (i.e. the charset used to encode filenames) is " 3162 "set to ANSI_X3.4-1968. It is highly unlikely that this has been done " 3163 "intentionally. Most likely the locale is not set at all. An invalid setting " 3164 "will result in problems when creating data projects." 2997 msgid "Your system's locale charset (i.e. the charset used to encode filenames) is set to ANSI_X3.4-1968. It is highly unlikely that this has been done intentionally. Most likely the locale is not set at all. An invalid setting will result in problems when creating data projects." 3165 2998 msgstr "" 3166 2999 3167 3000 #. +> trunk stable 3168 3001 #: k3bsystemproblemdialog.cpp:544 3169 msgid "" 3170 "To properly set the locale charset make sure the LC_* environment variables " 3171 "are set. Normally the distribution setup tools take care of this." 3002 msgid "To properly set the locale charset make sure the LC_* environment variables are set. Normally the distribution setup tools take care of this." 3172 3003 msgstr "" 3173 3004 … … 3179 3010 #. +> trunk stable 3180 3011 #: k3bsystemproblemdialog.cpp:558 3181 msgid "" 3182 "It is not recommended to run K3b under the root user account. This introduces " 3183 "unnecessary security risks." 3012 msgid "It is not recommended to run K3b under the root user account. This introduces unnecessary security risks." 3184 3013 msgstr "" 3185 3014 3186 3015 #. +> trunk stable 3187 3016 #: k3bsystemproblemdialog.cpp:560 3188 msgid "" 3189 "Run K3b from a proper user account and setup the device and external tool " 3190 "permissions appropriately." 3017 msgid "Run K3b from a proper user account and setup the device and external tool permissions appropriately." 3191 3018 msgstr "" 3192 3019 … … 3218 3045 #. +> trunk stable 3219 3046 #: k3btempdirselectionwidget.cpp:83 3220 msgid "" 3221 "<p>This is the folder in which K3b will save the <em>image files</em>.<p>" 3222 "Please make sure that it resides on a partition that has enough free space." 3047 msgid "<p>This is the folder in which K3b will save the <em>image files</em>.<p>Please make sure that it resides on a partition that has enough free space." 3223 3048 msgstr "" 3224 3049 … … 3363 3188 #. +> trunk stable 3364 3189 #: k3bwriterselectionwidget.cpp:173 3365 msgid "" 3366 "<p>Select the medium that you want to use for burning.<p>In most cases there " 3367 "will only be one medium available which does not leave much choice." 3190 msgid "<p>Select the medium that you want to use for burning.<p>In most cases there will only be one medium available which does not leave much choice." 3368 3191 msgstr "" 3369 3192 3370 3193 #. +> trunk stable 3371 3194 #: k3bwriterselectionwidget.cpp:176 3372 msgid "" 3373 "<p>Select the speed with which you want to burn.<p><b>Auto</b><br>This will " 3374 "choose the maximum writing speed possible with the used medium. This is the " 3375 "recommended selection for most media.</p><p><b>Ignore</b> (DVD only)<br>This " 3376 "will leave the speed selection to the writer device. Use this if K3b is " 3377 "unable to set the writing speed.<p>1x refers to 175 KB/s for CD, 1385 KB/s " 3378 "for DVD, and 4496 KB/s for Blu-ray.</p><p><b>Caution:</b> Make sure your " 3379 "system is able to send the data fast enough to prevent buffer underruns." 3195 msgid "<p>Select the speed with which you want to burn.<p><b>Auto</b><br>This will choose the maximum writing speed possible with the used medium. This is the recommended selection for most media.</p><p><b>Ignore</b> (DVD only)<br>This will leave the speed selection to the writer device. Use this if K3b is unable to set the writing speed.<p>1x refers to 175 KB/s for CD, 1385 KB/s for DVD, and 4496 KB/s for Blu-ray.</p><p><b>Caution:</b> Make sure your system is able to send the data fast enough to prevent buffer underruns." 3380 3196 msgstr "" 3381 3197 3382 3198 #. +> trunk stable 3383 3199 #: k3bwriterselectionwidget.cpp:187 3384 msgid "" 3385 "<p>K3b uses the command line tools cdrecord, growisofs, and cdrdao to " 3386 "actually write a CD or DVD.<p>Normally K3b chooses the best suited " 3387 "application for every task automatically but in some cases it may be possible " 3388 "that one of the applications does not work as intended with a certain writer. " 3389 "In this case one may select the application manually." 3200 msgid "<p>K3b uses the command line tools cdrecord, growisofs, and cdrdao to actually write a CD or DVD.<p>Normally K3b chooses the best suited application for every task automatically but in some cases it may be possible that one of the applications does not work as intended with a certain writer. In this case one may select the application manually." 3390 3201 msgstr "" 3391 3202 … … 3410 3221 #. +> trunk stable 3411 3222 #: k3bwriterselectionwidget.cpp:607 3412 msgid "" 3413 "<p>K3b is not able to perfectly determine the maximum writing speed of an " 3414 "optical writer. Writing speed is always reported subject to the inserted " 3415 "medium.<p>Please enter the writing speed here and K3b will remember it for " 3416 "future sessions (Example: 16x)." 3223 msgid "<p>K3b is not able to perfectly determine the maximum writing speed of an optical writer. Writing speed is always reported subject to the inserted medium.<p>Please enter the writing speed here and K3b will remember it for future sessions (Example: 16x)." 3417 3224 msgstr "" 3418 3225 … … 3429 3236 #. +> trunk stable 3430 3237 #: k3bwritingmodewidget.cpp:29 3431 msgid "" 3432 "<em>Disk At Once</em> or more properly <em>Session At Once</em>. The laser is " 3433 "never turned off while writing the CD or DVD. This is the preferred mode to " 3434 "write audio CDs since it allows pregaps other than 2 seconds. Not all writers " 3435 "support DAO.<br>DVD-R(W)s written in DAO provide the best DVD-Video " 3436 "compatibility." 3238 msgid "<em>Disk At Once</em> or more properly <em>Session At Once</em>. The laser is never turned off while writing the CD or DVD. This is the preferred mode to write audio CDs since it allows pregaps other than 2 seconds. Not all writers support DAO.<br>DVD-R(W)s written in DAO provide the best DVD-Video compatibility." 3437 3239 msgstr "" 3438 3240 3439 3241 #. +> trunk stable 3440 3242 #: k3bwritingmodewidget.cpp:35 3441 msgid "" 3442 "<em>Track At Once</em> should be supported by every CD writer. The laser will " 3443 "be turned off after every track.<br>Most CD writers need this mode for " 3444 "writing multisession CDs." 3243 msgid "<em>Track At Once</em> should be supported by every CD writer. The laser will be turned off after every track.<br>Most CD writers need this mode for writing multisession CDs." 3445 3244 msgstr "" 3446 3245 3447 3246 #. +> trunk stable 3448 3247 #: k3bwritingmodewidget.cpp:41 3449 msgid "" 3450 "RAW writing mode. The error correction data is created by the software " 3451 "instead of the writer device.<br>Try this if your CD writer fails to write in " 3452 "DAO and TAO." 3248 msgid "RAW writing mode. The error correction data is created by the software instead of the writer device.<br>Try this if your CD writer fails to write in DAO and TAO." 3453 3249 msgstr "" 3454 3250 3455 3251 #. +> trunk stable 3456 3252 #: k3bwritingmodewidget.cpp:45 3457 msgid "" 3458 "Incremental sequential is the default writing mode for DVD-R(W). It allows " 3459 "multisession DVD-R(W)s. It only applies to DVD-R(W)." 3253 msgid "Incremental sequential is the default writing mode for DVD-R(W). It allows multisession DVD-R(W)s. It only applies to DVD-R(W)." 3460 3254 msgstr "" 3461 3255 3462 3256 #. +> trunk stable 3463 3257 #: k3bwritingmodewidget.cpp:48 3464 msgid "" 3465 "Restricted Overwrite allows to use a DVD-RW just like a DVD-RAM or a DVD+RW. " 3466 "The media may just be overwritten. It is not possible to write multisession " 3467 "DVD-RWs in this mode but K3b uses growisofs to grow an ISO9660 filesystem " 3468 "within the first session, thus allowing new files to be added to an already " 3469 "burned disk." 3258 msgid "Restricted Overwrite allows to use a DVD-RW just like a DVD-RAM or a DVD+RW. The media may just be overwritten. It is not possible to write multisession DVD-RWs in this mode but K3b uses growisofs to grow an ISO9660 filesystem within the first session, thus allowing new files to be added to an already burned disk." 3470 3259 msgstr "" 3471 3260 … … 3482 3271 #. +> trunk stable 3483 3272 #: k3bwritingmodewidget.cpp:106 3484 msgid "" 3485 "Be aware that the writing mode is ignored when writing DVD+R(W) and BD-R(E) " 3486 "since there is only one way to write them." 3273 msgid "Be aware that the writing mode is ignored when writing DVD+R(W) and BD-R(E) since there is only one way to write them." 3487 3274 msgstr "" 3488 3275 … … 3521 3308 #. +> trunk stable 3522 3309 #: main.cpp:38 3523 msgid "" 3524 "<p>K3b is a full-featured CD/DVD/Blu-ray burning and ripping application.<br/>" 3525 "It supports a variety of project types as well as copying of optical media, " 3526 "burning of different types of images, and ripping Audio CDs, Video CDs, and " 3527 "Video DVDs.<br/>Its convenient user interface is targeted at all audiences, " 3528 "trying to be as simple as possible for novice users while also providing all " 3529 "features an advanced user might need." 3310 msgid "<p>K3b is a full-featured CD/DVD/Blu-ray burning and ripping application.<br/>It supports a variety of project types as well as copying of optical media, burning of different types of images, and ripping Audio CDs, Video CDs, and Video DVDs.<br/>Its convenient user interface is targeted at all audiences, trying to be as simple as possible for novice users while also providing all features an advanced user might need." 3530 3311 msgstr "" 3531 3312 … … 3711 3492 #. +> trunk stable 3712 3493 #: main.cpp:82 3713 msgid "" 3714 "For libsamplerate which is used for generic resampling in the audio decoder " 3715 "framework." 3494 msgid "For libsamplerate which is used for generic resampling in the audio decoder framework." 3716 3495 msgstr "" 3717 3496 … … 3784 3563 #. +> trunk stable 3785 3564 #: main.cpp:103 3786 msgid "" 3787 "Rob created a great theme and came up with the idea for transparent themes." 3565 msgid "Rob created a great theme and came up with the idea for transparent themes." 3788 3566 msgstr "" 3789 3567 … … 3890 3668 #. +> trunk stable 3891 3669 #: main.cpp:129 3892 msgid "" 3893 "Set the device to be used for new projects. (This option has no effect: its " 3894 "main purpose is to enable handling of empty media from the KDE Media Manager.)" 3670 msgid "Set the device to be used for new projects. (This option has no effect: its main purpose is to enable handling of empty media from the KDE Media Manager.)" 3895 3671 msgstr "" 3896 3672 … … 4069 3845 #. +> trunk stable 4070 3846 #: misc/k3bimagewritingdialog.cpp:607 4071 msgid "" 4072 "<p><b>Image types supported by K3b:</p><p><b>Plain image</b><br/>Plain images " 4073 "are written as is to the medium using a single data track. Typical plain " 4074 "images are iso images as created by K3b's data project.<p><b>Cue/bin images<" 4075 "/b><br/>Cue/bin images consist of a cue file describing the table of contents " 4076 "of the medium and an image file which contains the actual data. The data will " 4077 "be written to the medium according to the cue file.<p><b>Audio Cue image</b><" 4078 "br/>Audio cue images are a special kind of cue/bin image containing an image " 4079 "of an audio CD. The actual audio data can be encoded using any audio format " 4080 "supported by K3b. Audio cue files can also be imported into K3b audio " 4081 "projects which allows to change the order and add or remove tracks.<p><b>" 4082 "Cdrecord clone images</b><br/>K3b creates a cdrecord clone image of a " 4083 "single-session CD when copying a CD in clone mode. These images can be reused " 4084 "here.<p><b>Cdrdao TOC files</b><br/>K3b supports writing cdrdao's own image " 4085 "format, the toc files." 3847 msgid "<p><b>Image types supported by K3b:</p><p><b>Plain image</b><br/>Plain images are written as is to the medium using a single data track. Typical plain images are iso images as created by K3b's data project.<p><b>Cue/bin images</b><br/>Cue/bin images consist of a cue file describing the table of contents of the medium and an image file which contains the actual data. The data will be written to the medium according to the cue file.<p><b>Audio Cue image</b><br/>Audio cue images are a special kind of cue/bin image containing an image of an audio CD. The actual audio data can be encoded using any audio format supported by K3b. Audio cue files can also be imported into K3b audio projects which allows to change the order and add or remove tracks.<p><b>Cdrecord clone images</b><br/>K3b creates a cdrecord clone image of a single-session CD when copying a CD in clone mode. These images can be reused here.<p><b>Cdrdao TOC files</b><br/>K3b supports writing cdrdao's own image format, the toc files." 4086 3848 msgstr "" 4087 3849 4088 3850 #. +> trunk stable 4089 3851 #: misc/k3bimagewritingdialog.cpp:707 4090 msgid "" 4091 "<p>The actual file size does not match the size declared in the file header. " 4092 "If it has been downloaded make sure the download is complete.</p><p>Only " 4093 "continue if you know what you are doing.</p>" 3852 msgid "<p>The actual file size does not match the size declared in the file header. If it has been downloaded make sure the download is complete.</p><p>Only continue if you know what you are doing.</p>" 4094 3853 msgstr "" 4095 3854 … … 4253 4012 #. +> trunk stable 4254 4013 #: misc/k3bmediacopydialog.cpp:218 4255 msgid "" 4256 "<p>If this option is checked K3b will disable the source drive's ECC/EDC " 4257 "error correction. This way sectors that are unreadable by intention can be " 4258 "read.<p>This may be useful for cloning CDs with copy protection based on " 4259 "corrupted sectors." 4014 msgid "<p>If this option is checked K3b will disable the source drive's ECC/EDC error correction. This way sectors that are unreadable by intention can be read.<p>This may be useful for cloning CDs with copy protection based on corrupted sectors." 4260 4015 msgstr "" 4261 4016 4262 4017 #. +> trunk stable 4263 4018 #: misc/k3bmediacopydialog.cpp:223 4264 msgid "" 4265 "<p>If this option is checked K3b will search for CD-Text on the source CD. " 4266 "Disable it if your CD drive has problems with reading CD-Text or you want to " 4267 "stick to Cddb info." 4019 msgid "<p>If this option is checked K3b will search for CD-Text on the source CD. Disable it if your CD drive has problems with reading CD-Text or you want to stick to Cddb info." 4268 4020 msgstr "" 4269 4021 4270 4022 #. +> trunk stable 4271 4023 #: misc/k3bmediacopydialog.cpp:226 4272 msgid "" 4273 "<p>If this option is checked and K3b is not able to read a data sector from " 4274 "the source medium it will be replaced with zeros on the resulting copy." 4024 msgid "<p>If this option is checked and K3b is not able to read a data sector from the source medium it will be replaced with zeros on the resulting copy." 4275 4025 msgstr "" 4276 4026 4277 4027 #. +> trunk 4278 4028 #: misc/k3bmediacopydialog.cpp:231 4279 msgid "" 4280 "<p>This is the normal copy mode for DVD, Blu-ray, and most CD media types. It " 4281 "allows copying Audio CDs, multi and single session Data Media, and Enhanced " 4282 "Audio CDs (an Audio CD containing an additional data session).<p>For Video " 4283 "CDs please use the CD Cloning mode." 4029 msgid "<p>This is the normal copy mode for DVD, Blu-ray, and most CD media types. It allows copying Audio CDs, multi and single session Data Media, and Enhanced Audio CDs (an Audio CD containing an additional data session).<p>For Video CDs please use the CD Cloning mode." 4284 4030 msgstr "" 4285 4031 4286 4032 #. +> stable 4287 4033 #: misc/k3bmediacopydialog.cpp:231 4288 msgid "" 4289 "<p>This is the normal copy mode for DVD, Blu-ray, and most CD media types. It " 4290 "allows copying Audio CDs, multi and single session Data Media, and Enhanced " 4291 "Audio CDs (an Audio CD containing an additional data session).<p>For VideoCDs " 4292 "please use the CD Cloning mode." 4034 msgid "<p>This is the normal copy mode for DVD, Blu-ray, and most CD media types. It allows copying Audio CDs, multi and single session Data Media, and Enhanced Audio CDs (an Audio CD containing an additional data session).<p>For VideoCDs please use the CD Cloning mode." 4293 4035 msgstr "" 4294 4036 4295 4037 #. +> trunk 4296 4038 #: misc/k3bmediacopydialog.cpp:236 4297 msgid "" 4298 "<p>In CD Cloning mode K3b performs a raw copy of the CD. That means it does " 4299 "not care about the content but simply copies the CD bit by bit. It may be " 4300 "used to copy Video CDs or CDs which contain erroneous sectors.<p><b>Caution:<" 4301 "/b> Only single session CDs can be cloned." 4039 msgid "<p>In CD Cloning mode K3b performs a raw copy of the CD. That means it does not care about the content but simply copies the CD bit by bit. It may be used to copy Video CDs or CDs which contain erroneous sectors.<p><b>Caution:</b> Only single session CDs can be cloned." 4302 4040 msgstr "" 4303 4041 4304 4042 #. +> stable 4305 4043 #: misc/k3bmediacopydialog.cpp:236 4306 msgid "" 4307 "<p>In CD Cloning mode K3b performs a raw copy of the CD. That means it does " 4308 "not care about the content but simply copies the CD bit by bit. It may be " 4309 "used to copy VideoCDs or CDs which contain erroneous sectors.<p><b>Caution:<" 4310 "/b> Only single session CDs can be cloned." 4044 msgid "<p>In CD Cloning mode K3b performs a raw copy of the CD. That means it does not care about the content but simply copies the CD bit by bit. It may be used to copy VideoCDs or CDs which contain erroneous sectors.<p><b>Caution:</b> Only single session CDs can be cloned." 4311 4045 msgstr "" 4312 4046 4313 4047 #. +> trunk stable 4314 4048 #: misc/k3bmediacopydialog.cpp:273 projects/k3bprojectburndialog.cpp:213 4315 msgid "" 4316 "There does not seem to be enough free space in the temporary folder. Write " 4317 "anyway?" 4049 msgid "There does not seem to be enough free space in the temporary folder. Write anyway?" 4318 4050 msgstr "" 4319 4051 … … 4368 4100 #. +> trunk stable 4369 4101 #: misc/k3bmediaformattingdialog.cpp:88 4370 msgid "" 4371 "<p>If this option is checked K3b will format a DVD-RW even if it is empty. It " 4372 "may also be used to force K3b to format a DVD+RW, BD-RE or a DVD-RW in " 4373 "restricted overwrite mode.<p><b>Caution:</b> It is not recommended to format " 4374 "a DVD often as it may become unusable after only 10-20 reformat procedures.<p>" 4375 "DVD+RW and BD-RE media only needs to be formatted once. After that it just " 4376 "needs to be overwritten. The same applies to DVD-RW in restricted overwrite " 4377 "mode." 4102 msgid "<p>If this option is checked K3b will format a DVD-RW even if it is empty. It may also be used to force K3b to format a DVD+RW, BD-RE or a DVD-RW in restricted overwrite mode.<p><b>Caution:</b> It is not recommended to format a DVD often as it may become unusable after only 10-20 reformat procedures.<p>DVD+RW and BD-RE media only needs to be formatted once. After that it just needs to be overwritten. The same applies to DVD-RW in restricted overwrite mode." 4378 4103 msgstr "" 4379 4104 … … 4385 4110 #. +> trunk stable 4386 4111 #: misc/k3bmediaformattingdialog.cpp:99 4387 msgid "" 4388 "<p>If this option is checked K3b will tell the writer to perform a quick " 4389 "format.<p>Erasing a rewritable medium completely can take a very long time " 4390 "and some writers perform a full format even if quick format is enabled." 4112 msgid "<p>If this option is checked K3b will tell the writer to perform a quick format.<p>Erasing a rewritable medium completely can take a very long time and some writers perform a full format even if quick format is enabled." 4391 4113 msgstr "" 4392 4114 … … 4579 4301 #. +> trunk stable 4580 4302 #: option/base_k3bmiscoptiontab.ui:51 4581 msgid "" 4582 "<p>This is the default temporary directory. This is where K3b will store " 4583 "temporary files such as iso images or decoded audio files.<p>Be aware that " 4584 "the temporary directory may also be changed in every project burn dialog." 4303 msgid "<p>This is the default temporary directory. This is where K3b will store temporary files such as iso images or decoded audio files.<p>Be aware that the temporary directory may also be changed in every project burn dialog." 4585 4304 msgstr "" 4586 4305 … … 4601 4320 #. +> trunk stable 4602 4321 #: option/base_k3bmiscoptiontab.ui:72 4603 msgid "" 4604 "<p>If this option is checked K3b will check the system configuration for any " 4605 "problems on startup and when the user changes the settings." 4322 msgid "<p>If this option is checked K3b will check the system configuration for any problems on startup and when the user changes the settings." 4606 4323 msgstr "" 4607 4324 … … 4627 4344 #. +> trunk 4628 4345 #: option/base_k3bmiscoptiontab.ui:91 4629 msgid "" 4630 "<p>If this option is checked K3b will display the progress in KDE " 4631 "notification area. If K3b is run outside KDE environment a separate progress " 4632 "window may be shown instead.</p>" 4346 msgid "<p>If this option is checked K3b will display the progress in KDE notification area. If K3b is run outside KDE environment a separate progress window may be shown instead.</p>" 4633 4347 msgstr "" 4634 4348 … … 4649 4363 #. +> trunk stable 4650 4364 #: option/base_k3bmiscoptiontab.ui:104 4651 msgid "" 4652 "<p>If this option is checked K3b will hide the main window while displaying " 4653 "the progress dialog." 4365 msgid "<p>If this option is checked K3b will hide the main window while displaying the progress dialog." 4654 4366 msgstr "" 4655 4367 … … 4657 4369 #. +> stable 4658 4370 #: option/base_k3bmiscoptiontab.ui:83 4659 msgid "" 4660 "<p>If this option is checked K3b will display the progress in an OSD which " 4661 "always stays on top of all other windows." 4371 msgid "<p>If this option is checked K3b will display the progress in an OSD which always stays on top of all other windows." 4662 4372 msgstr "" 4663 4373 … … 4689 4399 #. +> trunk stable 4690 4400 #: option/base_k3bmiscoptiontab.ui:127 4691 msgid "" 4692 "<p>If this option is checked K3b will not close action dialogs such as the CD " 4693 "Copy dialog after the process has been finished. It will be kept open to " 4694 "start a new process, for instance, copying another CD." 4401 msgid "<p>If this option is checked K3b will not close action dialogs such as the CD Copy dialog after the process has been finished. It will be kept open to start a new process, for instance, copying another CD." 4695 4402 msgstr "" 4696 4403 … … 4723 4430 #. +> trunk stable 4724 4431 #: option/base_k3bpluginoptiontab.ui:47 option/k3bpluginoptiontab.cpp:40 4725 msgid "" 4726 "<p>Here all <em>K3b Plugins</em> may be configured. Be aware that this does " 4727 "not include the <em>KPart Plugins</em> which embed themselves in the K3b menu " 4728 "structure.</p>" 4432 msgid "<p>Here all <em>K3b Plugins</em> may be configured. Be aware that this does not include the <em>KPart Plugins</em> which embed themselves in the K3b menu structure.</p>" 4729 4433 msgstr "" 4730 4434 … … 4817 4521 #. +> trunk stable 4818 4522 #: option/k3badvancedoptiontab.cpp:100 4819 msgid "" 4820 "Show advanced GUI elements like allowing to choose between cdrecord and cdrdao" 4523 msgid "Show advanced GUI elements like allowing to choose between cdrecord and cdrdao" 4821 4524 msgstr "" 4822 4525 … … 4838 4541 #. +> trunk stable 4839 4542 #: option/k3badvancedoptiontab.cpp:105 4840 msgid "" 4841 "<p>If this option is checked additional GUI elements which allow to influence " 4842 "the behavior of K3b are shown. This includes the manual selection of the used " 4843 "burning tool. (Choose between cdrecord and cdrdao when writing a CD or " 4844 "between cdrecord and growisofs when writing a DVD/BD.)<p><b>Be aware that K3b " 4845 "does not support all possible tools in all project types and actions.</b>" 4543 msgid "<p>If this option is checked additional GUI elements which allow to influence the behavior of K3b are shown. This includes the manual selection of the used burning tool. (Choose between cdrecord and cdrdao when writing a CD or between cdrecord and growisofs when writing a DVD/BD.)<p><b>Be aware that K3b does not support all possible tools in all project types and actions.</b>" 4846 4544 msgstr "" 4847 4545 4848 4546 #. +> trunk stable 4849 4547 #: option/k3badvancedoptiontab.cpp:113 4850 msgid "" 4851 "<p>Each medium has an official maximum capacity which is stored in a " 4852 "read-only area of the medium and is guaranteed by the vendor. However, this " 4853 "official maximum is not always the actual maximum. Many media have an actual " 4854 "total capacity that is slightly larger than the official amount.<p>If this " 4855 "option is checked K3b will disable a safety check that prevents burning " 4856 "beyond the official capacity.<p><b>Caution:</b> Enabling this option can " 4857 "cause failures in the end of the burning process if K3b attempts to write " 4858 "beyond the official capacity. It makes sense to first determine the actual " 4859 "maximum capacity of the media brand with a simulated burn." 4548 msgid "<p>Each medium has an official maximum capacity which is stored in a read-only area of the medium and is guaranteed by the vendor. However, this official maximum is not always the actual maximum. Many media have an actual total capacity that is slightly larger than the official amount.<p>If this option is checked K3b will disable a safety check that prevents burning beyond the official capacity.<p><b>Caution:</b> Enabling this option can cause failures in the end of the burning process if K3b attempts to write beyond the official capacity. It makes sense to first determine the actual maximum capacity of the media brand with a simulated burn." 4860 4549 msgstr "" 4861 4550 4862 4551 #. +> trunk stable 4863 4552 #: option/k3badvancedoptiontab.cpp:124 4864 msgid "" 4865 "<p>If this option is checked K3b will automatically erase CD-RWs and format " 4866 "DVD-RWs if one is found instead of an empty media before writing." 4553 msgid "<p>If this option is checked K3b will automatically erase CD-RWs and format DVD-RWs if one is found instead of an empty media before writing." 4867 4554 msgstr "" 4868 4555 … … 4870 4557 #: option/k3badvancedoptiontab.cpp:128 4871 4558 #, kde-format 4872 msgid "" 4873 "<p>K3b uses a software buffer during the burning process to avoid gaps in the " 4874 "data stream due to high system load. The default sizes used are %1 MB for CD " 4875 "and %2 MB for DVD burning.<p>If this option is checked the value specified " 4876 "will be used for both CD and DVD burning." 4559 msgid "<p>K3b uses a software buffer during the burning process to avoid gaps in the data stream due to high system load. The default sizes used are %1 MB for CD and %2 MB for DVD burning.<p>If this option is checked the value specified will be used for both CD and DVD burning." 4877 4560 msgstr "" 4878 4561 4879 4562 #. +> trunk stable 4880 4563 #: option/k3badvancedoptiontab.cpp:134 4881 msgid "" 4882 "<p>If this option is checked K3b will not eject the medium once the burn " 4883 "process finishes. This can be helpful in case one leaves the computer after " 4884 "starting the burning and does not want the tray to be open all the time.<p>" 4885 "However, on Linux systems a freshly burned medium has to be reloaded. " 4886 "Otherwise the system will not detect the changes and still treat it as an " 4887 "empty medium." 4564 msgid "<p>If this option is checked K3b will not eject the medium once the burn process finishes. This can be helpful in case one leaves the computer after starting the burning and does not want the tray to be open all the time.<p>However, on Linux systems a freshly burned medium has to be reloaded. Otherwise the system will not detect the changes and still treat it as an empty medium." 4888 4565 msgstr "" 4889 4566 4890 4567 #. +> trunk stable 4891 4568 #: option/k3badvancedoptiontab.cpp:140 4892 msgid "" 4893 "<p>If this option is checked K3b will continue in some situations which would " 4894 "otherwise be deemed as unsafe.<p>This setting for example disables the check " 4895 "for medium speed verification. Thus, one can force K3b to burn a high speed " 4896 "medium on a low speed writer.<p><b>Caution:</b> Enabling this option may " 4897 "result in damaged media." 4569 msgid "<p>If this option is checked K3b will continue in some situations which would otherwise be deemed as unsafe.<p>This setting for example disables the check for medium speed verification. Thus, one can force K3b to burn a high speed medium on a low speed writer.<p><b>Caution:</b> Enabling this option may result in damaged media." 4898 4570 msgstr "" 4899 4571 … … 4905 4577 #. +> trunk stable 4906 4578 #: option/k3bdeviceoptiontab.cpp:45 4907 msgid "" 4908 "K3b tries to detect all your devices properly. If K3b is unable to detect " 4909 "your drive, you need to modify their permissions to give K3b write access to " 4910 "all devices." 4579 msgid "K3b tries to detect all your devices properly. If K3b is unable to detect your drive, you need to modify their permissions to give K3b write access to all devices." 4911 4580 msgstr "" 4912 4581 … … 5022 4691 #. +> trunk stable 5023 4692 #: option/k3bexternalbinoptiontab.cpp:37 5024 msgid "" 5025 "Specify the paths to the external programs that K3b needs to work properly, " 5026 "or press \"Search\" to let K3b search for the programs." 4693 msgid "Specify the paths to the external programs that K3b needs to work properly, or press \"Search\" to let K3b search for the programs." 5027 4694 msgstr "" 5028 4695 … … 5047 4714 #. +> trunk 5048 4715 #: option/k3bexternalbinwidget.cpp:80 5049 msgid "" 5050 "<p>If K3b finds more than one installed version of a program it will choose " 5051 "one as the <em>default</em>, which will be used to do the work. If you want " 5052 "to change the default, check desired version on the list." 4716 msgid "<p>If K3b finds more than one installed version of a program it will choose one as the <em>default</em>, which will be used to do the work. If you want to change the default, check desired version on the list." 5053 4717 msgstr "" 5054 4718 5055 4719 #. +> stable 5056 4720 #: option/k3bexternalbinwidget.cpp:121 5057 msgid "" 5058 "<p>If K3b finds more than one installed version of a program it will choose " 5059 "one as the <em>default</em>, which will be used to do the work. If you want " 5060 "to change the default, select the desired version and press this button." 4721 msgid "<p>If K3b finds more than one installed version of a program it will choose one as the <em>default</em>, which will be used to do the work. If you want to change the default, select the desired version and press this button." 5061 4722 msgstr "" 5062 4723 … … 5079 4740 #. +> trunk stable 5080 4741 #: option/k3bexternalbinwidget.cpp:113 option/k3bexternalbinwidget.cpp:123 4742 #, fuzzy 5081 4743 msgid "Search Path" 5082 msgstr " "4744 msgstr "Putanja pretraÅŸivanja" 5083 4745 5084 4746 #. +> trunk stable 5085 4747 #: option/k3bexternalbinwidget.cpp:115 5086 msgid "" 5087 "<qt><b>Hint:</b> to force K3b to use another than the default name for the " 5088 "executable specify it in the search path.</qt>" 5089 msgstr "" 4748 #, fuzzy 4749 msgid "<qt><b>Hint:</b> to force K3b to use another than the default name for the executable specify it in the search path.</qt>" 4750 msgstr "<qt><b>Savjet:</b> kako biste prisilili K3b na koriÅ¡tenje posebnog naziva izvrÅ¡nog programa, navedite ga u putanji pretraÅŸivanja.</qt>" 5090 4751 5091 4752 #. +> stable … … 5144 4805 #. +> trunk stable 5145 4806 #: option/k3bmiscoptiontab.cpp:56 5146 msgid "" 5147 "K3b handles three sets of settings in action dialogs (action dialogs include " 5148 "the CD Copy dialog or the Audio CD project dialog):" 4807 msgid "K3b handles three sets of settings in action dialogs (action dialogs include the CD Copy dialog or the Audio CD project dialog):" 5149 4808 msgstr "" 5150 4809 5151 4810 #. +> trunk stable 5152 4811 #: option/k3bmiscoptiontab.cpp:59 5153 msgid "" 5154 "One of these sets is loaded once an action dialog is opened. This setting " 5155 "defines which set it will be." 4812 msgid "One of these sets is loaded once an action dialog is opened. This setting defines which set it will be." 5156 4813 msgstr "" 5157 4814 … … 5183 4840 #. +> trunk stable 5184 4841 #: option/k3bmiscoptiontab.cpp:128 5185 msgid "" 5186 "You specified a file for the temporary folder. K3b will use its base path as " 5187 "the temporary folder." 4842 msgid "You specified a file for the temporary folder. K3b will use its base path as the temporary folder." 5188 4843 msgstr "" 5189 4844 … … 5328 4983 #: option/k3bthemeoptiontab.cpp:186 5329 4984 #, kde-format 5330 msgid "" 5331 "<qt>Are you sure you want to remove the <strong>%1</strong> theme?<br><br>" 5332 "This will delete the files installed by this theme.</qt>" 4985 msgid "<qt>Are you sure you want to remove the <strong>%1</strong> theme?<br><br>This will delete the files installed by this theme.</qt>" 5333 4986 msgstr "" 5334 4987 … … 5430 5083 "<p>Set the ISO-9660 conformance level.\n" 5431 5084 "<ul>\n" 5432 "<li>Level 1: Files may only consist of one section and filenames are " 5433 "restricted to 8.3 characters.</li>\n" 5085 "<li>Level 1: Files may only consist of one section and filenames are restricted to 8.3 characters.</li>\n" 5434 5086 "<li>Level 2: Files may only consist of one section.</li>\n" 5435 5087 "<li>Level 3: No restrictions.</li>\n" 5436 5088 "</ul>\n" 5437 "<p>With all ISO-9660 levels, all filenames are restricted to upper case " 5438 "letters, numbers and the underscore (_). The maximum filename length is 31 " 5439 "characters, the directory nesting level is restricted to 8 and the maximum " 5440 "path length is limited to 255 characters. (These restrictions may be violated " 5441 "with the additional ISO-9660 features K3b offers.)" 5089 "<p>With all ISO-9660 levels, all filenames are restricted to upper case letters, numbers and the underscore (_). The maximum filename length is 31 characters, the directory nesting level is restricted to 8 and the maximum path length is limited to 255 characters. (These restrictions may be violated with the additional ISO-9660 features K3b offers.)" 5442 5090 msgstr "" 5443 5091 … … 5549 5197 #: projects/base_k3badvanceddataimagesettings.ui:239 5550 5198 msgid "" 5551 "<p>If this option is checked, K3b will generate the System Use Sharing " 5552 "Protocol records (SUSP) specified by the Rock Ridge Interchange Protocol " 5553 "(IEEE-P1282).\n" 5554 "<p>Rock Ridge extends the ISO-9660 filesystem by features equal to the UNIX " 5555 "filesystems (permissions, symbolic links, very long filenames, ...). It uses " 5556 "ISO-8859 or UTF-16 based characters and allows 255 octets.\n" 5557 "<p>Rock Ridge extensions are located at the end of each ISO-9660 directory " 5558 "record. This makes the Rock Ridge tree closely coupled to the ISO-9660 tree.\n" 5559 "<p><b>It is highly recommended to use Rock Ridge extensions on every data CD " 5560 "or DVD.</b>" 5199 "<p>If this option is checked, K3b will generate the System Use Sharing Protocol records (SUSP) specified by the Rock Ridge Interchange Protocol (IEEE-P1282).\n" 5200 "<p>Rock Ridge extends the ISO-9660 filesystem by features equal to the UNIX filesystems (permissions, symbolic links, very long filenames, ...). It uses ISO-8859 or UTF-16 based characters and allows 255 octets.\n" 5201 "<p>Rock Ridge extensions are located at the end of each ISO-9660 directory record. This makes the Rock Ridge tree closely coupled to the ISO-9660 tree.\n" 5202 "<p><b>It is highly recommended to use Rock Ridge extensions on every data CD or DVD.</b>" 5561 5203 msgstr "" 5562 5204 … … 5577 5219 #: projects/base_k3badvanceddataimagesettings.ui:259 5578 5220 msgid "" 5579 "<p>If this option is checked, K3b will add additional Joliet extensions to " 5580 "the ISO-9660 file system.\n" 5581 "<p>Joliet is not an accepted independent international standard like ISO-9660 " 5582 "or Rock Ridge. It is mainly used on Windows systems.\n" 5583 "<p>Joliet does not allow all characters, so the Joliet filenames are not " 5584 "identical to the filenames on disk (as compared to Rock Ridge). Joliet has a " 5585 "filename length limitation of 64 chars (independent from the character coding " 5586 "and type e.g. European vs. Japanese). This is inconvenient, as modern file " 5587 "systems all allow 255 characters per path name component.\n" 5221 "<p>If this option is checked, K3b will add additional Joliet extensions to the ISO-9660 file system.\n" 5222 "<p>Joliet is not an accepted independent international standard like ISO-9660 or Rock Ridge. It is mainly used on Windows systems.\n" 5223 "<p>Joliet does not allow all characters, so the Joliet filenames are not identical to the filenames on disk (as compared to Rock Ridge). Joliet has a filename length limitation of 64 chars (independent from the character coding and type e.g. European vs. Japanese). This is inconvenient, as modern file systems all allow 255 characters per path name component.\n" 5588 5224 "<p>Joliet uses UTF-16 coding.\n" 5589 "<p><b>Caution:</b> With the exception of Linux and FreeBSD, there is no " 5590 "POSIX-like OS that supports Joliet. So <b>never create Joliet-only CDs or " 5591 "DVDs</b> for that reason." 5225 "<p><b>Caution:</b> With the exception of Linux and FreeBSD, there is no POSIX-like OS that supports Joliet. So <b>never create Joliet-only CDs or DVDs</b> for that reason." 5592 5226 msgstr "" 5593 5227 … … 5608 5242 #: projects/base_k3badvanceddataimagesettings.ui:273 5609 5243 msgid "" 5610 "<p>If this option is checked K3b will create UDF filesystem structures in " 5611 "addition to the ISO9660 filesystem.\n" 5612 "<p>The UDF (<em><b>U</b>niversal <b>D</b>isk <b>F</b>ormat</em>) is mainly " 5613 "used for DVDs." 5244 "<p>If this option is checked K3b will create UDF filesystem structures in addition to the ISO9660 filesystem.\n" 5245 "<p>The UDF (<em><b>U</b>niversal <b>D</b>isk <b>F</b>ormat</em>) is mainly used for DVDs." 5614 5246 msgstr "" 5615 5247 … … 5631 5263 #: projects/base_k3badvanceddataimagesettings.ui:293 5632 5264 msgid "" 5633 "<p>If this option is checked, all files in the resulting file system will " 5634 "have exactly the same permissions as the source files. (Otherwise, all files " 5635 "will have equal permissions and be owned by root).\n" 5636 "<p>This is mainly useful for backups.<p><b>Caution:</b> The permissions may " 5637 "not make much sense on other file systems; for example, if a user that owns a " 5638 "file on the CD or DVD does not exist." 5265 "<p>If this option is checked, all files in the resulting file system will have exactly the same permissions as the source files. (Otherwise, all files will have equal permissions and be owned by root).\n" 5266 "<p>This is mainly useful for backups.<p><b>Caution:</b> The permissions may not make much sense on other file systems; for example, if a user that owns a file on the CD or DVD does not exist." 5639 5267 msgstr "" 5640 5268 … … 5759 5387 msgid "" 5760 5388 "<p><b>CD-Text</b>\n" 5761 "<p>If this option is checked K3b uses some otherwise unused space on the " 5762 "Audio CD to store additional information, such as the artist's name or the CD " 5763 "title.\n" 5389 "<p>If this option is checked K3b uses some otherwise unused space on the Audio CD to store additional information, such as the artist's name or the CD title.\n" 5764 5390 "<p>CD-Text is an extension to the audio CD standard introduced by Sony.\n" 5765 "<p>CD-Text will only be usable on CD players that support this extension " 5766 "(mostly car CD players) and software like K3b, of course.\n" 5767 "<p>Since a CD-Text-enhanced Audio CD will work in any Hifi CD or DVD player " 5768 "even if the player does not support CD-Text explicitly, enabling it is never " 5769 "a bad idea (just remember to fill in the CD-Text information)." 5391 "<p>CD-Text will only be usable on CD players that support this extension (mostly car CD players) and software like K3b, of course.\n" 5392 "<p>Since a CD-Text-enhanced Audio CD will work in any Hifi CD or DVD player even if the player does not support CD-Text explicitly, enabling it is never a bad idea (just remember to fill in the CD-Text information)." 5770 5393 msgstr "" 5771 5394 … … 5815 5438 #. +> trunk stable 5816 5439 #: projects/base_k3baudiotrackwidget.ui:176 5817 msgid "" 5818 "<p>Preemphasis is mainly used in audio processing. Higher frequencies in " 5819 "audio signals usually have lower amplitudes. This can lead to bad signal " 5820 "quality on noisy transmission because the high frequencies might become too " 5821 "weak. To avoid this effect, high frequencies are amplified before " 5822 "transmission (preemphasis); the receiver will then weaken them accordingly " 5823 "for playback." 5440 msgid "<p>Preemphasis is mainly used in audio processing. Higher frequencies in audio signals usually have lower amplitudes. This can lead to bad signal quality on noisy transmission because the high frequencies might become too weak. To avoid this effect, high frequencies are amplified before transmission (preemphasis); the receiver will then weaken them accordingly for playback." 5824 5441 msgstr "" 5825 5442 … … 5847 5464 msgid "" 5848 5465 "<p>On an audio CD each track (except for the last) can have a post-gap.\n" 5849 "This does not mean that K3b adds an additional gap of silence to the track. " 5850 "This setting simply influences the display on a Hifi audio CD player. The " 5851 "part of an audio track that is marked as post-gap is counted backwards.\n" 5852 "<p>This setting is irrelevant for most users as modern CD burners can put " 5853 "arbitrary audio data in the post-gap when burning in DAO mode.\n" 5854 "<p><i>In other CD-burning applications the post-gap might be called the " 5855 "pre-gap. The pre-gap of track 2 is the same as the post-gap of track 1.\n" 5466 "This does not mean that K3b adds an additional gap of silence to the track. This setting simply influences the display on a Hifi audio CD player. The part of an audio track that is marked as post-gap is counted backwards.\n" 5467 "<p>This setting is irrelevant for most users as modern CD burners can put arbitrary audio data in the post-gap when burning in DAO mode.\n" 5468 "<p><i>In other CD-burning applications the post-gap might be called the pre-gap. The pre-gap of track 2 is the same as the post-gap of track 1.\n" 5856 5469 "<p><b>Changing the post-gap does not change the length of the track.</b>\n" 5857 "<p><b>When writing in TAO writing mode (not recommended for Audio CDs) the " 5858 "post-gap will most likely be muted and on some burners forced to 2 seconds.<" 5859 "/b>" 5470 "<p><b>When writing in TAO writing mode (not recommended for Audio CDs) the post-gap will most likely be muted and on some burners forced to 2 seconds.</b>" 5860 5471 msgstr "" 5861 5472 … … 6040 5651 #: projects/base_k3bdataimagesettings.ui:105 6041 5652 msgid "" 6042 "<p>K3b can create ISO9660 filesystems that contain symlinks if the Rock Ridge " 6043 "extensions are enabled (they are by default). You can change the way symlinks " 6044 "are handled in a K3b project.\n" 5653 "<p>K3b can create ISO9660 filesystems that contain symlinks if the Rock Ridge extensions are enabled (they are by default). You can change the way symlinks are handled in a K3b project.\n" 6045 5654 "\n" 6046 5655 "<p><b>No Change</b><br>\n" … … 6048 5657 "\n" 6049 5658 "<p><b>Discard broken symlinks</b><br>\n" 6050 "K3b will discard all symbolic links that do not point to a file inside the " 6051 "project. That includes all links to absolute paths like " 6052 "'/home/myhome/testfile'.\n" 5659 "K3b will discard all symbolic links that do not point to a file inside the project. That includes all links to absolute paths like '/home/myhome/testfile'.\n" 6053 5660 "\n" 6054 5661 "<p><b>Discard all symlinks</b><br>\n" 6055 "K3b will discard all symbolic links that have been added to the project; " 6056 "meaning that the resulting file system will have no links at all.\n" 5662 "K3b will discard all symbolic links that have been added to the project; meaning that the resulting file system will have no links at all.\n" 6057 5663 "\n" 6058 5664 "<p><b>Follow symlinks</b><br>\n" 6059 "Each symbolic link in the project will be replaced with the contents of the " 6060 "file it is pointing to. Thus, the resulting filesystem will not contain any " 6061 "symbolic links.<br>\n" 6062 "Be aware that in case Rock Ridge extensions are disabled (which is not " 6063 "recommended) symbolic links are always followed because ISO9660 does not " 6064 "support symbolic links.\n" 5665 "Each symbolic link in the project will be replaced with the contents of the file it is pointing to. Thus, the resulting filesystem will not contain any symbolic links.<br>\n" 5666 "Be aware that in case Rock Ridge extensions are disabled (which is not recommended) symbolic links are always followed because ISO9660 does not support symbolic links.\n" 6065 5667 "\n" 6066 5668 "<p><b>Caution:</b> Symbolic links require Rock Ridge extensions." … … 6111 5713 msgid "" 6112 5714 "<p><b>No Change</b><br>\n" 6113 "If this option is checked, K3b will leave all spaces in filenames as they are." 6114 "\n" 5715 "If this option is checked, K3b will leave all spaces in filenames as they are.\n" 6115 5716 "<p><b>Strip</b><br>\n" 6116 "If this option is checked, K3b will remove all spaces from all filenames.<br>" 6117 "\n" 5717 "If this option is checked, K3b will remove all spaces from all filenames.<br>\n" 6118 5718 "Example: 'my good file.ext' becomes 'mygoodfile.ext'\n" 6119 5719 "<p><b>Extended Strip</b><br>\n" 6120 "If this option is checked K3b will remove all spaces in all filenames and " 6121 "capitalize all letters following a space.<br>\n" 5720 "If this option is checked K3b will remove all spaces in all filenames and capitalize all letters following a space.<br>\n" 6122 5721 "Example: 'my good file.ext' becomes 'myGoodFile.ext'\n" 6123 5722 "<p><b>Replace</b><br>\n" 6124 "If this option is checked, K3b will replace all spaces in all filenames with " 6125 "the specified characters.<br>\n" 5723 "If this option is checked, K3b will replace all spaces in all filenames with the specified characters.<br>\n" 6126 5724 "Example: 'my good file.ext' becomes 'my_good_file.ext'" 6127 5725 msgstr "" … … 6291 5889 #. +> trunk stable 6292 5890 #: projects/base_k3bmovixoptionswidget.ui:59 6293 msgid "" 6294 "<p>If this option is checked the order in which the files are played is " 6295 "determined randomly every time it is played." 5891 msgid "<p>If this option is checked the order in which the files are played is determined randomly every time it is played." 6296 5892 msgstr "" 6297 5893 … … 6311 5907 #. +> trunk stable 6312 5908 #: projects/base_k3bmovixoptionswidget.ui:72 6313 msgid "" 6314 "<p>If this option is checked the resulting eMovix CD/DVD will not use DMA for " 6315 "accessing the drive. This will slow down reading from the CD/DVD but may be " 6316 "necessary on some systems that do not support DMA.</p>" 5909 msgid "<p>If this option is checked the resulting eMovix CD/DVD will not use DMA for accessing the drive. This will slow down reading from the CD/DVD but may be necessary on some systems that do not support DMA.</p>" 6317 5910 msgstr "" 6318 5911 … … 6402 5995 msgid "" 6403 5996 "<p><b>Audio Player Background</b>\n" 6404 "<p>During audio playback normally the screen would be black. However, if a " 6405 "background movie has been selected, eMovix will display it during playback.\n" 6406 "<p>Additional background movies can be installed. However, this is not as " 6407 "simple as a few mouse clicks. The background movies are stored in the emovix " 6408 "shared data folder (mostly <i>/usr/share/emovix</i> or <i>" 6409 "/usr/local/share/emovix</i>) under <em>backgrounds</em>. So to add a " 6410 "background one has to copy the file to that folder." 5997 "<p>During audio playback normally the screen would be black. However, if a background movie has been selected, eMovix will display it during playback.\n" 5998 "<p>Additional background movies can be installed. However, this is not as simple as a few mouse clicks. The background movies are stored in the emovix shared data folder (mostly <i>/usr/share/emovix</i> or <i>/usr/local/share/emovix</i>) under <em>backgrounds</em>. So to add a background one has to copy the file to that folder." 6411 5999 msgstr "" 6412 6000 … … 6452 6040 msgid "" 6453 6041 "<p><b>eMovix Boot Labels</b>\n" 6454 "<p>eMovix provides a variety of different boot configurations which can be " 6455 "selected at boot time via a boot label (comparable to Lilo or Grub). The many " 6456 "different boot configurations mainly influence the Video output.\n" 6457 "<p>The <b>default</b>, <b>movix</b>, or <b>MoviX</b> labels start a general " 6458 "Vesa video driver.\n" 6459 "<p>The <b>TV</b> labels can be used to direct video to the TV output of the " 6460 "graphic board. eMovix provides TVout drivers for different brands of graphic " 6461 "boards.\n" 6462 "<p>The <b>FB</b> labels refer to configurations that start a Frame Buffer " 6463 "driver in different screen resolutions.\n" 6464 "<p>The <b>AA</b> labels make eMovix output the video through the ASCII-Art " 6465 "library which displays the picture in text mode through the usage of simple " 6466 "ASCII characters.\n" 6467 "<p>The <b>hd</b> label makes eMovix boot from the local harddisk instead of " 6468 "the medium. This can be used to prevent accidental starting of an eMovix " 6469 "medium.\n" 6470 "<p>The <b>floppy</b> label makes eMovix boot from the local floppy drive " 6471 "instead of the medium." 6042 "<p>eMovix provides a variety of different boot configurations which can be selected at boot time via a boot label (comparable to Lilo or Grub). The many different boot configurations mainly influence the Video output.\n" 6043 "<p>The <b>default</b>, <b>movix</b>, or <b>MoviX</b> labels start a general Vesa video driver.\n" 6044 "<p>The <b>TV</b> labels can be used to direct video to the TV output of the graphic board. eMovix provides TVout drivers for different brands of graphic boards.\n" 6045 "<p>The <b>FB</b> labels refer to configurations that start a Frame Buffer driver in different screen resolutions.\n" 6046 "<p>The <b>AA</b> labels make eMovix output the video through the ASCII-Art library which displays the picture in text mode through the usage of simple ASCII characters.\n" 6047 "<p>The <b>hd</b> label makes eMovix boot from the local harddisk instead of the medium. This can be used to prevent accidental starting of an eMovix medium.\n" 6048 "<p>The <b>floppy</b> label makes eMovix boot from the local floppy drive instead of the medium." 6472 6049 msgstr "" 6473 6050 … … 6481 6058 #. +> trunk stable 6482 6059 #: projects/base_k3bmovixoptionswidget.ui:232 6483 msgid "" 6484 "<p>The keyboard layout selected here will be used for eMovix commands such as " 6485 "controlling the media player." 6060 msgid "<p>The keyboard layout selected here will be used for eMovix commands such as controlling the media player." 6486 6061 msgstr "" 6487 6062 … … 6501 6076 #. +> trunk stable 6502 6077 #: projects/base_k3bmovixoptionswidget.ui:257 6503 msgid "" 6504 "<p>If this option is checked the disk will be ejected after MPlayer has " 6505 "finished." 6078 msgid "<p>If this option is checked the disk will be ejected after MPlayer has finished." 6506 6079 msgstr "" 6507 6080 … … 6521 6094 #. +> trunk stable 6522 6095 #: projects/base_k3bmovixoptionswidget.ui:270 6523 msgid "" 6524 "<p>If this option is checked the PC will be shut down after MPlayer has " 6525 "finished playing." 6096 msgid "<p>If this option is checked the PC will be shut down after MPlayer has finished playing." 6526 6097 msgstr "" 6527 6098 … … 6541 6112 #. +> trunk stable 6542 6113 #: projects/base_k3bmovixoptionswidget.ui:283 6543 msgid "" 6544 "<p>If this option is checked the PC will be rebooted after MPlayer has " 6545 "finished playing." 6114 msgid "<p>If this option is checked the PC will be rebooted after MPlayer has finished playing." 6546 6115 msgstr "" 6547 6116 … … 6588 6157 #. +> trunk stable 6589 6158 #: projects/k3baudioburndialog.cpp:119 6590 msgid "" 6591 "<p>If this option is checked K3b will <em>hide</em> the first track.<p>The " 6592 "audio CD standard uses pregaps before every track on the CD. By default these " 6593 "last for 2 seconds and are silent. In DAO mode it is possible to have longer " 6594 "pregaps that contain some audio. In this case the first pregap will contain " 6595 "the complete first track.<p>You will need to seek back from the beginning of " 6596 "the CD to listen to the first track. Try it, it is quite amusing.<p><b>This " 6597 "feature is only available in DAO mode when writing with cdrdao." 6159 msgid "<p>If this option is checked K3b will <em>hide</em> the first track.<p>The audio CD standard uses pregaps before every track on the CD. By default these last for 2 seconds and are silent. In DAO mode it is possible to have longer pregaps that contain some audio. In this case the first pregap will contain the complete first track.<p>You will need to seek back from the beginning of the CD to listen to the first track. Try it, it is quite amusing.<p><b>This feature is only available in DAO mode when writing with cdrdao." 6598 6160 msgstr "" 6599 6161 6600 6162 #. +> trunk stable 6601 6163 #: projects/k3baudioburndialog.cpp:286 projects/k3bmixedburndialog.cpp:288 6602 msgid "" 6603 "<p><b>External program <em>normalize</em> is not installed.</b><p>K3b uses <" 6604 "em>normalize</em> (http://normalize.nongnu.org/) to normalize audio tracks. " 6605 "In order to use this functionality, please install it first." 6164 msgid "<p><b>External program <em>normalize</em> is not installed.</b><p>K3b uses <em>normalize</em> (http://normalize.nongnu.org/) to normalize audio tracks. In order to use this functionality, please install it first." 6606 6165 msgstr "" 6607 6166 … … 6609 6168 #: projects/k3baudioburndialog.cpp:293 projects/k3baudioburndialog.cpp:312 6610 6169 #: projects/k3bmixedburndialog.cpp:295 projects/k3bmixedburndialog.cpp:314 6611 msgid "" 6612 "<p>K3b is not able to normalize audio tracks when burning on-the-fly. The " 6613 "external program used for this task only supports normalizing a set of audio " 6614 "files." 6170 msgid "<p>K3b is not able to normalize audio tracks when burning on-the-fly. The external program used for this task only supports normalizing a set of audio files." 6615 6171 msgstr "" 6616 6172 … … 6627 6183 msgstr "" 6628 6184 6629 #. +> trunk stable 6185 #. +> trunk 6186 #: projects/k3baudiodatasourceeditwidget.cpp:38 6187 #, fuzzy 6188 #| msgid "Shadow:" 6189 msgid "Start Offset:" 6190 msgstr "Rubovi strane" 6191 6192 #. +> stable 6630 6193 #: projects/k3baudiodatasourceeditwidget.cpp:38 6631 6194 msgid "Start Offset" 6632 6195 msgstr "" 6633 6196 6634 #. +> trunk stable 6197 #. +> trunk 6198 #: projects/k3baudiodatasourceeditwidget.cpp:39 6199 #, fuzzy 6200 msgid "End Offset:" 6201 msgstr "Pomak:" 6202 6203 #. +> stable 6635 6204 #: projects/k3baudiodatasourceeditwidget.cpp:39 6636 6205 msgid "End Offset" … … 6639 6208 #. +> trunk stable 6640 6209 #: projects/k3baudiodatasourceeditwidget.cpp:62 6641 msgid "" 6642 "Drag the edges of the highlighted area to define the portion of the audio " 6643 "source you want to include in the Audio CD track. You can also use the input " 6644 "windows to fine-tune your selection." 6210 msgid "Drag the edges of the highlighted area to define the portion of the audio source you want to include in the Audio CD track. You can also use the input windows to fine-tune your selection." 6645 6211 msgstr "" 6646 6212 … … 6721 6287 #. +> trunk stable 6722 6288 #: projects/k3baudiotrackaddingdialog.cpp:93 6723 msgid "" 6724 "You may manually convert these audio files to wave using another application " 6725 "supporting the audio format and then add the wave files to the K3b project." 6289 msgid "You may manually convert these audio files to wave using another application supporting the audio format and then add the wave files to the K3b project." 6726 6290 msgstr "" 6727 6291 … … 6956 6520 #. +> trunk stable 6957 6521 #: projects/k3bbootimageview.cpp:108 6958 msgid "" 6959 "<p>The file you selected is not a floppy image (floppy images are of size " 6960 "1200 KB, 1440 KB, or 2880 KB). You may still use boot images of other sizes " 6961 "by emulating a harddisk or disabling emulation completely. <p>If you are not " 6962 "familiar with terms like 'harddisk emulation' you most likely want to use a " 6963 "floppy image here. Floppy images can be created by directly extracting them " 6964 "from a real floppy disk:<pre>dd if=/dev/floppy of=/tmp/floppy.img</pre>or by " 6965 "using one of the many boot floppy generators that can be found on <a " 6966 "href=\"http://www.google.com/search?q=linux+boot+floppy&ie=UTF-8&oe=UTF-8\">" 6967 "the Internet</a>." 6522 msgid "<p>The file you selected is not a floppy image (floppy images are of size 1200 KB, 1440 KB, or 2880 KB). You may still use boot images of other sizes by emulating a harddisk or disabling emulation completely. <p>If you are not familiar with terms like 'harddisk emulation' you most likely want to use a floppy image here. Floppy images can be created by directly extracting them from a real floppy disk:<pre>dd if=/dev/floppy of=/tmp/floppy.img</pre>or by using one of the many boot floppy generators that can be found on <a href=\"http://www.google.com/search?q=linux+boot+floppy&ie=UTF-8&oe=UTF-8\">the Internet</a>." 6968 6523 msgstr "" 6969 6524 … … 7043 6598 #. +> trunk stable 7044 6599 #: projects/k3bdataburndialog.cpp:262 7045 msgid "" 7046 "It is not possible to write multisession media in DAO mode. Multisession has " 7047 "been disabled." 6600 msgid "It is not possible to write multisession media in DAO mode. Multisession has been disabled." 7048 6601 msgstr "" 7049 6602 … … 7083 6636 #: projects/k3bdataimagesettingswidget.cpp:98 7084 6637 #, fuzzy 7085 msgctxt "" 7086 "This is the default volume identifier of a data project created by K3b. The " 7087 "string should not be longer than 16 characters to avoid warnings regarding " 7088 "Joiliet extensions which induce this restriction." 6638 msgctxt "This is the default volume identifier of a data project created by K3b. The string should not be longer than 16 characters to avoid warnings regarding Joiliet extensions which induce this restriction." 7089 6639 msgid "K3b data project" 7090 6640 msgstr "Quanta projekt" … … 7092 6642 #. +> trunk stable 7093 6643 #: projects/k3bdataimagesettingswidget.cpp:152 7094 msgid "" 7095 "<p><b>File System Presets</b><p>K3b provides the following file system " 7096 "Presets which allow for a quick selection of the most frequently used " 7097 "settings." 6644 msgid "<p><b>File System Presets</b><p>K3b provides the following file system Presets which allow for a quick selection of the most frequently used settings." 7098 6645 msgstr "" 7099 6646 7100 6647 #. +> trunk stable 7101 6648 #: projects/k3bdataimagesettingswidget.cpp:156 7102 msgid "" 7103 "The file system is optimized for usage on Linux/Unix systems. This mainly " 7104 "means that it uses the Rock Ridge extensions to provide long filenames, " 7105 "symbolic links, and POSIX compatible file permissions." 6649 msgid "The file system is optimized for usage on Linux/Unix systems. This mainly means that it uses the Rock Ridge extensions to provide long filenames, symbolic links, and POSIX compatible file permissions." 7106 6650 msgstr "" 7107 6651 7108 6652 #. +> trunk stable 7109 6653 #: projects/k3bdataimagesettingswidget.cpp:160 7110 msgid "" 7111 "In addition to the settings for Linux/Unix the file system contains a Joliet " 7112 "tree which allows for long file names on Windows which does not support the " 7113 "Rock Ridge extensions. Be aware that the file name length is restricted to " 7114 "103 characters." 6654 msgid "In addition to the settings for Linux/Unix the file system contains a Joliet tree which allows for long file names on Windows which does not support the Rock Ridge extensions. Be aware that the file name length is restricted to 103 characters." 7115 6655 msgstr "" 7116 6656 7117 6657 #. +> trunk stable 7118 6658 #: projects/k3bdataimagesettingswidget.cpp:164 7119 msgid "" 7120 "The file system has additional UDF entries attached to it. This raises the " 7121 "maximal file size to 4 GB. Be aware that the UDF support in K3b is limited." 6659 msgid "The file system has additional UDF entries attached to it. This raises the maximal file size to 4 GB. Be aware that the UDF support in K3b is limited." 7122 6660 msgstr "" 7123 6661 7124 6662 #. +> trunk stable 7125 6663 #: projects/k3bdataimagesettingswidget.cpp:167 7126 msgid "" 7127 "The file system is optimized for compatibility with old systems. That means " 7128 "file names are restricted to 8.3 characters and no symbolic links or file " 7129 "permissions are supported." 6664 msgid "The file system is optimized for compatibility with old systems. That means file names are restricted to 8.3 characters and no symbolic links or file permissions are supported." 7130 6665 msgstr "" 7131 6666 … … 7158 6693 #. +> trunk stable 7159 6694 #: projects/k3bdataimagesettingswidget.cpp:247 7160 msgid "" 7161 "<p>Be aware that it is not recommended to disable the Rock Ridge Extensions. " 7162 "There is no disadvantage in enabling Rock Ridge (except for a very small " 7163 "space overhead) but a lot of advantages.<p>Without Rock Ridge Extensions " 7164 "symbolic links are not supported and will always be followed as if the " 7165 "\"Follow Symbolic Links\" option was enabled." 6695 msgid "<p>Be aware that it is not recommended to disable the Rock Ridge Extensions. There is no disadvantage in enabling Rock Ridge (except for a very small space overhead) but a lot of advantages.<p>Without Rock Ridge Extensions symbolic links are not supported and will always be followed as if the \"Follow Symbolic Links\" option was enabled." 7166 6696 msgstr "" 7167 6697 … … 7173 6703 #. +> trunk stable 7174 6704 #: projects/k3bdataimagesettingswidget.cpp:259 7175 msgid "" 7176 "<p>Be aware that without the Joliet extensions Windows systems will not be " 7177 "able to display long filenames. You will only see the ISO9660 filenames.<p>If " 7178 "you do not intend to use the CD/DVD on a Windows system it is safe to disable " 7179 "Joliet." 6705 msgid "<p>Be aware that without the Joliet extensions Windows systems will not be able to display long filenames. You will only see the ISO9660 filenames.<p>If you do not intend to use the CD/DVD on a Windows system it is safe to disable Joliet." 7180 6706 msgstr "" 7181 6707 … … 7192 6718 #. +> trunk stable 7193 6719 #: projects/k3bdatamultisessioncombobox.cpp:37 7194 msgid "" 7195 "<p><b>Multisession Mode</b><p><b>Auto</b><br>Let K3b decide which mode to use." 7196 " The decision will be based on the size of the project (does it fill the " 7197 "whole media) and the state of the inserted media (appendable or not).<p><b>No " 7198 "Multisession</b><br>Create a single-session CD or DVD and close the disk.<p><" 7199 "b>Start Multisession</b><br>Start a multisession CD or DVD, not closing the " 7200 "disk to allow further sessions to be appended.<p><b>Continue Multisession</b>" 7201 "<br>Continue an appendable data CD (as for example created in <em>Start " 7202 "Multisession</em> mode) and add another session without closing the disk to " 7203 "allow further sessions to be appended.<p><b>Finish Multisession</b><br>" 7204 "Continue an appendable data CD (as for example created in <em>Start " 7205 "Multisession</em> mode), add another session, and close the disk.<p><em>In " 7206 "the case of DVD+RW and DVD-RW restricted overwrite media K3b will not " 7207 "actually create multiple sessions but grow the file system to include the new " 7208 "data.</em>" 6720 msgid "<p><b>Multisession Mode</b><p><b>Auto</b><br>Let K3b decide which mode to use. The decision will be based on the size of the project (does it fill the whole media) and the state of the inserted media (appendable or not).<p><b>No Multisession</b><br>Create a single-session CD or DVD and close the disk.<p><b>Start Multisession</b><br>Start a multisession CD or DVD, not closing the disk to allow further sessions to be appended.<p><b>Continue Multisession</b><br>Continue an appendable data CD (as for example created in <em>Start Multisession</em> mode) and add another session without closing the disk to allow further sessions to be appended.<p><b>Finish Multisession</b><br>Continue an appendable data CD (as for example created in <em>Start Multisession</em> mode), add another session, and close the disk.<p><em>In the case of DVD+RW and DVD-RW restricted overwrite media K3b will not actually create multiple sessions but grow the file system to include the new data.</em>" 7209 6721 msgstr "" 7210 6722 … … 7231 6743 #. +> trunk stable 7232 6744 #: projects/k3bdatamultisessionimportdialog.cpp:98 7233 msgid "" 7234 "<p>K3b found session containing Joliet information for long filenames but no " 7235 "Rock Ridge extensions.<p>The filenames in the imported session will be " 7236 "converted to a restricted character set in the new session. This character " 7237 "set is based on the ISO9660 settings in the K3b project. K3b is not able to " 7238 "display these converted filenames yet." 6745 msgid "<p>K3b found session containing Joliet information for long filenames but no Rock Ridge extensions.<p>The filenames in the imported session will be converted to a restricted character set in the new session. This character set is based on the ISO9660 settings in the K3b project. K3b is not able to display these converted filenames yet." 7239 6746 msgstr "" 7240 6747 … … 7382 6889 #. +> trunk stable 7383 6890 #: projects/k3bdatapropertiesdialog.cpp:165 7384 msgid "" 7385 "<p>If this option is checked, the file or folder (and its entire contents) " 7386 "will be hidden on the ISO9660 and RockRidge filesystem.</p><p>This is useful, " 7387 "for example, for having different README files for RockRidge and Joliet, " 7388 "which can be managed by hiding README.joliet on RockRidge and README.rr on " 7389 "the Joliet filesystem.</p>" 6891 msgid "<p>If this option is checked, the file or folder (and its entire contents) will be hidden on the ISO9660 and RockRidge filesystem.</p><p>This is useful, for example, for having different README files for RockRidge and Joliet, which can be managed by hiding README.joliet on RockRidge and README.rr on the Joliet filesystem.</p>" 7390 6892 msgstr "" 7391 6893 7392 6894 #. +> trunk stable 7393 6895 #: projects/k3bdatapropertiesdialog.cpp:172 7394 msgid "" 7395 "<p>If this option is checked, the file or folder (and its entire contents) " 7396 "will be hidden on the Joliet filesystem.</p><p>This is useful, for example, " 7397 "for having different README files for RockRidge and Joliet, which can be " 7398 "managed by hiding README.joliet on RockRidge and README.rr on the Joliet " 7399 "filesystem.</p>" 6896 msgid "<p>If this option is checked, the file or folder (and its entire contents) will be hidden on the Joliet filesystem.</p><p>This is useful, for example, for having different README files for RockRidge and Joliet, which can be managed by hiding README.joliet on RockRidge and README.rr on the Joliet filesystem.</p>" 7400 6897 msgstr "" 7401 6898 7402 6899 #. +> trunk stable 7403 6900 #: projects/k3bdatapropertiesdialog.cpp:179 7404 msgid "" 7405 "<p>This value modifies the physical sort order of the files in the ISO9660 " 7406 "filesystem. A higher weighting means that the file will be located closer to " 7407 "the beginning of the image (and the disk).<p>This option is useful in order " 7408 "to optimize the data layout on a medium.<p><b>Caution:</b> This does not sort " 7409 "the order of the file names that appear in the ISO9660 folder. It sorts the " 7410 "order in which the file data is written to the image." 6901 msgid "<p>This value modifies the physical sort order of the files in the ISO9660 filesystem. A higher weighting means that the file will be located closer to the beginning of the image (and the disk).<p>This option is useful in order to optimize the data layout on a medium.<p><b>Caution:</b> This does not sort the order of the file names that appear in the ISO9660 folder. It sorts the order in which the file data is written to the image." 7411 6902 msgstr "" 7412 6903 … … 7501 6992 msgstr[2] "Otvori datoteku" 7502 6993 6994 #. +> trunk 6995 #: projects/k3bdatapropertiesdialog.cpp:305 6996 #, fuzzy 6997 msgid "No Files" 6998 msgstr "INI datoteke" 6999 7503 7000 #. +> stable 7504 7001 #: projects/k3bdatapropertiesdialog.cpp:293 … … 7519 7016 msgstr[2] "%1 mapa" 7520 7017 7018 #. +> trunk 7019 #: projects/k3bdatapropertiesdialog.cpp:310 7020 #, fuzzy 7021 #| msgid "Folders" 7022 msgid "No Folders" 7023 msgstr "Mape" 7024 7521 7025 #. +> trunk stable 7522 7026 #: projects/k3bdataurladdingdialog.cpp:95 … … 7527 7031 #. +> trunk stable 7528 7032 #: projects/k3bdataurladdingdialog.cpp:117 7033 #, kde-format 7034 msgid "Adding files to project '%1'" 7035 msgstr "" 7036 7037 #. +> trunk 7529 7038 #: projects/k3bdataurladdingdialog.cpp:123 7530 #, kde-format7531 msgid "Adding files to project '%1' "7532 msgstr " "7039 #, fuzzy, kde-format 7040 msgid "Adding files to project '%1'..." 7041 msgstr "Dodavanje datoteka u SVN repozitorijâŠ" 7533 7042 7534 7043 #. +> trunk stable 7535 7044 #: projects/k3bdataurladdingdialog.cpp:197 7536 msgid "" 7537 "<p>The file you are about to add to the project is an ISO9660 image. As such " 7538 "it can be burned to a medium directly since it already contains a file system." 7539 "<br>Are you sure you want to add this file to the project?" 7045 msgid "<p>The file you are about to add to the project is an ISO9660 image. As such it can be burned to a medium directly since it already contains a file system.<br>Are you sure you want to add this file to the project?" 7540 7046 msgstr "" 7541 7047 … … 7627 7133 #: projects/k3bdataurladdingdialog.cpp:462 7628 7134 #, kde-format 7629 msgid "" 7630 "<p>'%1' is a symbolic link to folder '%2'.<p>If you intend to make K3b follow " 7631 "symbolic links you should consider letting K3b do this now since K3b will not " 7632 "be able to do so afterwards because symbolic links to folders inside a K3b " 7633 "project cannot be resolved.<p><b>If you do not intend to enable the option <" 7634 "em>follow symbolic links</em> you may safely ignore this warning and choose " 7635 "to add the link to the project.</b>" 7135 msgid "<p>'%1' is a symbolic link to folder '%2'.<p>If you intend to make K3b follow symbolic links you should consider letting K3b do this now since K3b will not be able to do so afterwards because symbolic links to folders inside a K3b project cannot be resolved.<p><b>If you do not intend to enable the option <em>follow symbolic links</em> you may safely ignore this warning and choose to add the link to the project.</b>" 7636 7136 msgstr "" 7637 7137 … … 7692 7192 #. +> trunk stable 7693 7193 #: projects/k3bdataurladdingdialog.cpp:786 7694 msgid "" 7695 "Do you also want to add system files (FIFOs, sockets, device files, and " 7696 "broken symlinks)?" 7194 msgid "Do you also want to add system files (FIFOs, sockets, device files, and broken symlinks)?" 7697 7195 msgstr "" 7698 7196 … … 7715 7213 #. +> trunk stable 7716 7214 #: projects/k3bdataurladdingdialog.cpp:824 7717 msgid "" 7718 "The following filenames have an invalid encoding. You may fix this with the " 7719 "convmv tool" 7215 msgid "The following filenames have an invalid encoding. You may fix this with the convmv tool" 7720 7216 msgstr "" 7721 7217 … … 7788 7284 #. +> trunk stable 7789 7285 #: projects/k3bdataviewimpl.cpp:221 7790 msgid "" 7791 "A file with that name already exists. Please insert the name for the new " 7792 "folder:" 7286 msgid "A file with that name already exists. Please insert the name for the new folder:" 7793 7287 msgstr "" 7794 7288 … … 7797 7291 msgid "Edit Boot Images" 7798 7292 msgstr "" 7799 7800 #. +> trunk stable7801 #: projects/k3bfillstatusdisplay.cpp:180 projects/k3bfillstatusdisplay.cpp:5867802 #: projects/k3bfillstatusdisplay.cpp:8497803 #, fuzzy7804 msgid "min"7805 msgstr " min"7806 7293 7807 7294 #. +> trunk stable … … 7906 7393 #. +> trunk stable 7907 7394 #: projects/k3bfillstatusdisplay.cpp:571 7908 msgid "" 7909 "<p><b>Why does K3b offer 4.4 GB and 8.0 GB instead of 4.7 and 8.5 like it " 7910 "says on the media?</b><p>A single layer DVD media has a capacity of " 7911 "approximately 4.4 GB which equals 4.4*1024<sup>3</sup> bytes. Media producers " 7912 "just calculate with 1000 instead of 1024 for advertising reasons.<br>This " 7913 "results in 4.4*1024<sup>3</sup>/1000<sup>3</sup> = 4.7 GB." 7395 msgid "<p><b>Why does K3b offer 4.4 GB and 8.0 GB instead of 4.7 and 8.5 like it says on the media?</b><p>A single layer DVD media has a capacity of approximately 4.4 GB which equals 4.4*1024<sup>3</sup> bytes. Media producers just calculate with 1000 instead of 1024 for advertising reasons.<br>This results in 4.4*1024<sup>3</sup>/1000<sup>3</sup> = 4.7 GB." 7914 7396 msgstr "" 7915 7397 … … 7921 7403 7922 7404 #. +> trunk stable 7405 #: projects/k3bfillstatusdisplay.cpp:586 7406 #, fuzzy 7407 msgid "min" 7408 msgstr " min" 7409 7410 #. +> trunk stable 7923 7411 #: projects/k3bfillstatusdisplay.cpp:599 7924 7412 msgid "Custom Size" … … 7927 7415 #. +> trunk stable 7928 7416 #: projects/k3bfillstatusdisplay.cpp:600 7929 msgid "" 7930 "<p>Please specify the size of the medium. Use suffixes <b>GB</b>,<b>MB</b>, " 7931 "and <b>min</b> for <em>gigabytes</em>, <em>megabytes</em>, and <em>minutes<" 7932 "/em> respectively." 7417 msgid "<p>Please specify the size of the medium. Use suffixes <b>GB</b>,<b>MB</b>, and <b>min</b> for <em>gigabytes</em>, <em>megabytes</em>, and <em>minutes</em> respectively." 7933 7418 msgstr "" 7934 7419 … … 7965 7450 #. +> trunk stable 7966 7451 #: projects/k3bmixedburndialog.cpp:104 7967 msgid "" 7968 "<em>Blue book CD</em><br>K3b will create a multisession CD with 2 sessions. " 7969 "The first session will contain all audio tracks and the second session will " 7970 "contain a mode 2 form 1 data track.<br>This mode is based on the <em>Blue " 7971 "book</em> standard (also known as <em>Extended Audio CD</em>, <em>CD-Extra<" 7972 "/em>, or <em>CD Plus</em>) and has the advantage that a hifi audio CD player " 7973 "will only recognize the first session and ignore the second session with the " 7974 "data track.<br>If the CD is intended to be used in a hifi audio CD player " 7975 "this is the recommended mode.<br>Some older CD-ROMs may have problems reading " 7976 "a blue book CD since it is a multisession CD." 7452 msgid "<em>Blue book CD</em><br>K3b will create a multisession CD with 2 sessions. The first session will contain all audio tracks and the second session will contain a mode 2 form 1 data track.<br>This mode is based on the <em>Blue book</em> standard (also known as <em>Extended Audio CD</em>, <em>CD-Extra</em>, or <em>CD Plus</em>) and has the advantage that a hifi audio CD player will only recognize the first session and ignore the second session with the data track.<br>If the CD is intended to be used in a hifi audio CD player this is the recommended mode.<br>Some older CD-ROMs may have problems reading a blue book CD since it is a multisession CD." 7977 7453 msgstr "" 7978 7454 … … 7999 7475 #. +> trunk stable 8000 7476 #: projects/k3bmixedburndialog.cpp:128 8001 msgid "" 8002 "<b>Caution:</b> The last two modes should only be used for CDs that are " 8003 "unlikely to be played on a hifi audio CD player.<br>It could lead to problems " 8004 "with some older hifi audio CD players that try to play the data track." 7477 msgid "<b>Caution:</b> The last two modes should only be used for CDs that are unlikely to be played on a hifi audio CD player.<br>It could lead to problems with some older hifi audio CD players that try to play the data track." 8005 7478 msgstr "" 8006 7479 … … 8064 7537 msgstr "zadano" 8065 7538 8066 #. +> trunk stable 7539 #. +> trunk 7540 #: projects/k3bmovixprojectmodel.cpp:296 7541 #, fuzzy, kde-format 7542 msgid "%1 (broken)" 7543 msgstr "%1 (trenutno)" 7544 7545 #. +> stable 8067 7546 #: projects/k3bmovixprojectmodel.cpp:296 8068 7547 msgid " (broken)" … … 8327 7806 #. +> trunk stable 8328 7807 #: projects/k3bvcdburndialog.cpp:117 projects/k3bvcdtrackdialog.cpp:258 8329 msgid "" 8330 "Playback control, PBC, is available for Video CD 2.0 and Super Video CD 1.0 " 8331 "disc formats." 7808 msgid "Playback control, PBC, is available for Video CD 2.0 and Super Video CD 1.0 disc formats." 8332 7809 msgstr "" 8333 7810 … … 8344 7821 #. +> trunk stable 8345 7822 #: projects/k3bvcdburndialog.cpp:120 8346 msgid "" 8347 "This controls whether to update the scan data information contained in the " 8348 "MPEG-2 video streams." 7823 msgid "This controls whether to update the scan data information contained in the MPEG-2 video streams." 8349 7824 msgstr "" 8350 7825 8351 7826 #. +> trunk stable 8352 7827 #: projects/k3bvcdburndialog.cpp:121 8353 msgid "" 8354 "This element allows to set viewing restrictions which may be interpreted by " 8355 "the playing device." 7828 msgid "This element allows to set viewing restrictions which may be interpreted by the playing device." 8356 7829 msgstr "" 8357 7830 … … 8363 7836 #. +> trunk stable 8364 7837 #: projects/k3bvcdburndialog.cpp:124 8365 msgid "" 8366 "Used to set the number of empty sectors added before the lead-out area begins." 7838 msgid "Used to set the number of empty sectors added before the lead-out area begins." 8367 7839 msgstr "" 8368 7840 … … 8384 7856 #. +> trunk stable 8385 7857 #: projects/k3bvcdburndialog.cpp:131 8386 msgid "" 8387 "<p>This is the most basic <b>Video CD</b> specification dating back to 1993, " 8388 "which has the following characteristics:<ul><li>One mode2 mixed form ISO-9660 " 8389 "track containing file pointers to the information areas.</li><li>Up to 98 " 8390 "multiplex-ed MPEG-1 audio/video streams or CD-DA audio tracks.</li><li>Up to " 8391 "500 MPEG sequence entry points used as chapter divisions.</li></ul><p>The " 8392 "Video CD specification requires the multiplex-ed MPEG-1 stream to have a CBR " 8393 "of less than 174300 bytes (1394400 bits) per second in order to accommodate " 8394 "single speed CD-ROM drives.<br>The specification allows for the following two " 8395 "resolutions:<ul><li>352 x 240 @ 29.97 Hz (NTSC SIF).</li><li>352 x 240 @ 23." 8396 "976 Hz (FILM SIF).</li></ul><p>The CBR MPEG-1, layer II audio stream is fixed " 8397 "at 224 kbps with 1 stereo or 2 mono channels.<p><b>It is recommended to keep " 8398 "the video bit-rate under 1151929.1 bps.</b>" 7858 msgid "<p>This is the most basic <b>Video CD</b> specification dating back to 1993, which has the following characteristics:<ul><li>One mode2 mixed form ISO-9660 track containing file pointers to the information areas.</li><li>Up to 98 multiplex-ed MPEG-1 audio/video streams or CD-DA audio tracks.</li><li>Up to 500 MPEG sequence entry points used as chapter divisions.</li></ul><p>The Video CD specification requires the multiplex-ed MPEG-1 stream to have a CBR of less than 174300 bytes (1394400 bits) per second in order to accommodate single speed CD-ROM drives.<br>The specification allows for the following two resolutions:<ul><li>352 x 240 @ 29.97 Hz (NTSC SIF).</li><li>352 x 240 @ 23.976 Hz (FILM SIF).</li></ul><p>The CBR MPEG-1, layer II audio stream is fixed at 224 kbps with 1 stereo or 2 mono channels.<p><b>It is recommended to keep the video bit-rate under 1151929.1 bps.</b>" 8399 7859 msgstr "" 8400 7860 8401 7861 #. +> trunk stable 8402 7862 #: projects/k3bvcdburndialog.cpp:142 8403 msgid "" 8404 "<p>About two years after the Video CD 1.1 specification came out, an improved " 8405 "<b>Video CD 2.0</b> standard was published in 1995.<p>This one added the " 8406 "following items to the features already available in the Video CD 1.1 " 8407 "specification:<ul><li>Support for MPEG segment play items (<b>\"SPI\"</b>), " 8408 "consisting of still pictures, motion pictures and/or audio (only) streams was " 8409 "added.</li><li>Note Segment Items::.</li><li>Support for interactive playback " 8410 "control (<b>\"PBC\"</b>) was added.</li><li>Support for playing related " 8411 "access by providing a scan point index file was added. (<b>\"/EXT/SCANDATA." 8412 "DAT\"</b>)</li><li>Support for closed captions.</li><li>Support for mixing " 8413 "NTSC and PAL content.</li></ul><p>By adding PAL support to the Video CD 1.1 " 8414 "specification, the following resolutions became available:<ul><li>352 x 240 @ " 8415 "29.97 Hz (NTSC SIF).</li><li>352 x 240 @ 23.976 Hz (FILM SIF).</li><li>352 x " 8416 "288 @ 25 Hz (PAL SIF).</li></ul><p>For segment play items the following audio " 8417 "encodings became available:<ul><li>Joint stereo, stereo or dual channel audio " 8418 "streams at 128, 192, 224 or 384 kbit/sec bit-rate.</li><li>Mono audio streams " 8419 "at 64, 96 or 192 kbit/sec bit-rate.</li></ul><p>Also the possibility to have " 8420 "audio only streams and still pictures was provided.<p><b>The bit-rate of " 8421 "multiplex-ed streams should be kept under 174300 bytes/sec (except for single " 8422 "still picture items) in order to accommodate single speed drives.</b>" 7863 msgid "<p>About two years after the Video CD 1.1 specification came out, an improved <b>Video CD 2.0</b> standard was published in 1995.<p>This one added the following items to the features already available in the Video CD 1.1 specification:<ul><li>Support for MPEG segment play items (<b>\"SPI\"</b>), consisting of still pictures, motion pictures and/or audio (only) streams was added.</li><li>Note Segment Items::.</li><li>Support for interactive playback control (<b>\"PBC\"</b>) was added.</li><li>Support for playing related access by providing a scan point index file was added. (<b>\"/EXT/SCANDATA.DAT\"</b>)</li><li>Support for closed captions.</li><li>Support for mixing NTSC and PAL content.</li></ul><p>By adding PAL support to the Video CD 1.1 specification, the following resolutions became available:<ul><li>352 x 240 @ 29.97 Hz (NTSC SIF).</li><li>352 x 240 @ 23.976 Hz (FILM SIF).</li><li>352 x 288 @ 25 Hz (PAL SIF).</li></ul><p>For segment play items the following audio encodings became available:<ul><li>Joint stereo, stereo or dual channel audio streams at 128, 192, 224 or 384 kbit/sec bit-rate.</li><li>Mono audio streams at 64, 96 or 192 kbit/sec bit-rate.</li></ul><p>Also the possibility to have audio only streams and still pictures was provided.<p><b>The bit-rate of multiplex-ed streams should be kept under 174300 bytes/sec (except for single still picture items) in order to accommodate single speed drives.</b>" 8423 7864 msgstr "" 8424 7865 8425 7866 #. +> trunk stable 8426 7867 #: projects/k3bvcdburndialog.cpp:160 8427 msgid "" 8428 "<p>With the upcoming of the DVD-V media, a new VCD standard had to be " 8429 "published in order to be able to keep up with technology, so the Super Video " 8430 "CD specification was called into life 1999.<p>In the midst of 2000 a full " 8431 "subset of this <b>Super Video CD</b> specification was published as <b>" 8432 "IEC-62107</b>.<p>As the most notable change over Video CD 2.0 is a switch " 8433 "from MPEG-1 CBR to MPEG-2 VBR encoding for the video stream was performed.<p>" 8434 "The following new features--building upon the Video CD 2.0 " 8435 "specification--are:<ul><li>Use of MPEG-2 encoding instead of MPEG-1 for the " 8436 "video stream.</li><li>Allowed VBR encoding of MPEG-1 audio stream.</li><li>" 8437 "Higher resolutions (see below) for video stream resolution.</li><li>Up to 4 " 8438 "overlay graphics and text (<b>\"OGT\"</b>) sub-channels for user switchable " 8439 "subtitle displaying in addition to the already existing closed caption " 8440 "facility.</li><li>Command lists for controlling the SVCD virtual machine.</li>" 8441 "</ul><p>For the <b>Super Video CD</b>, only the following two resolutions are " 8442 "supported for motion video and (low resolution) still pictures:<ul><li>480 x " 8443 "480 @ 29.97 Hz (NTSC 2/3 D-2).</li><li>480 x 576 @ 25 Hz (PAL 2/3 D-2).</li><" 8444 "/ul>" 7868 msgid "<p>With the upcoming of the DVD-V media, a new VCD standard had to be published in order to be able to keep up with technology, so the Super Video CD specification was called into life 1999.<p>In the midst of 2000 a full subset of this <b>Super Video CD</b> specification was published as <b>IEC-62107</b>.<p>As the most notable change over Video CD 2.0 is a switch from MPEG-1 CBR to MPEG-2 VBR encoding for the video stream was performed.<p>The following new features--building upon the Video CD 2.0 specification--are:<ul><li>Use of MPEG-2 encoding instead of MPEG-1 for the video stream.</li><li>Allowed VBR encoding of MPEG-1 audio stream.</li><li>Higher resolutions (see below) for video stream resolution.</li><li>Up to 4 overlay graphics and text (<b>\"OGT\"</b>) sub-channels for user switchable subtitle displaying in addition to the already existing closed caption facility.</li><li>Command lists for controlling the SVCD virtual machine.</li></ul><p>For the <b>Super Video CD</b>, only the following two resolutions are supported for motion video and (low resolution) still pictures:<ul><li>480 x 480 @ 29.97 Hz (NTSC 2/3 D-2).</li><li>480 x 576 @ 25 Hz (PAL 2/3 D-2).</li></ul>" 8445 7869 msgstr "" 8446 7870 8447 7871 #. +> trunk stable 8448 7872 #: projects/k3bvcdburndialog.cpp:173 8449 msgid "" 8450 "<p>This is actually just a minor variation defined in IEC-62107 on the Super " 8451 "Video CD 1.0 format for compatibility with current products in the market.<p>" 8452 "It differs from the Super Video CD 1.0 format in the following items:<ul><li>" 8453 "The system profile tag field in <b>/SVCD/INFO.SVD</b> is set to <b>1</b> " 8454 "instead of <b>0</b>.</li><li>The system identification field value in <b>" 8455 "/SVCD/INFO.SVD</b> is set to <b>HQ-VCD</b> instead of <b>SUPERVCD</b>.</li><" 8456 "li><b>/EXT/SCANDATA.DAT</b> is mandatory instead of being optional.</li><li><" 8457 "b>/SVCD/SEARCH.DAT</b> is optional instead of being mandatory.</li></ul>" 7873 msgid "<p>This is actually just a minor variation defined in IEC-62107 on the Super Video CD 1.0 format for compatibility with current products in the market.<p>It differs from the Super Video CD 1.0 format in the following items:<ul><li>The system profile tag field in <b>/SVCD/INFO.SVD</b> is set to <b>1</b> instead of <b>0</b>.</li><li>The system identification field value in <b>/SVCD/INFO.SVD</b> is set to <b>HQ-VCD</b> instead of <b>SUPERVCD</b>.</li><li><b>/EXT/SCANDATA.DAT</b> is mandatory instead of being optional.</li><li><b>/SVCD/SEARCH.DAT</b> is optional instead of being mandatory.</li></ul>" 8458 7874 msgstr "" 8459 7875 8460 7876 #. +> trunk 8461 7877 #: projects/k3bvcdburndialog.cpp:180 8462 msgid "" 8463 "<p>If Autodetect is:</p><ul><li>ON then K3b will set the correct Video CD " 8464 "type.</li><li>OFF then the correct Video CD type needs to be set by the user." 8465 "</li></ul><p>If you are not sure about the correct Video CD type, it is best " 8466 "to turn Autodetect ON.</p><p>If you want to force the Video CD type, you must " 8467 "turn Autodetect OFF. This is useful for some standalone DVD players without " 8468 "SVCD support.</p>" 7878 msgid "<p>If Autodetect is:</p><ul><li>ON then K3b will set the correct Video CD type.</li><li>OFF then the correct Video CD type needs to be set by the user.</li></ul><p>If you are not sure about the correct Video CD type, it is best to turn Autodetect ON.</p><p>If you want to force the Video CD type, you must turn Autodetect OFF. This is useful for some standalone DVD players without SVCD support.</p>" 8469 7879 msgstr "" 8470 7880 8471 7881 #. +> stable 8472 7882 #: projects/k3bvcdburndialog.cpp:180 8473 msgid "" 8474 "<p>If Autodetect is:</p><ul><li>ON then K3b will set the correct VideoCD type." 8475 "</li><li>OFF then the correct VideoCD type needs to be set by the user.</li><" 8476 "/ul><p>If you are not sure about the correct VideoCD type, it is best to turn " 8477 "Autodetect ON.</p><p>If you want to force the VideoCD type, you must turn " 8478 "Autodetect OFF. This is useful for some standalone DVD players without SVCD " 8479 "support.</p>" 7883 msgid "<p>If Autodetect is:</p><ul><li>ON then K3b will set the correct VideoCD type.</li><li>OFF then the correct VideoCD type needs to be set by the user.</li></ul><p>If you are not sure about the correct VideoCD type, it is best to turn Autodetect ON.</p><p>If you want to force the VideoCD type, you must turn Autodetect OFF. This is useful for some standalone DVD players without SVCD support.</p>" 8480 7884 msgstr "" 8481 7885 8482 7886 #. +> trunk stable 8483 7887 #: projects/k3bvcdburndialog.cpp:186 8484 msgid "" 8485 "<ul><li>Rename <b>\"/MPEG2\"</b> folder on SVCDs to (non-compliant) " 8486 "\"/MPEGAV\".</li><li>Enables the use of the (deprecated) signature <b>" 8487 "\"ENTRYSVD\"</b> instead of <b>\"ENTRYVCD\"</b> for the file <b>\"/SVCD/ENTRY." 8488 "SVD\"</b>.</li></ul>" 7888 msgid "<ul><li>Rename <b>\"/MPEG2\"</b> folder on SVCDs to (non-compliant) \"/MPEGAV\".</li><li>Enables the use of the (deprecated) signature <b>\"ENTRYSVD\"</b> instead of <b>\"ENTRYVCD\"</b> for the file <b>\"/SVCD/ENTRY.SVD\"</b>.</li></ul>" 8489 7889 msgstr "" 8490 7890 8491 7891 #. +> trunk stable 8492 7892 #: projects/k3bvcdburndialog.cpp:188 8493 msgid "" 8494 "<ul><li>Enables the use of the (deprecated) Chinese <b>\"/SVCD/TRACKS.SVD\"<" 8495 "/b> format which differs from the format defined in the <b>IEC-62107</b> " 8496 "specification.</li></ul><p><b>The differences are most exposed on SVCDs " 8497 "containing more than one video track.</b>" 7893 msgid "<ul><li>Enables the use of the (deprecated) Chinese <b>\"/SVCD/TRACKS.SVD\"</b> format which differs from the format defined in the <b>IEC-62107</b> specification.</li></ul><p><b>The differences are most exposed on SVCDs containing more than one video track.</b>" 8498 7894 msgstr "" 8499 7895 8500 7896 #. +> trunk stable 8501 7897 #: projects/k3bvcdburndialog.cpp:191 8502 msgid "" 8503 "<p>though most devices will have problems with such an out-of-specification " 8504 "media.<p><b>You may want use this option for images longer than 80 minutes</b>" 7898 msgid "<p>though most devices will have problems with such an out-of-specification media.<p><b>You may want use this option for images longer than 80 minutes</b>" 8505 7899 msgstr "" 8506 7900 8507 7901 #. +> trunk stable 8508 7902 #: projects/k3bvcdburndialog.cpp:194 8509 msgid "" 8510 "<p>To allow the play of Video-CDs on a CD-i player, the Video-CD standard " 8511 "requires that a CD-i application program must be present.<p>This program is " 8512 "designed to:<ul><li>provide full play back control as defined in the PSD of " 8513 "the standard</li><li>be extremely simple to use and easy-to-learn for the " 8514 "end-user</li></ul><p>The program runs on CD-i players equipped with the " 8515 "CDRTOS 1.1(.1) operating system and a Digital Video extension cartridge." 7903 msgid "<p>To allow the play of Video-CDs on a CD-i player, the Video-CD standard requires that a CD-i application program must be present.<p>This program is designed to:<ul><li>provide full play back control as defined in the PSD of the standard</li><li>be extremely simple to use and easy-to-learn for the end-user</li></ul><p>The program runs on CD-i players equipped with the CDRTOS 1.1(.1) operating system and a Digital Video extension cartridge." 8516 7904 msgstr "" 8517 7905 8518 7906 #. +> trunk 8519 7907 #: projects/k3bvcdburndialog.cpp:200 8520 msgid "" 8521 "<p>Configuration parameters only available for Video CD 2.0<p>The engine " 8522 "works perfectly well when used as-is.<p>You have the option to configure the " 8523 "VCD application.<p>You can adapt the color and/or the shape of the cursor and " 8524 "lots more." 7908 msgid "<p>Configuration parameters only available for Video CD 2.0<p>The engine works perfectly well when used as-is.<p>You have the option to configure the VCD application.<p>You can adapt the color and/or the shape of the cursor and lots more." 8525 7909 msgstr "" 8526 7910 8527 7911 #. +> stable 8528 7912 #: projects/k3bvcdburndialog.cpp:200 8529 msgid "" 8530 "<p>Configuration parameters only available for VideoCD 2.0<p>The engine works " 8531 "perfectly well when used as-is.<p>You have the option to configure the VCD " 8532 "application.<p>You can adapt the color and/or the shape of the cursor and " 8533 "lots more." 7913 msgid "<p>Configuration parameters only available for VideoCD 2.0<p>The engine works perfectly well when used as-is.<p>You have the option to configure the VCD application.<p>You can adapt the color and/or the shape of the cursor and lots more." 8534 7914 msgstr "" 8535 7915 8536 7916 #. +> trunk stable 8537 7917 #: projects/k3bvcdburndialog.cpp:206 projects/k3bvcdtrackdialog.cpp:269 8538 msgid "" 8539 "<p>Playback control, PBC, is available for Video CD 2.0 and Super Video CD 1." 8540 "0 disc formats.<p>PBC allows control of the playback of play items and the " 8541 "possibility of interaction with the user through the remote control or some " 8542 "other input device available." 7918 msgid "<p>Playback control, PBC, is available for Video CD 2.0 and Super Video CD 1.0 disc formats.<p>PBC allows control of the playback of play items and the possibility of interaction with the user through the remote control or some other input device available." 8543 7919 msgstr "" 8544 7920 8545 7921 #. +> trunk stable 8546 7922 #: projects/k3bvcdburndialog.cpp:209 8547 msgid "" 8548 "<p>Here you can specify that the folder <b>SEGMENT</b> should always be " 8549 "present.<p>Some DVD players need the folder to give a faultless rendition." 7923 msgid "<p>Here you can specify that the folder <b>SEGMENT</b> should always be present.<p>Some DVD players need the folder to give a faultless rendition." 8550 7924 msgstr "" 8551 7925 8552 7926 #. +> trunk stable 8553 7927 #: projects/k3bvcdburndialog.cpp:212 8554 msgid "" 8555 "<p>An Access Point Sector, APS, is an MPEG video sector on the VCD/SVCD which " 8556 "is suitable to be jumped to directly.<p>APS are required for entry points and " 8557 "scantables. APS have to fulfil the requirement to precede every I-frame by a " 8558 "GOP header which shall be preceded by a sequence header in its turn.<p>The " 8559 "start codes of these 3 items are required to be contained all in the same " 8560 "MPEG pack/sector, thus forming a so-called access point sector.<p>This " 8561 "requirement can be relaxed by enabling the relaxed aps option, i.e. every " 8562 "sector containing an I-frame will be regarded as an APS.<p><b>Warning:</b> " 8563 "The sequence header is needed for a playing device to figure out display " 8564 "parameters, such as display resolution and frame rate, relaxing the aps " 8565 "requirement may lead to non-working entry points." 7928 msgid "<p>An Access Point Sector, APS, is an MPEG video sector on the VCD/SVCD which is suitable to be jumped to directly.<p>APS are required for entry points and scantables. APS have to fulfil the requirement to precede every I-frame by a GOP header which shall be preceded by a sequence header in its turn.<p>The start codes of these 3 items are required to be contained all in the same MPEG pack/sector, thus forming a so-called access point sector.<p>This requirement can be relaxed by enabling the relaxed aps option, i.e. every sector containing an I-frame will be regarded as an APS.<p><b>Warning:</b> The sequence header is needed for a playing device to figure out display parameters, such as display resolution and frame rate, relaxing the aps requirement may lead to non-working entry points." 8566 7929 msgstr "" 8567 7930 8568 7931 #. +> trunk stable 8569 7932 #: projects/k3bvcdburndialog.cpp:218 8570 msgid "" 8571 "<p>According to the specification, it is mandatory for Super Video CDs to " 8572 "encode scan information data into user data blocks in the picture layer of " 8573 "all intra coded picture.<p>It can be used by playing devices for implementing " 8574 "fast forward & fast reverse scanning.<p>The already existing scan information " 8575 "data can be updated by enabling the update scan offsets option." 7933 msgid "<p>According to the specification, it is mandatory for Super Video CDs to encode scan information data into user data blocks in the picture layer of all intra coded picture.<p>It can be used by playing devices for implementing fast forward & fast reverse scanning.<p>The already existing scan information data can be updated by enabling the update scan offsets option." 8576 7934 msgstr "" 8577 7935 8578 7936 #. +> trunk stable 8579 7937 #: projects/k3bvcdburndialog.cpp:222 8580 msgid "" 8581 "<p>Viewing Restriction may be interpreted by the playing device.<p>The " 8582 "allowed range goes from 0 to 3.<ul><li>0 = unrestricted, free to view for " 8583 "all</li><li>3 = restricted, content not suitable for ages under 18</li></ul><" 8584 "p>Actually, the exact meaning is not defined and is player dependant.<p><b>" 8585 "Most players ignore that value.<b>" 7938 msgid "<p>Viewing Restriction may be interpreted by the playing device.<p>The allowed range goes from 0 to 3.<ul><li>0 = unrestricted, free to view for all</li><li>3 = restricted, content not suitable for ages under 18</li></ul><p>Actually, the exact meaning is not defined and is player dependant.<p><b>Most players ignore that value.<b>" 8586 7939 msgstr "" 8587 7940 … … 8593 7946 #. +> trunk stable 8594 7947 #: projects/k3bvcdburndialog.cpp:230 8595 msgid "" 8596 "<p>This option allows to set the number of empty sectors added before the " 8597 "lead-out area begins, i.e. the number of post-gap sectors.<p>The ECMA-130 " 8598 "specification requires the last data track before the lead-out to carry a " 8599 "post-gap of at least 150 sectors, which is used as default for this parameter." 8600 "<p>Some operating systems may encounter I/O errors due to read-ahead issues " 8601 "when reading the last MPEG track if this parameter is set too low.<p>Allowed " 8602 "value content: [0..300]. Default: 150." 7948 msgid "<p>This option allows to set the number of empty sectors added before the lead-out area begins, i.e. the number of post-gap sectors.<p>The ECMA-130 specification requires the last data track before the lead-out to carry a post-gap of at least 150 sectors, which is used as default for this parameter.<p>Some operating systems may encounter I/O errors due to read-ahead issues when reading the last MPEG track if this parameter is set too low.<p>Allowed value content: [0..300]. Default: 150." 8603 7949 msgstr "" 8604 7950 8605 7951 #. +> trunk stable 8606 7952 #: projects/k3bvcdburndialog.cpp:235 8607 msgid "" 8608 "<p>Used to set the track pre-gap for all tracks in sectors globally.<p>The " 8609 "specification requires the pre-gaps to be at least 150 sectors long.<p>" 8610 "Allowed value content: [0..300]. Default: 150." 7953 msgid "<p>Used to set the track pre-gap for all tracks in sectors globally.<p>The specification requires the pre-gaps to be at least 150 sectors long.<p>Allowed value content: [0..300]. Default: 150." 8611 7954 msgstr "" 8612 7955 8613 7956 #. +> trunk stable 8614 7957 #: projects/k3bvcdburndialog.cpp:239 8615 msgid "" 8616 "Margins are used to compensate for inaccurate sector-addressing issues on " 8617 "CD-ROM media. Interestingly, they have been abandoned for Super Video CDs.<p>" 8618 "For Video CD 1.0/1.1/2.0 this margin should be at least 15 sectors long.<p>" 8619 "Allowed value content: [0..150]. Default: 30 for Video CD 1.0/1.1/2.0, " 8620 "otherwise (i.e. Super Video CD 1.0 and HQ-VCD 1.0) 0." 7958 msgid "Margins are used to compensate for inaccurate sector-addressing issues on CD-ROM media. Interestingly, they have been abandoned for Super Video CDs.<p>For Video CD 1.0/1.1/2.0 this margin should be at least 15 sectors long.<p>Allowed value content: [0..150]. Default: 30 for Video CD 1.0/1.1/2.0, otherwise (i.e. Super Video CD 1.0 and HQ-VCD 1.0) 0." 8621 7959 msgstr "" 8622 7960 8623 7961 #. +> trunk stable 8624 7962 #: projects/k3bvcdburndialog.cpp:243 8625 msgid "" 8626 "<p>Margins are used to compensate for inaccurate sector-addressing issues on " 8627 "CD-ROM media. Interestingly, they have been abandoned for Super Video CDs.<p>" 8628 "For Video CD 1.0/1.1/2.0 this margin should be at least 15 sectors long.<p>" 8629 "Allowed value content: [0..150]. Default: 45 for Video CD 1.0/1.1/2.0, " 8630 "otherwise 0." 7963 msgid "<p>Margins are used to compensate for inaccurate sector-addressing issues on CD-ROM media. Interestingly, they have been abandoned for Super Video CDs.<p>For Video CD 1.0/1.1/2.0 this margin should be at least 15 sectors long.<p>Allowed value content: [0..150]. Default: 45 for Video CD 1.0/1.1/2.0, otherwise 0." 8631 7964 msgstr "" 8632 7965 … … 9020 8353 #. +> trunk stable 9021 8354 #: projects/k3bvcdtrackdialog.cpp:265 9022 msgid "" 9023 "<p>Target to be jumped to on time-out of <wait>.<p>If omitted (and <wait> is " 9024 "not set to an infinite time) one of the targets is selected at random." 8355 msgid "<p>Target to be jumped to on time-out of <wait>.<p>If omitted (and <wait> is not set to an infinite time) one of the targets is selected at random." 9025 8356 msgstr "" 9026 8357 9027 8358 #. +> trunk stable 9028 8359 #: projects/k3bvcdtrackdialog.cpp:267 9029 msgid "" 9030 "<p>When reactivity is set to delayed, it is recommended that the length of " 9031 "the referenced 'play track' is not more than 5 seconds.<p>The recommended " 9032 "setting for a play item consisting of one still picture and no audio is to " 9033 "loop once and have a delayed reactivity." 8360 msgid "<p>When reactivity is set to delayed, it is recommended that the length of the referenced 'play track' is not more than 5 seconds.<p>The recommended setting for a play item consisting of one still picture and no audio is to loop once and have a delayed reactivity." 9034 8361 msgstr "" 9035 8362 9036 8363 #. +> trunk stable 9037 8364 #: projects/k3bvcdtrackdialog.cpp:271 9038 msgid "" 9039 "These are actually pseudo keys, representing the numeric keys 0, 1, ..., 9." 8365 msgid "These are actually pseudo keys, representing the numeric keys 0, 1, ..., 9." 9040 8366 msgstr "" 9041 8367 … … 9047 8373 #. +> trunk stable 9048 8374 #: projects/k3bvcdtrackdialog.cpp:273 9049 msgid "" 9050 "<p>Times to repeat the playback of 'play track'.<p>The reactivity attribute " 9051 "controls whether the playback of 'play track' is finished, thus delayed, " 9052 "before executing user triggered action or an immediate jump is performed.<p>" 9053 "After the specified number of repetitions have completed, the <wait> time " 9054 "begins to count down, unless set to an infinite wait time.<p>If this element " 9055 "is omitted, a default of `1' is used, i.e. the 'play track' will be displayed " 9056 "once." 8375 msgid "<p>Times to repeat the playback of 'play track'.<p>The reactivity attribute controls whether the playback of 'play track' is finished, thus delayed, before executing user triggered action or an immediate jump is performed.<p>After the specified number of repetitions have completed, the <wait> time begins to count down, unless set to an infinite wait time.<p>If this element is omitted, a default of `1' is used, i.e. the 'play track' will be displayed once." 9057 8376 msgstr "" 9058 8377 9059 8378 #. +> trunk stable 9060 8379 #: projects/k3bvcdtrackdialog.cpp:277 9061 msgid "" 9062 "Time in seconds to wait after playback of 'play track' before triggering the " 9063 "<timeout> action (unless the user triggers some action before time ran up)." 8380 msgid "Time in seconds to wait after playback of 'play track' before triggering the <timeout> action (unless the user triggers some action before time ran up)." 9064 8381 msgstr "" 9065 8382 … … 9267 8584 #. +> trunk 9268 8585 #: projects/k3bvcdview.cpp:101 9269 msgid "" 9270 "Could not find VcdImager executable. To create Video CDs you have to install " 9271 "VcdImager >= 0.7.12. You can find this on your distributionâs software " 9272 "repository or download it from http://www.vcdimager.org" 8586 msgid "Could not find VcdImager executable. To create Video CDs you have to install VcdImager >= 0.7.12. You can find this on your distributionâs software repository or download it from http://www.vcdimager.org" 9273 8587 msgstr "" 9274 8588 9275 8589 #. +> stable 9276 8590 #: projects/k3bvcdview.cpp:85 9277 msgid "" 9278 "Could not find VcdImager executable. To create VideoCD's you must install " 9279 "VcdImager >= 0.7.12. You can find this on your distribution disks or download " 9280 "it from http://www.vcdimager.org" 8591 msgid "Could not find VcdImager executable. To create VideoCD's you must install VcdImager >= 0.7.12. You can find this on your distribution disks or download it from http://www.vcdimager.org" 9281 8592 msgstr "" 9282 8593 … … 9288 8599 #. +> trunk stable 9289 8600 #: projects/k3bvideodvdview.cpp:58 9290 msgid "" 9291 "Be aware that you need to provide the complete Video DVD filestructure. K3b " 9292 "does not support video transcoding and preparation of video object files yet. " 9293 "That means you need to already have the VTS_X_YY.VOB and VTS_X_YY.IFO files." 8601 msgid "Be aware that you need to provide the complete Video DVD filestructure. K3b does not support video transcoding and preparation of video object files yet. That means you need to already have the VTS_X_YY.VOB and VTS_X_YY.IFO files." 9294 8602 msgstr "" 9295 8603 … … 9381 8689 #: rip/base_k3baudiorippingoptionwidget.ui:95 9382 8690 msgid "" 9383 "<p>If this option is checked, the entries in the playlist will be relative to " 9384 "its location.\n" 8691 "<p>If this option is checked, the entries in the playlist will be relative to its location.\n" 9385 8692 "<p>Example: If your playlist is located in <em>/home/myself/music</em> and\n" 9386 "your audio files are in <em>/home/myself/music/cool</em>; then the entries in " 9387 "the\n" 8693 "your audio files are in <em>/home/myself/music/cool</em>; then the entries in the\n" 9388 8694 "playlist will look something like: <em>cool/track1.ogg</em>." 9389 8695 msgstr "" … … 9427 8733 #. +> trunk stable 9428 8734 #: rip/base_k3baudiorippingoptionwidget.ui:148 9429 msgid "" 9430 "<p>If this option is checked K3b will create a CDRWIN cue file which allows " 9431 "to easily write a copy of the audio CD on other systems." 8735 msgid "<p>If this option is checked K3b will create a CDRWIN cue file which allows to easily write a copy of the audio CD on other systems." 9432 8736 msgstr "" 9433 8737 … … 9584 8888 #: rip/k3baudiocdview.cpp:186 9585 8889 #, kde-format 9586 msgid "" 9587 "Found Cd-Text (%1 - %2). Do you want to use it instead of CDDB (%3 - %4)?" 8890 msgid "Found Cd-Text (%1 - %2). Do you want to use it instead of CDDB (%3 - %4)?" 9588 8891 msgstr "" 9589 8892 … … 9977 9280 #. +> trunk stable 9978 9281 #: rip/k3baudiorippingdialog.cpp:210 9979 msgid "" 9980 "<p>This specifies the maximum number of retries to read a sector of audio " 9981 "data from the cd. After that K3b will either skip the sector if the <em>" 9982 "Ignore Read Errors</em> option is enabled or stop the process." 9282 msgid "<p>This specifies the maximum number of retries to read a sector of audio data from the cd. After that K3b will either skip the sector if the <em>Ignore Read Errors</em> option is enabled or stop the process." 9983 9283 msgstr "" 9984 9284 … … 9990 9290 #. +> trunk stable 9991 9291 #: rip/k3baudiorippingdialog.cpp:215 9992 msgid "" 9993 "<p>If this option is checked K3b will not rip the audio data in the pregaps. " 9994 "Most audio tracks contain an empty pregap which does not belong to the track " 9995 "itself.</p><p>Although the default behavior of nearly all ripping software is " 9996 "to include the pregaps for most CDs, it makes more sense to ignore them. In " 9997 "any case, when creating a K3b audio project, the pregaps will be regenerated." 9998 "</p>" 9292 msgid "<p>If this option is checked K3b will not rip the audio data in the pregaps. Most audio tracks contain an empty pregap which does not belong to the track itself.</p><p>Although the default behavior of nearly all ripping software is to include the pregaps for most CDs, it makes more sense to ignore them. In any case, when creating a K3b audio project, the pregaps will be regenerated.</p>" 9999 9293 msgstr "" 10000 9294 … … 10042 9336 #. +> trunk stable 10043 9337 #: rip/k3bcddbpatternwidget.cpp:53 10044 msgctxt "" 10045 "Please do NOT modify/translate the quotes, they are part of the pattern!" 9338 msgctxt "Please do NOT modify/translate the quotes, they are part of the pattern!" 10046 9339 msgid "%A - %T/%n - !a='%A'{%a - }%t" 10047 9340 msgstr "" … … 10074 9367 #. +> trunk stable 10075 9368 #: rip/k3bcddbpatternwidget.cpp:127 10076 msgid "" 10077 "<p><b>Pattern special strings:</b><p>The following strings will be replaced " 10078 "with their respective meaning in every track name.<br><em>Hint:</em> %A " 10079 "differs from %a only on soundtracks or compilations.<p><table border=\"0\"><" 10080 "tr><td></td><td><em>Meaning</em></td><td><em>Alternatives</em></td></tr><tr><" 10081 "td>%a</td><td>artist of the track</td><td>%{a} or %{artist}</td></tr><tr><td>%" 10082 "t</td><td>title of the track</td><td>%{t} or %{title}</td></tr><tr><td>%n</td>" 10083 "<td>track number</td><td>%{n} or %{number}</td></tr><tr><td>%y</td><td>year " 10084 "of the CD</td><td>%{y} or %{year}</td></tr><tr><td>%c</td><td>extended track " 10085 "information</td><td>%{c} or %{comment}</td></tr><tr><td>%g</td><td>genre of " 10086 "the CD</td><td>%{g} or %{genre}</td></tr><tr><td>%A</td><td>album artist</td>" 10087 "<td>%{A} or %{albumartist}</td></tr><tr><td>%T</td><td>album title</td><td>%" 10088 "{T} or %{albumtitle}</td></tr><tr><td>%C</td><td>extended CD information</td>" 10089 "<td>%{C} or %{albumcomment}</td></tr><tr><td>%d</td><td>current date</td><td>%" 10090 "{d} or %{date}</td></tr><tr><td>%e</td><td>file extension (if left out, it is " 10091 "added automatically)</td><td>%{e} or %{ext}</td></tr></table>" 9369 msgid "<p><b>Pattern special strings:</b><p>The following strings will be replaced with their respective meaning in every track name.<br><em>Hint:</em> %A differs from %a only on soundtracks or compilations.<p><table border=\"0\"><tr><td></td><td><em>Meaning</em></td><td><em>Alternatives</em></td></tr><tr><td>%a</td><td>artist of the track</td><td>%{a} or %{artist}</td></tr><tr><td>%t</td><td>title of the track</td><td>%{t} or %{title}</td></tr><tr><td>%n</td><td>track number</td><td>%{n} or %{number}</td></tr><tr><td>%y</td><td>year of the CD</td><td>%{y} or %{year}</td></tr><tr><td>%c</td><td>extended track information</td><td>%{c} or %{comment}</td></tr><tr><td>%g</td><td>genre of the CD</td><td>%{g} or %{genre}</td></tr><tr><td>%A</td><td>album artist</td><td>%{A} or %{albumartist}</td></tr><tr><td>%T</td><td>album title</td><td>%{T} or %{albumtitle}</td></tr><tr><td>%C</td><td>extended CD information</td><td>%{C} or %{albumcomment}</td></tr><tr><td>%d</td><td>current date</td><td>%{d} or %{date}</td></tr><tr><td>%e</td><td>file extension (if left out, it is added automatically)</td><td>%{e} or %{ext}</td></tr></table>" 10092 9370 msgstr "" 10093 9371 … … 10095 9373 #: rip/k3bcddbpatternwidget.cpp:153 10096 9374 #, c-format 10097 msgctxt "" 10098 "Please do NOT modify/translate the quotes, they are part of the pattern!" 10099 msgid "" 10100 "<p><b>Conditional inclusion:</b><p>These patterns make it possible to " 10101 "selectively include texts, depending on the value of CDDB entries. You can " 10102 "choose only to include or exclude texts if one of the entries is empty, or if " 10103 "it has a specific value. Examples:<ul><li>@T{TEXT} includes TEXT if the album " 10104 "title is specified<li>!T{TEXT} includes TEXT if the album title is not " 10105 "specified<li>@C='Soundtrack'{TEXT} includes TEXT if the CD's extended " 10106 "information is named Soundtrack<li>!C='Soundtrack'{TEXT} includes TEXT if the " 10107 "CD's extended information is anything else but Soundtrack<li>It is also " 10108 "possible to include special strings in texts and conditions, e.g. !a='%A'{%a} " 10109 "only includes the title's artist information if it does not differ from the " 10110 "album artist.</ul><p>Conditional includes make use of the same characters as " 10111 "the special strings, which means that the X in @X{...} can be one character " 10112 "out of [atnycgATCd]." 9375 msgctxt "Please do NOT modify/translate the quotes, they are part of the pattern!" 9376 msgid "<p><b>Conditional inclusion:</b><p>These patterns make it possible to selectively include texts, depending on the value of CDDB entries. You can choose only to include or exclude texts if one of the entries is empty, or if it has a specific value. Examples:<ul><li>@T{TEXT} includes TEXT if the album title is specified<li>!T{TEXT} includes TEXT if the album title is not specified<li>@C='Soundtrack'{TEXT} includes TEXT if the CD's extended information is named Soundtrack<li>!C='Soundtrack'{TEXT} includes TEXT if the CD's extended information is anything else but Soundtrack<li>It is also possible to include special strings in texts and conditions, e.g. !a='%A'{%a} only includes the title's artist information if it does not differ from the album artist.</ul><p>Conditional includes make use of the same characters as the special strings, which means that the X in @X{...} can be one character out of [atnycgATCd]." 10113 9377 msgstr "" 10114 9378 … … 10198 9462 #. +> trunk 10199 9463 #: rip/k3bvideocdrip.cpp:103 10200 msgid "" 10201 "You can find this on your distributionâs software repository or download it " 10202 "from http://www.vcdimager.org" 9464 msgid "You can find this on your distributionâs software repository or download it from http://www.vcdimager.org" 10203 9465 msgstr "" 10204 9466 … … 10211 9473 #. +> trunk stable 10212 9474 #: rip/k3bvideocdrip.cpp:112 10213 msgid "" 10214 "You can find this on your distribution disks or download it from http://www." 10215 "vcdimager.org" 9475 msgid "You can find this on your distribution disks or download it from http://www.vcdimager.org" 10216 9476 msgstr "" 10217 9477 … … 10364 9624 #. +> trunk stable 10365 9625 #: rip/k3bvideocdrippingdialog.cpp:134 10366 msgid "" 10367 "<p>Ignore extended PSD (located in the ISO-9660 filesystem under `/EXT/PSD_X." 10368 "VCD') and use the <em>standard</em> PSD.</p>" 9626 msgid "<p>Ignore extended PSD (located in the ISO-9660 filesystem under `/EXT/PSD_X.VCD') and use the <em>standard</em> PSD.</p>" 10369 9627 msgstr "" 10370 9628 … … 10376 9634 #. +> trunk stable 10377 9635 #: rip/k3bvideocdrippingdialog.cpp:137 10378 msgid "" 10379 "<p>This option only makes sense if you are reading from a BIN CD disk image. " 10380 "This indicates to `vcdxrip' to assume a 2336-byte sector mode for image file." 10381 "</p><b>Note: This option is slated to disappear.</b>" 9636 msgid "<p>This option only makes sense if you are reading from a BIN CD disk image. This indicates to `vcdxrip' to assume a 2336-byte sector mode for image file.</p><b>Note: This option is slated to disappear.</b>" 10382 9637 msgstr "" 10383 9638 … … 10389 9644 #. +> trunk stable 10390 9645 #: rip/k3bvideocdrippingdialog.cpp:141 10391 msgid "" 10392 "<p>This option creates an XML description file with all video CD information." 10393 "</p><p>This file will always contain all of the information.</p><p>Example: " 10394 "If you only extract sequences, the description file will also hold the " 10395 "information for files and segments.</p><p>The filename is the same as the " 10396 "video CD name, with a .xml extension. The default is VIDEOCD.xml.</p>" 9646 msgid "<p>This option creates an XML description file with all video CD information.</p><p>This file will always contain all of the information.</p><p>Example: If you only extract sequences, the description file will also hold the information for files and segments.</p><p>The filename is the same as the video CD name, with a .xml extension. The default is VIDEOCD.xml.</p>" 10397 9647 msgstr "" 10398 9648 … … 10475 9725 #. +> trunk stable 10476 9726 #: rip/videodvd/base_k3bvideodvdrippingwidget.ui:21 10477 msgid "" 10478 "Please select the audio streams you want to include in every ripped title" 9727 msgid "Please select the audio streams you want to include in every ripped title" 10479 9728 msgstr "" 10480 9729 … … 10526 9775 #. +> trunk 10527 9776 #: rip/videodvd/base_k3bvideodvdrippingwidget.ui:239 10528 msgid "" 10529 "<p>No Audio Quality settings available for <em>AC3 pass-through</em>. The " 10530 "audio stream from the Video DVD is used without any changes.</p>" 9777 msgid "<p>No Audio Quality settings available for <em>AC3 pass-through</em>. The audio stream from the Video DVD is used without any changes.</p>" 10531 9778 msgstr "" 10532 9779 … … 10534 9781 #. +> stable 10535 9782 #: rip/videodvd/base_k3bvideodvdrippingwidget.ui:257 10536 msgid "" 10537 "<p>No Audio Quality settings available for <em>AC3 pass-through</em>. The " 10538 "audio stream from the Video DVD is used without any changes." 9783 msgid "<p>No Audio Quality settings available for <em>AC3 pass-through</em>. The audio stream from the Video DVD is used without any changes." 10539 9784 msgstr "" 10540 9785 … … 10585 9830 #: rip/videodvd/base_k3bvideodvdrippingwidget.ui:468 10586 9831 msgid "" 10587 "<p>If this option is checked K3b encodes the video titles in two passes. The " 10588 "first pass is used to gather information about the video in order to improve " 10589 "the distribution of bits in the second pass. The resulting video will have a " 10590 "higher quality using a variable bitrate.\n" 10591 "<p>If this option is not checked K3b will create video files with a constant " 10592 "bitrate and a lower quality.\n" 9832 "<p>If this option is checked K3b encodes the video titles in two passes. The first pass is used to gather information about the video in order to improve the distribution of bits in the second pass. The resulting video will have a higher quality using a variable bitrate.\n" 9833 "<p>If this option is not checked K3b will create video files with a constant bitrate and a lower quality.\n" 10593 9834 "<p>2-pass encoding results in a doubled encoding time." 10594 9835 msgstr "" … … 10617 9858 #: rip/videodvd/base_k3bvideodvdrippingwidget.ui:489 10618 9859 msgid "" 10619 "<p>Most Video DVDs are encoded in a letterboxed format. <em>Letterboxed</em> " 10620 "refers to black bars used at the top and bottom (and sometimes at the sides) " 10621 "of the video to force it into one of the aspect ratios supported by the Video " 10622 "DVD standard.\n" 10623 "<p>If this option is checked K3b will automatically detect and remove these " 10624 "black bars from the resulting video.\n" 10625 "<p>Although this method is very reliable there may be problems if the source " 10626 "material is exceptionally short or dark." 9860 "<p>Most Video DVDs are encoded in a letterboxed format. <em>Letterboxed</em> refers to black bars used at the top and bottom (and sometimes at the sides) of the video to force it into one of the aspect ratios supported by the Video DVD standard.\n" 9861 "<p>If this option is checked K3b will automatically detect and remove these black bars from the resulting video.\n" 9862 "<p>Although this method is very reliable there may be problems if the source material is exceptionally short or dark." 10627 9863 msgstr "" 10628 9864 … … 10643 9879 #: rip/videodvd/base_k3bvideodvdrippingwidget.ui:506 10644 9880 msgid "" 10645 "<p>Video DVD audio streams normally are encoded with a sampling rate of 48000 " 10646 "Hz. Audio CDs on the other hand are encoded with a sampling rate of 44100 Hz." 10647 "\n" 10648 "<p>If this option is checked K3b will change the sampling rate of the audio " 10649 "stream to 44100 Hz." 9881 "<p>Video DVD audio streams normally are encoded with a sampling rate of 48000 Hz. Audio CDs on the other hand are encoded with a sampling rate of 44100 Hz.\n" 9882 "<p>If this option is checked K3b will change the sampling rate of the audio stream to 44100 Hz." 10650 9883 msgstr "" 10651 9884 … … 10743 9976 #. +> trunk stable 10744 9977 #: rip/videodvd/k3bvideodvdrippingdialog.cpp:498 10745 msgid "" 10746 "<p>When using the <em>AC3 pass-through</em> audio codec all selected audio " 10747 "streams need to be in AC3 format. Please select another audio codec or choose " 10748 "AC3 audio streams for all ripped titles." 9978 msgid "<p>When using the <em>AC3 pass-through</em> audio codec all selected audio streams need to be in AC3 format. Please select another audio codec or choose AC3 audio streams for all ripped titles." 10749 9979 msgstr "" 10750 9980 … … 10817 10047 #. +> trunk stable 10818 10048 #: rip/videodvd/k3bvideodvdrippingview.cpp:88 10819 msgid "" 10820 "Shows plain Video DVD vob files from the DVD (including decryption) for " 10821 "further processing with another application" 10049 msgid "Shows plain Video DVD vob files from the DVD (including decryption) for further processing with another application" 10822 10050 msgstr "" 10823 10051 … … 10835 10063 #: rip/videodvd/k3bvideodvdrippingview.cpp:244 10836 10064 #, kde-format 10837 msgid "" 10838 "K3b was unable to unmount device '%1' containing medium '%2'. Video DVD " 10839 "ripping will not work if the device is mounted. Please unmount manually." 10065 msgid "K3b was unable to unmount device '%1' containing medium '%2'. Video DVD ripping will not work if the device is mounted. Please unmount manually." 10840 10066 msgstr "" 10841 10067 … … 10847 10073 #. +> trunk stable 10848 10074 #: rip/videodvd/k3bvideodvdrippingview.cpp:259 10849 msgid "" 10850 "<p>Unable to read Video DVD contents: Found encrypted Video DVD.<p>Install <i>" 10851 "libdvdcss</i> to get Video DVD decryption support." 10852 msgstr "" 10853 10854 #. +> trunk stable 10075 msgid "<p>Unable to read Video DVD contents: Found encrypted Video DVD.<p>Install <i>libdvdcss</i> to get Video DVD decryption support." 10076 msgstr "" 10077 10078 #. +> trunk 10855 10079 #: rip/videodvd/k3bvideodvdrippingview.cpp:270 10080 #, fuzzy, kde-format 10081 msgid "%1 (Video DVD)" 10082 msgstr "Video DVD" 10083 10084 #. +> stable 10085 #: rip/videodvd/k3bvideodvdrippingview.cpp:218 10856 10086 #, fuzzy 10857 10087 msgid "Video DVD" … … 10874 10104 #. +> trunk stable 10875 10105 #: rip/videodvd/k3bvideodvdrippingview.cpp:293 10876 msgid "" 10877 "<p>K3b uses transcode to rip Video DVDs. Your installation of transcode lacks " 10878 "support for any of the codecs supported by K3b.<p>Please make sure it is " 10879 "installed properly." 10106 msgid "<p>K3b uses transcode to rip Video DVDs. Your installation of transcode lacks support for any of the codecs supported by K3b.<p>Please make sure it is installed properly." 10880 10107 msgstr "" 10881 10108 … … 10892 10119 #. +> trunk stable 10893 10120 #: rip/videodvd/k3bvideodvdrippingview.cpp:350 10894 msgid "" 10895 "<p>Rips single titles from a video DVD into a compressed format such as XviD. " 10896 "Menu structures are completely ignored.<p>If you intend to copy the plain " 10897 "Video DVD vob files from the DVD (including decryption) for further " 10898 "processing with another application, please use \"Show files\" button.<p>If " 10899 "you intend to make a copy of the entire Video DVD including all menus and " 10900 "extras it is recommended to use the K3b Copy tool." 10121 msgid "<p>Rips single titles from a video DVD into a compressed format such as XviD. Menu structures are completely ignored.<p>If you intend to copy the plain Video DVD vob files from the DVD (including decryption) for further processing with another application, please use \"Show files\" button.<p>If you intend to make a copy of the entire Video DVD including all menus and extras it is recommended to use the K3b Copy tool." 10901 10122 msgstr "" 10902 10123 … … 10925 10146 #. +> trunk stable 10926 10147 #: rip/videodvd/k3bvideodvdrippingwidget.cpp:286 10927 msgid "" 10928 "<p><b>Pattern special strings:</b><p>The following strings will be replaced " 10929 "with their respective meaning in every track name.<br><p><table border=\"0\">" 10930 "<tr><td></td><td><em>Meaning</em></td><td><em>Alternatives</em></td></tr><tr>" 10931 "<td>%t</td><td>title number</td><td>%{t} or %{title_number}</td></tr><tr><td>%" 10932 "i</td><td>volume id (mostly the name of the Video DVD)</td><td>%{i} or %" 10933 "{volume_id}</td></tr><tr><td>%b</td><td>beautified volume id</td><td>%{b} or %" 10934 "{beautified_volume_id}</td></tr><tr><td>%l</td><td>two chars language code<" 10935 "/td><td>%{l} or %{lang_code}</td></tr><tr><td>%n</td><td>language name</td><" 10936 "td>%{n} or %{lang_name}</td></tr><tr><td>%a</td><td>audio format (on the " 10937 "Video DVD)</td><td>%{a} or %{audio_format}</td></tr><tr><td>%c</td><td>number " 10938 "of audio channels (on the Video DVD)</td><td>%{c} or %{channels}</td></tr><tr>" 10939 "<td>%v</td><td>size of the original video</td><td>%{v} or %{orig_video_size}<" 10940 "/td></tr><tr><td>%s</td><td>size of the resulting video (<em>Caution: " 10941 "auto-clipping values are not taken into account.</em>)</td><td>%{s} or %" 10942 "{video_size}</td></tr><tr><td>%r</td><td>aspect ratio of the original video<" 10943 "/td><td>%{r} or %{aspect_ratio}</td></tr><tr><td>%d</td><td>current date</td>" 10944 "<td>%{d} or %{date}</td></tr></table><p><em>Hint: K3b also accepts slight " 10945 "variations of the long special strings. One can, for example, leave out the " 10946 "underscores.</em>" 10148 msgid "<p><b>Pattern special strings:</b><p>The following strings will be replaced with their respective meaning in every track name.<br><p><table border=\"0\"><tr><td></td><td><em>Meaning</em></td><td><em>Alternatives</em></td></tr><tr><td>%t</td><td>title number</td><td>%{t} or %{title_number}</td></tr><tr><td>%i</td><td>volume id (mostly the name of the Video DVD)</td><td>%{i} or %{volume_id}</td></tr><tr><td>%b</td><td>beautified volume id</td><td>%{b} or %{beautified_volume_id}</td></tr><tr><td>%l</td><td>two chars language code</td><td>%{l} or %{lang_code}</td></tr><tr><td>%n</td><td>language name</td><td>%{n} or %{lang_name}</td></tr><tr><td>%a</td><td>audio format (on the Video DVD)</td><td>%{a} or %{audio_format}</td></tr><tr><td>%c</td><td>number of audio channels (on the Video DVD)</td><td>%{c} or %{channels}</td></tr><tr><td>%v</td><td>size of the original video</td><td>%{v} or %{orig_video_size}</td></tr><tr><td>%s</td><td>size of the resulting video (<em>Caution: auto-clipping values are not taken into account.</em>)</td><td>%{s} or %{video_size}</td></tr><tr><td>%r</td><td>aspect ratio of the original video</td><td>%{r} or %{aspect_ratio}</td></tr><tr><td>%d</td><td>current date</td><td>%{d} or %{date}</td></tr></table><p><em>Hint: K3b also accepts slight variations of the long special strings. One can, for example, leave out the underscores.</em>" 10947 10149 msgstr "" 10948 10150 … … 10954 10156 #. +> trunk stable 10955 10157 #: rip/videodvd/k3bvideodvdrippingwidget.cpp:343 10956 msgid "" 10957 "<p>Please choose the width and height of the resulting video. If one value is " 10958 "set to <em>Auto</em> K3b will choose this value depending on the aspect ratio " 10959 "of the video picture.<br>Be aware that setting both the width and the height " 10960 "to fixed values will result in no aspect ratio correction being performed." 10961 msgstr "" 10962 10963 #. +> trunk stable 10158 msgid "<p>Please choose the width and height of the resulting video. If one value is set to <em>Auto</em> K3b will choose this value depending on the aspect ratio of the video picture.<br>Be aware that setting both the width and the height to fixed values will result in no aspect ratio correction being performed." 10159 msgstr "" 10160 10161 #. +> trunk 10964 10162 #: rip/videodvd/k3bvideodvdrippingwidget.cpp:358 10163 #, fuzzy 10164 msgid "Width:" 10165 msgstr "Å irina:" 10166 10167 #. +> stable 10168 #: rip/videodvd/k3bvideodvdrippingwidget.cpp:365 10965 10169 #, fuzzy 10966 10170 msgid "Width" 10967 10171 msgstr "Å irina" 10968 10172 10969 #. +> trunk stable10173 #. +> trunk 10970 10174 #: rip/videodvd/k3bvideodvdrippingwidget.cpp:360 10175 #, fuzzy 10176 msgid "Height:" 10177 msgstr "Visina:" 10178 10179 #. +> stable 10180 #: rip/videodvd/k3bvideodvdrippingwidget.cpp:367 10971 10181 #, fuzzy 10972 10182 msgid "Height" … … 11107 10317 #. +> stable 11108 10318 #: projects/k3baudioview.cpp:136 11109 msgid "" 11110 "No audio decoder plugins found. You will not be able to add any files to the " 11111 "audio project." 10319 msgid "No audio decoder plugins found. You will not be able to add any files to the audio project." 11112 10320 msgstr "" 11113 10321 … … 11132 10340 #: tips:16 11133 10341 msgid "" 11134 "<p>...that K3b has two types of settings. On the one hand K3b has settings " 11135 "like most\n" 11136 "KDE applications have accessible through the configuration dialog via the " 11137 "settings menu;\n" 11138 "on the other hand every K3b action dialog has three buttons to load and save " 11139 "defaults\n" 11140 "for that action. This way one may, for example, set the defaults for CD " 11141 "Copy: these defaults\n" 11142 "will then be loaded every time the CD Copy dialog is opened. The button <em>" 11143 "K3b defaults</em>\n" 11144 "will restore the <em>factory settings</em> in case you do not know if the " 11145 "settings you chose\n" 10342 "<p>...that K3b has two types of settings. On the one hand K3b has settings like most\n" 10343 "KDE applications have accessible through the configuration dialog via the settings menu;\n" 10344 "on the other hand every K3b action dialog has three buttons to load and save defaults\n" 10345 "for that action. This way one may, for example, set the defaults for CD Copy: these defaults\n" 10346 "will then be loaded every time the CD Copy dialog is opened. The button <em>K3b defaults</em>\n" 10347 "will restore the <em>factory settings</em> in case you do not know if the settings you chose\n" 11146 10348 "are appropriate.</p>\n" 11147 10349 msgstr "" … … 11151 10353 #: tips:28 11152 10354 msgid "" 11153 "<p>...that you do not need to bother changing the settings marked as <em>" 11154 "advanced</em> if you \n" 11155 "do not know what they mean. K3b's defaults are suitable for most daily use.<" 11156 "/p>\n" 10355 "<p>...that you do not need to bother changing the settings marked as <em>advanced</em> if you \n" 10356 "do not know what they mean. K3b's defaults are suitable for most daily use.</p>\n" 11157 10357 msgstr "" 11158 10358 … … 11161 10361 #: tips:35 11162 10362 msgid "" 11163 "<p>Just left-click one of your devices in the device and file tree and see " 11164 "what happens. K3b opens a specific\n" 11165 "window based on the media's contents. For an audio CD for example you will be " 11166 "given a list of the tracks with\n" 11167 "the possibility to rip these tracks to any format supported by K3b (like mp3 " 11168 "or Ogg-Vorbis).</p>\n" 10363 "<p>Just left-click one of your devices in the device and file tree and see what happens. K3b opens a specific\n" 10364 "window based on the media's contents. For an audio CD for example you will be given a list of the tracks with\n" 10365 "the possibility to rip these tracks to any format supported by K3b (like mp3 or Ogg-Vorbis).</p>\n" 11169 10366 msgstr "" 11170 10367 … … 11173 10370 #: tips:43 11174 10371 msgid "" 11175 "<p>...that K3b lets you choose media instead of devices for burning. So if " 11176 "you want to burn to a certain\n" 11177 "medium simply insert it and wait for K3b to detect it. It will then appear as " 11178 "your burning medium.</p>\n" 11179 msgstr "" 10372 "<p>...that K3b lets you choose media instead of devices for burning. So if you want to burn to a certain\n" 10373 "medium simply insert it and wait for K3b to detect it. It will then appear as your burning medium.</p>\n" 10374 msgstr "" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/kaffeine.po ¶
r1014 r1036 6 6 "Project-Id-Version: \n" 7 7 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 8 "POT-Creation-Date: 2011-05- 09 09:11+0200\n"8 "POT-Creation-Date: 2011-05-25 09:37+0200\n" 9 9 "PO-Revision-Date: 2010-01-24 16:34+0100\n" 10 10 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n" … … 31 31 32 32 #. +> trunk 33 #: backend-mplayer/mplayermediawidget.cpp:220 34 #, fuzzy 35 msgid "Cannot start mplayer process." 36 msgstr "Nije moguÄe pokrenuti proces %1." 37 38 #. +> trunk 33 39 #: configurationdialog.cpp:37 34 40 #, fuzzy … … 1211 1217 1212 1218 #. +> trunk 1213 #: mediawidget.cpp:105 mediawidget.cpp:39 51219 #: mediawidget.cpp:105 mediawidget.cpp:393 1214 1220 #, fuzzy 1215 1221 msgctxt "'Playback' menu" … … 1218 1224 1219 1225 #. +> trunk 1220 #: mediawidget.cpp:111 mediawidget.cpp:39 91226 #: mediawidget.cpp:111 mediawidget.cpp:397 1221 1227 #, fuzzy 1222 1228 msgctxt "'Playback' menu" … … 1338 1344 1339 1345 #. +> trunk 1340 #: mediawidget.cpp:265 mediawidget.cpp:272 mediawidget.cpp:95 41341 #: mediawidget.cpp:9 621346 #: mediawidget.cpp:265 mediawidget.cpp:272 mediawidget.cpp:950 1347 #: mediawidget.cpp:958 1342 1348 #, kde-format, no-c-format 1343 1349 msgctxt "submenu of 'Skip'" … … 1346 1352 1347 1353 #. +> trunk 1348 #: mediawidget.cpp:279 mediawidget.cpp:286 mediawidget.cpp:95 61349 #: mediawidget.cpp:96 41354 #: mediawidget.cpp:279 mediawidget.cpp:286 mediawidget.cpp:952 1355 #: mediawidget.cpp:960 1350 1356 #, kde-format, no-c-format 1351 1357 msgctxt "submenu of 'Skip'" … … 1360 1366 #. +> trunk 1361 1367 #: mediawidget.cpp:304 1368 #, fuzzy 1362 1369 msgctxt "dvd navigation" 1363 msgid " ToggleMenu"1364 msgstr " "1370 msgid "DVD Menu" 1371 msgstr "KDE izbornik" 1365 1372 1366 1373 #. +> trunk … … 1388 1395 1389 1396 #. +> trunk 1390 #: mediawidget.cpp:37 81397 #: mediawidget.cpp:376 1391 1398 msgctxt "file filter" 1392 1399 msgid "Supported Media Files" … … 1394 1401 1395 1402 #. +> trunk 1396 #: mediawidget.cpp:37 91403 #: mediawidget.cpp:377 1397 1404 msgctxt "file filter" 1398 1405 msgid "All Files" … … 1400 1407 1401 1408 #. +> trunk 1402 #: mediawidget.cpp:4 111409 #: mediawidget.cpp:409 1403 1410 #, fuzzy 1404 1411 msgctxt "'Playback' menu" … … 1407 1414 1408 1415 #. +> trunk 1409 #: mediawidget.cpp:41 51416 #: mediawidget.cpp:413 1410 1417 #, fuzzy 1411 1418 msgctxt "'Playback' menu" … … 1414 1421 1415 1422 #. +> trunk 1416 #: mediawidget.cpp:67 31423 #: mediawidget.cpp:670 1417 1424 msgctxt "osd" 1418 1425 msgid "Stopped" … … 1420 1427 1421 1428 #. +> trunk 1422 #: mediawidget.cpp:7 311429 #: mediawidget.cpp:727 1423 1430 msgctxt "osd" 1424 1431 msgid "Mute On" … … 1426 1433 1427 1434 #. +> trunk 1428 #: mediawidget.cpp:73 41435 #: mediawidget.cpp:730 1429 1436 msgctxt "osd" 1430 1437 msgid "Mute Off" … … 1432 1439 1433 1440 #. +> trunk 1434 #: mediawidget.cpp:7 411441 #: mediawidget.cpp:737 1435 1442 #, kde-format 1436 1443 msgctxt "osd" … … 1439 1446 1440 1447 #. +> trunk 1441 #: mediawidget.cpp:77 61448 #: mediawidget.cpp:772 1442 1449 msgctxt "osd message" 1443 1450 msgid "Deinterlacing On" … … 1445 1452 1446 1453 #. +> trunk 1447 #: mediawidget.cpp:77 81454 #: mediawidget.cpp:774 1448 1455 msgctxt "osd message" 1449 1456 msgid "Deinterlacing Off" … … 1451 1458 1452 1459 #. +> trunk 1453 #: mediawidget.cpp:11 771460 #: mediawidget.cpp:1187 1454 1461 msgctxt "osd" 1455 1462 msgid "Playing" … … 1457 1464 1458 1465 #. +> trunk 1459 #: mediawidget.cpp:1 1961466 #: mediawidget.cpp:1206 1460 1467 msgctxt "osd" 1461 1468 msgid "Paused" … … 1463 1470 1464 1471 #. +> trunk 1465 #: mediawidget.cpp:1 4441472 #: mediawidget.cpp:1393 1466 1473 #, fuzzy 1467 1474 msgctxt "@title:window" … … 1470 1477 1471 1478 #. +> trunk 1472 #: mediawidget.cpp:1 4491479 #: mediawidget.cpp:1398 1473 1480 msgid "Enter a position:" 1474 1481 msgstr "" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/kplayer.po ¶
r862 r1036 6 6 "Project-Id-Version: \n" 7 7 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 8 "POT-Creation-Date: 201 0-11-16 11:11+0100\n"8 "POT-Creation-Date: 2011-05-25 09:37+0200\n" 9 9 "PO-Revision-Date: 2010-01-24 16:36+0100\n" 10 10 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n" … … 1358 1358 #. +> trunk 1359 1359 #: kplayernode.cpp:1703 1360 #, fuzzy 1360 1361 msgid "Searches" 1361 msgstr " "1362 msgstr "Pretrage" 1362 1363 1363 1364 #. +> trunk … … 1992 1993 1993 1994 #. +> trunk 1994 #: kplayerpart.cpp:127 main.cpp:391995 #: kplayerpart.cpp:127 1995 1996 msgid "(C) 2002-2008, kiriuja" 1996 1997 msgstr "" 1997 1998 1998 1999 #. +> trunk 1999 #: kplayerpart.cpp:129 main.cpp:402000 #: kplayerpart.cpp:129 2000 2001 msgid "kiriuja" 2001 2002 msgstr "" … … 6810 6811 6811 6812 #. +> trunk 6813 #: main.cpp:39 6814 #, fuzzy 6815 msgid "(C) 2002-2008, Kirill Bulygin" 6816 msgstr "© 2008â2009 Gilles Caulier" 6817 6818 #. +> trunk 6819 #: main.cpp:40 6820 msgid "Kirill Bulygin" 6821 msgstr "" 6822 6823 #. +> trunk 6812 6824 #: main.cpp:90 6813 6825 msgid "Play the files immediately (default)" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/extragear-multimedia/libk3b.po ¶
r982 r1036 6 6 "Project-Id-Version: \n" 7 7 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 8 "POT-Creation-Date: 2011-0 4-27 10:53+0200\n"8 "POT-Creation-Date: 2011-05-25 09:37+0200\n" 9 9 "PO-Revision-Date: 2010-01-24 16:35+0100\n" 10 10 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n" … … 359 359 #. +> trunk stable 360 360 #: jobs/k3bcdcopyjob.cpp:584 jobs/k3bdvdcopyjob.cpp:319 361 #, kde-format361 #, fuzzy, kde-format 362 362 msgid "Do you want to overwrite %1?" 363 msgstr " "363 msgstr "Åœelite li prebrisati %1?" 364 364 365 365 #. +> trunk stable … … 482 482 msgstr "" 483 483 484 #. +> trunk stable484 #. +> trunk 485 485 #: jobs/k3bcdcopyjob.cpp:1102 jobs/k3bverificationjob.cpp:269 486 #: projects/k3bcdrecordwriter.cpp:750 projects/mixedcd/k3bmixedjob.cpp:564 487 #, fuzzy 488 msgid "Please reload the medium and press 'OK'" 489 msgstr "Unesite ispravnu adresu elektronske poÅ¡te" 490 491 #. +> stable 492 #: jobs/k3bcdcopyjob.cpp:1101 jobs/k3bverificationjob.cpp:269 486 493 #: projects/k3bcdrecordwriter.cpp:750 projects/mixedcd/k3bmixedjob.cpp:564 487 494 msgid "Please reload the medium and press 'ok'" … … 1809 1816 msgstr "" 1810 1817 1811 #. +> trunk stable 1818 #. +> trunk 1819 #: projects/audiocd/k3baudiojob.cpp:501 1820 msgid "I/O Error. Most likely no space left on harddisk." 1821 msgstr "" 1822 1823 #. +> stable 1812 1824 #: projects/audiocd/k3baudiojob.cpp:501 1813 1825 msgid "IO Error. Most likely no space left on harddisk." 1814 1826 msgstr "" 1815 1827 1816 #. +> trunk stable 1828 #. +> trunk 1829 #: projects/audiocd/k3baudiojob.cpp:550 projects/mixedcd/k3bmixedjob.cpp:638 1830 #: projects/mixedcd/k3bmixedjob.cpp:679 1831 #, fuzzy 1832 msgid "I/O Error" 1833 msgstr "Ulazno-izlazna pogreÅ¡ka" 1834 1835 #. +> stable 1817 1836 #: projects/audiocd/k3baudiojob.cpp:550 projects/mixedcd/k3bmixedjob.cpp:638 1818 1837 #: projects/mixedcd/k3bmixedjob.cpp:679 … … 2249 2268 msgstr "" 2250 2269 2251 #. +> trunk stable2270 #. +> trunk 2252 2271 #: projects/datacd/k3bmkisofshandler.cpp:122 2272 msgid "The boot image contains multiple partitions." 2273 msgstr "" 2274 2275 #. +> stable 2276 #: projects/datacd/k3bmkisofshandler.cpp:117 2253 2277 msgid "The boot image contains multiple partitions.." 2254 2278 msgstr "" … … 2665 2689 #. +> trunk stable 2666 2690 #: projects/k3bcdrecordwriter.cpp:723 projects/k3bgrowisofshandler.cpp:140 2667 #: projects/k3bgrowisofshandler.cpp:147 projects/k3bgrowisofshandler.cpp:1482691 #: projects/k3bgrowisofshandler.cpp:147 2668 2692 msgid "Closing Session" 2669 2693 msgstr "" … … 2922 2946 2923 2947 #. +> trunk stable 2924 #: projects/k3bgrowisofshandler.cpp:143 projects/k3bgrowisofshandler.cpp:1442948 #: projects/k3bgrowisofshandler.cpp:143 2925 2949 msgid "Updating RMA" 2926 2950 msgstr "" 2951 2952 #. +> trunk 2953 #: projects/k3bgrowisofshandler.cpp:144 2954 #, fuzzy 2955 msgid "Updating RMA..." 2956 msgstr "AÅŸuriram ikonicu âŠ" 2957 2958 #. +> trunk 2959 #: projects/k3bgrowisofshandler.cpp:148 2960 #, fuzzy 2961 msgid "Closing Session..." 2962 msgstr "Zatvori sesiju" 2927 2963 2928 2964 #. +> trunk stable … … 3360 3396 msgstr "" 3361 3397 3362 #. +> trunk stable 3398 #. +> trunk 3399 #: projects/videocd/k3bvcdjob.cpp:184 3400 #, fuzzy 3401 msgid "Could not write correct XML file." 3402 msgstr "Nije moguÄe pisati u datoteku %1." 3403 3404 #. +> stable 3363 3405 #: projects/videocd/k3bvcdjob.cpp:184 3364 3406 msgid "Could not write correct XML-file." … … 3750 3792 #. +> trunk stable 3751 3793 #: tools/k3bmedium.cpp:359 3794 #, fuzzy 3752 3795 msgid "No medium present" 3753 msgstr " "3796 msgstr "Medij nije prisutan" 3754 3797 3755 3798 #. +> trunk stable -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/desktop_kdebase_kate.po ¶
r1032 r1036 6 6 "Project-Id-Version: desktop_kdesdk 0\n" 7 7 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 8 "POT-Creation-Date: 2011-05-2 3 09:07+0200\n"8 "POT-Creation-Date: 2011-05-25 09:38+0200\n" 9 9 "PO-Revision-Date: 2009-10-27 17:52+0100\n" 10 10 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n" … … 296 296 297 297 #. +> trunk 298 #: kate/plugins/search/katesearch.desktop:1 8298 #: kate/plugins/search/katesearch.desktop:19 299 299 #, fuzzy 300 300 msgctxt "Comment" … … 349 349 350 350 #. +> trunk 351 #: kate/plugins/tabbarextension/katetabbarextension.desktop:2 3351 #: kate/plugins/tabbarextension/katetabbarextension.desktop:24 352 352 msgctxt "Comment" 353 353 msgid "Adds a tab bar with multiple rows to Kate's main window" … … 414 414 415 415 #. +> trunk 416 #: ktexteditor/kcm_ktexteditor.desktop: 29416 #: ktexteditor/kcm_ktexteditor.desktop:30 417 417 #, fuzzy 418 418 msgctxt "Comment" … … 449 449 450 450 #. +> trunk 451 #: kwrite/kwrite.desktop: 29451 #: kwrite/kwrite.desktop:30 452 452 #, fuzzy 453 453 msgctxt "Name" … … 472 472 473 473 #. +> trunk 474 #: part/plugins/autobookmarker/ktexteditor_autobookmarker.desktop:4 0474 #: part/plugins/autobookmarker/ktexteditor_autobookmarker.desktop:41 475 475 #, fuzzy 476 476 msgctxt "Comment" … … 486 486 487 487 #. +> trunk 488 #: part/plugins/autobrace/ktexteditor_autobrace.desktop:4 3488 #: part/plugins/autobrace/ktexteditor_autobrace.desktop:44 489 489 #, fuzzy 490 490 msgctxt "Comment" … … 507 507 508 508 #. +> trunk 509 #: part/plugins/exporter/ktexteditor_exporter.desktop:4 5509 #: part/plugins/exporter/ktexteditor_exporter.desktop:46 510 510 #, fuzzy 511 511 msgctxt "Comment" … … 521 521 522 522 #. +> trunk 523 #: part/plugins/hlselection/ktexteditor_hlselection.desktop:4 3523 #: part/plugins/hlselection/ktexteditor_hlselection.desktop:44 524 524 #, fuzzy 525 525 msgctxt "Comment" … … 535 535 536 536 #. +> trunk 537 #: part/plugins/insertfile/ktexteditor_insertfile.desktop:4 5537 #: part/plugins/insertfile/ktexteditor_insertfile.desktop:46 538 538 #, fuzzy 539 539 msgctxt "Comment" … … 549 549 550 550 #. +> trunk 551 #: part/plugins/kdatatool/ktexteditor_kdatatool.desktop:4 5551 #: part/plugins/kdatatool/ktexteditor_kdatatool.desktop:46 552 552 #, fuzzy 553 553 msgctxt "Comment" … … 563 563 564 564 #. +> trunk 565 #: part/plugins/kte_iconinserter/ktexteditor_iconinserter.desktop:2 5565 #: part/plugins/kte_iconinserter/ktexteditor_iconinserter.desktop:26 566 566 #, fuzzy 567 567 msgctxt "Name" … … 570 570 571 571 #. +> trunk 572 #: part/plugins/kte_iconinserter/ktexteditor_iconinserter.desktop: 48572 #: part/plugins/kte_iconinserter/ktexteditor_iconinserter.desktop:50 573 573 #, fuzzy 574 574 msgctxt "GenericName" … … 584 584 585 585 #. +> trunk 586 #: part/plugins/kte_insanehtml_le/data/ktexteditor_insanehtml_le.desktop:3 7586 #: part/plugins/kte_insanehtml_le/data/ktexteditor_insanehtml_le.desktop:38 587 587 #, fuzzy 588 588 msgctxt "Comment" … … 598 598 599 599 #. +> trunk 600 #: part/plugins/pythonencoding/ktexteditor_python-encoding.desktop: 29600 #: part/plugins/pythonencoding/ktexteditor_python-encoding.desktop:30 601 601 #, fuzzy 602 602 msgctxt "Comment" … … 612 612 613 613 #. +> trunk 614 #: part/plugins/timedate/ktexteditor_timedate.desktop:4 6614 #: part/plugins/timedate/ktexteditor_timedate.desktop:47 615 615 #, fuzzy 616 616 msgctxt "Comment" … … 632 632 633 633 #. +> trunk 634 #: playground/kte_acomment/ktexteditor_acomment.desktop:2 0634 #: playground/kte_acomment/ktexteditor_acomment.desktop:21 635 635 msgctxt "Name" 636 636 msgid "Artistic Comment" … … 638 638 639 639 #. +> trunk 640 #: playground/kte_acomment/ktexteditor_acomment.desktop:4 2640 #: playground/kte_acomment/ktexteditor_acomment.desktop:44 641 641 msgctxt "GenericName" 642 642 msgid "Format comments in an \"artistic\" way" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/katepart4.po ¶
r1027 r1036 10 10 "Project-Id-Version: katepart4 0\n" 11 11 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 12 "POT-Creation-Date: 2011-05-2 0 07:32+0200\n"12 "POT-Creation-Date: 2011-05-25 09:38+0200\n" 13 13 "PO-Revision-Date: 2010-06-06 14:00+0200\n" 14 14 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n" … … 6643 6643 6644 6644 #. +> trunk stable 6645 #: vimode/katevimodebase.cpp:684 vimode/katevinormalmode.cpp:105 76645 #: vimode/katevimodebase.cpp:684 vimode/katevinormalmode.cpp:1059 6646 6646 #, kde-format 6647 6647 msgid "Nothing in register %1" … … 6649 6649 6650 6650 #. +> trunk stable 6651 #: vimode/katevinormalmode.cpp:13 296651 #: vimode/katevinormalmode.cpp:1331 6652 6652 #, kde-format 6653 6653 msgid "'%1' %2, Hex %3, Octal %4" … … 6655 6655 6656 6656 #. +> trunk stable 6657 #: vimode/katevinormalmode.cpp:198 36657 #: vimode/katevinormalmode.cpp:1985 6658 6658 #, kde-format 6659 6659 msgid "Mark not set: %1" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/konqueror.po ¶
r1017 r1036 9 9 "Project-Id-Version: konqueror 0\n" 10 10 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 11 "POT-Creation-Date: 2011-05- 13 05:50+0200\n"11 "POT-Creation-Date: 2011-05-25 09:38+0200\n" 12 12 "PO-Revision-Date: 2011-02-15 16:19+0100\n" 13 13 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n" … … 2640 2640 2641 2641 #. +> trunk stable 2642 #: src/konqview.cpp:1 1992642 #: src/konqview.cpp:1203 2643 2643 msgid "The page you are trying to view is the result of posted form data. If you resend the data, any action the form carried out (such as search or online purchase) will be repeated. " 2644 2644 msgstr "Stranica koju ÅŸelite otvoriti rezultat je podataka objavljenih u obliku obrasca. Ako ponovno poÅ¡aljete podatke svaka Äe akcija koja proizlazi iz obrasca biti ponovljena (npr. pretraÅŸivanje ili kupovina putem Interneta)." 2645 2645 2646 2646 #. +> trunk 2647 #: src/konqview.cpp:120 12647 #: src/konqview.cpp:1205 2648 2648 #, fuzzy 2649 2649 msgctxt "@title:window" … … 2657 2657 2658 2658 #. +> trunk stable 2659 #: src/konqview.cpp:120 12659 #: src/konqview.cpp:1205 2660 2660 msgid "Resend" 2661 2661 msgstr "Ponovno poÅ¡alji" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdebase/nepomukstorage.po ¶
r1017 r1036 8 8 "Project-Id-Version: nepomuk\n" 9 9 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 10 "POT-Creation-Date: 2011-05- 13 05:50+0200\n"10 "POT-Creation-Date: 2011-05-25 09:38+0200\n" 11 11 "PO-Revision-Date: 2010-05-30 18:06+0200\n" 12 12 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n" … … 49 49 50 50 #. +> trunk stable 51 #: ontologyloader.cpp:13 551 #: ontologyloader.cpp:134 52 52 #, kde-format 53 53 msgid "Parsing of file %1 failed (%2)" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdeedu/blinken.po ¶
r750 r1036 6 6 "Project-Id-Version: blinken\n" 7 7 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 8 "POT-Creation-Date: 2011-0 1-11 10:25+0100\n"8 "POT-Creation-Date: 2011-05-25 09:38+0200\n" 9 9 "PO-Revision-Date: 2010-03-12 10:41+0100\n" 10 10 "Last-Translator: Ivo Ugrina <ivo@iugrina.com>\n" … … 210 210 211 211 #. +> stable 212 #: highscoredialog.cpp:15 2 highscoredialog.cpp:153212 #: highscoredialog.cpp:156 highscoredialog.cpp:157 213 213 #, kde-format 214 214 msgctxt "@title:group level high scores" … … 236 236 237 237 #. +> stable 238 #: highscoredialog.cpp:15 4238 #: highscoredialog.cpp:158 239 239 msgctxt "@title:group all other level high scores" 240 240 msgid "Level ?" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdeedu/kalgebra.po ¶
r1022 r1036 7 7 "Project-Id-Version: \n" 8 8 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 9 "POT-Creation-Date: 2011-05- 17 08:57+0200\n"9 "POT-Creation-Date: 2011-05-25 09:38+0200\n" 10 10 "PO-Revision-Date: 2010-02-25 21:28+0100\n" 11 11 "Last-Translator: Ivo Ugrina <ivo@iugrina.com>\n" … … 40 40 41 41 #. +> trunk stable 42 #: analitza/analyzer.cpp:49 542 #: analitza/analyzer.cpp:498 43 43 msgctxt "Error message, no proper condition found." 44 44 msgid "Could not find a proper choice for a condition statement." … … 52 52 53 53 #. +> trunk stable 54 #: analitza/analyzer.cpp:82 454 #: analitza/analyzer.cpp:827 55 55 msgid "Type not supported for bounding." 56 56 msgstr "" 57 57 58 58 #. +> trunk stable 59 #: analitza/analyzer.cpp:8 4959 #: analitza/analyzer.cpp:852 60 60 msgid "The downlimit is greater than the uplimit" 61 61 msgstr "" 62 62 63 63 #. +> trunk stable 64 #: analitza/analyzer.cpp:85 164 #: analitza/analyzer.cpp:854 65 65 msgid "Incorrect uplimit or downlimit." 66 66 msgstr "" … … 72 72 73 73 #. +> trunk stable 74 #: analitza/analyzer.cpp:181 374 #: analitza/analyzer.cpp:1812 75 75 msgctxt "By a cycle i mean a variable that depends on itself" 76 76 msgid "Defined a variable cycle" … … 78 78 79 79 #. +> trunk stable 80 #: analitza/analyzer.cpp:185 580 #: analitza/analyzer.cpp:1854 81 81 msgid "The result is not a number" 82 82 msgstr "Rezultat nije broj" … … 171 171 172 172 #. +> trunk stable 173 #: analitza/expression.cpp:37 2173 #: analitza/expression.cpp:373 174 174 #, kde-format 175 175 msgid "Error while parsing: %1" … … 177 177 178 178 #. +> trunk stable 179 #: analitza/expression.cpp:40 3179 #: analitza/expression.cpp:404 180 180 #, kde-format 181 181 msgctxt "An error message" … … 184 184 185 185 #. +> trunk stable 186 #: analitza/expression.cpp:4 09186 #: analitza/expression.cpp:410 187 187 #, kde-format 188 188 msgid "Cannot codify the %1 value." … … 190 190 191 191 #. +> trunk stable 192 #: analitza/expression.cpp:41 5192 #: analitza/expression.cpp:416 193 193 #, kde-format 194 194 msgid "The %1 operator cannot have child contexts." … … 196 196 197 197 #. +> trunk stable 198 #: analitza/expression.cpp:4 19198 #: analitza/expression.cpp:420 199 199 #, kde-format 200 200 msgid "The element '%1' is not an operator." … … 202 202 203 203 #. +> trunk stable 204 #: analitza/expression.cpp:43 2204 #: analitza/expression.cpp:433 205 205 #, fuzzy 206 206 msgid "Do not want empty vectors" … … 208 208 209 209 #. +> trunk stable 210 #: analitza/expression.cpp:45 0210 #: analitza/expression.cpp:451 211 211 #, kde-format 212 212 msgctxt "Error message due to an unrecognized input" … … 215 215 216 216 #. +> trunk 217 #: analitza/expressiontypechecker.cpp: 401217 #: analitza/expressiontypechecker.cpp:391 218 218 msgid "The domain should be either a vector or a list." 219 219 msgstr "" 220 220 221 221 #. +> trunk stable 222 #: analitza/expressiontypechecker.cpp: 501222 #: analitza/expressiontypechecker.cpp:492 223 223 #, fuzzy, kde-format 224 224 #| msgid "Wrong parameter count, had 1 parameter for '%2'" … … 231 231 232 232 #. +> trunk stable 233 #: analitza/expressiontypechecker.cpp:53 3233 #: analitza/expressiontypechecker.cpp:531 234 234 #, fuzzy, kde-format 235 235 msgid "Could not call '%1'" … … 237 237 238 238 #. +> trunk stable 239 #: analitza/expressiontypechecker.cpp:5 41239 #: analitza/expressiontypechecker.cpp:539 240 240 #, fuzzy, kde-format 241 241 msgid "Could not solve '%1'" … … 243 243 244 244 #. +> trunk stable 245 #: analitza/expressiontypechecker.cpp:58 9245 #: analitza/expressiontypechecker.cpp:587 246 246 msgid "Could not determine the type for piecewise" 247 247 msgstr "" 248 248 249 249 #. +> trunk 250 #: analitza/expressiontypechecker.cpp:76 8250 #: analitza/expressiontypechecker.cpp:764 251 251 #, fuzzy 252 252 msgid "Unexpected type" … … 254 254 255 255 #. +> trunk stable 256 #: analitza/expressiontypechecker.cpp:7 91256 #: analitza/expressiontypechecker.cpp:787 257 257 #, fuzzy, kde-format 258 258 #| msgid "Cannot convert %1 to %2" … … 379 379 380 380 #. +> trunk stable 381 #: analitzagui/function.cpp:66 exp.g:4 15381 #: analitzagui/function.cpp:66 exp.g:420 382 382 #, fuzzy 383 383 msgid ", " … … 879 879 880 880 #. +> trunk stable 881 #: analitzagui/operatorsmodel.cpp:53 1881 #: analitzagui/operatorsmodel.cpp:533 882 882 #, kde-format 883 883 msgctxt "n-ary function prototype" … … 886 886 887 887 #. +> trunk stable 888 #: analitzagui/operatorsmodel.cpp:54 2888 #: analitzagui/operatorsmodel.cpp:544 889 889 #, kde-format 890 890 msgctxt "Function name in function prototype" … … 893 893 894 894 #. +> trunk stable 895 #: analitzagui/operatorsmodel.cpp:54 3895 #: analitzagui/operatorsmodel.cpp:545 896 896 #, kde-format 897 897 msgctxt "Uncorrect function name in function prototype" … … 900 900 901 901 #. +> trunk stable 902 #: analitzagui/operatorsmodel.cpp:54 6902 #: analitzagui/operatorsmodel.cpp:548 903 903 #, kde-format 904 904 msgctxt "Parameter in function prototype" … … 907 907 908 908 #. +> trunk stable 909 #: analitzagui/operatorsmodel.cpp:5 49 analitzagui/operatorsmodel.cpp:559909 #: analitzagui/operatorsmodel.cpp:551 analitzagui/operatorsmodel.cpp:561 910 910 #, kde-format 911 911 msgctxt "Current parameter in function prototype" … … 914 914 915 915 #. +> trunk stable 916 #: analitzagui/operatorsmodel.cpp:55 2916 #: analitzagui/operatorsmodel.cpp:554 917 917 msgctxt "Function parameter separator" 918 918 msgid ", " … … 920 920 921 921 #. +> trunk stable 922 #: analitzagui/operatorsmodel.cpp:55 6922 #: analitzagui/operatorsmodel.cpp:558 923 923 msgctxt "Current parameter is the bounding" 924 924 msgid " : bounds" … … 932 932 933 933 #. +> trunk stable 934 #: exp.g:4 15934 #: exp.g:420 935 935 #, kde-format 936 936 msgctxt "error message" … … 939 939 940 940 #. +> trunk stable 941 #: exp.g:4 17941 #: exp.g:422 942 942 msgid "Missing right parenthesis" 943 943 msgstr "Nedostaje desna zagrada" 944 944 945 945 #. +> trunk stable 946 #: exp.g:4 19946 #: exp.g:424 947 947 msgid "Unbalanced right parenthesis" 948 948 msgstr "" 949 949 950 950 #. +> trunk stable 951 #: exp.g:42 1951 #: exp.g:426 952 952 #, kde-format 953 953 msgid "Unexpected token %1" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdeedu/kalzium.po ¶
r1021 r1036 6 6 "Project-Id-Version: kalzium 0\n" 7 7 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 8 "POT-Creation-Date: 2011-05- 16 08:59+0200\n"8 "POT-Creation-Date: 2011-05-25 09:38+0200\n" 9 9 "PO-Revision-Date: 2010-08-24 23:53+0200\n" 10 10 "Last-Translator: Oliver Mucafir <oliver.untwist@gmail.com>\n" … … 86 86 87 87 #. +> trunk stable 88 #: data/knowledge.xml:4 src/kalziumgradienttype.cpp:4 4888 #: data/knowledge.xml:4 src/kalziumgradienttype.cpp:454 89 89 msgid "State of matter" 90 90 msgstr "Agregatno stanje" … … 399 399 #. +> trunk stable 400 400 #: data/knowledge.xml:131 src/elementdataviewer.cpp:228 401 #: src/kalziumgradienttype.cpp:2 84401 #: src/kalziumgradienttype.cpp:290 402 402 msgid "Atomic Mass" 403 403 msgstr "Atomska masa" … … 564 564 #: data/knowledge.xml:275 src/detailinfodlg.cpp:235 565 565 #: src/elementdataviewer.cpp:261 src/exportdialog.cpp:130 566 #: src/kalziumgradienttype.cpp:1 69src/plotsetupwidget.ui:146566 #: src/kalziumgradienttype.cpp:175 src/plotsetupwidget.ui:146 567 567 #: src/plotsetupwidget.ui:298 src/settings_gradients.ui:60 568 568 msgid "Covalent Radius" … … 5114 5114 #. +> trunk stable 5115 5115 #: src/detailinfodlg.cpp:207 src/elementdataviewer.cpp:240 5116 #: src/exportdialog.cpp:132 src/kalziumgradienttype.cpp:39 35116 #: src/exportdialog.cpp:132 src/kalziumgradienttype.cpp:399 5117 5117 #: src/plotsetupwidget.ui:131 src/plotsetupwidget.ui:283 5118 5118 #: src/settings_gradients.ui:88 … … 5125 5125 #. +> trunk stable 5126 5126 #: src/detailinfodlg.cpp:214 src/elementdataviewer.cpp:247 5127 #: src/exportdialog.cpp:133 src/kalziumgradienttype.cpp:3 375127 #: src/exportdialog.cpp:133 src/kalziumgradienttype.cpp:343 5128 5128 #: src/plotsetupwidget.ui:136 src/plotsetupwidget.ui:288 5129 5129 #: src/settings_gradients.ui:81 … … 6507 6507 6508 6508 #. +> trunk stable 6509 #: src/kalziumgradienttype.cpp:2 266509 #: src/kalziumgradienttype.cpp:232 6510 6510 msgid "van Der Waals" 6511 6511 msgstr "Van Der Waals" 6512 6512 6513 6513 #. +> trunk stable 6514 #: src/kalziumgradienttype.cpp: 2966514 #: src/kalziumgradienttype.cpp:302 6515 6515 msgid "u" 6516 6516 msgstr "u" … … 6524 6524 6525 6525 #. +> trunk stable 6526 #: src/kalziumgradienttype.cpp:5 046526 #: src/kalziumgradienttype.cpp:510 6527 6527 msgid "Electronegativity (Pauling)" 6528 6528 msgstr "Elektronegativnost (Pauling)" 6529 6529 6530 6530 #. +> trunk stable 6531 #: src/kalziumgradienttype.cpp:5 596531 #: src/kalziumgradienttype.cpp:565 6532 6532 msgid "Discovery date" 6533 6533 msgstr "Datum otkriÄa" … … 6540 6540 #. i18n: ectx: property (text), widget (QCheckBox, kcfg_LogarithmicElectronaffinityGradient) 6541 6541 #. +> trunk stable 6542 #: src/kalziumgradienttype.cpp:6 16src/settings_gradients.ui:1096542 #: src/kalziumgradienttype.cpp:622 src/settings_gradients.ui:109 6543 6543 msgid "Electronaffinity" 6544 6544 msgstr "Elektronski afinitet" 6545 6545 6546 6546 #. +> trunk stable 6547 #: src/kalziumgradienttype.cpp:67 36547 #: src/kalziumgradienttype.cpp:678 6548 6548 msgid "First Ionization" 6549 6549 msgstr "Prva ionizacija" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdeedu/marble_qt.po ¶
r1031 r1036 7 7 "Project-Id-Version: \n" 8 8 "Report-Msgid-Bugs-To: \n" 9 "POT-Creation-Date: 2011-05-2 2 08:38+0200\n"9 "POT-Creation-Date: 2011-05-25 09:39+0200\n" 10 10 "PO-Revision-Date: 2010-09-14 15:36+0200\n" 11 11 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n" … … 397 397 398 398 #. +> trunk stable 399 #: src/lib/geodata/parser/GeoDataParser.cpp:9 8399 #: src/lib/geodata/parser/GeoDataParser.cpp:99 400 400 msgid "The file is not a valid GPX 1.0 / 1.1 file" 401 401 msgstr "" 402 402 403 403 #. +> trunk stable 404 #: src/lib/geodata/parser/GeoDataParser.cpp:10 1404 #: src/lib/geodata/parser/GeoDataParser.cpp:102 405 405 msgid "The file is not a valid KML 2.0 / 2.1 / 2.2 file" 406 406 msgstr "" 407 407 408 408 #. +> trunk stable 409 #: src/lib/geodata/parser/GeoParser.cpp:1 29409 #: src/lib/geodata/parser/GeoParser.cpp:130 410 410 #, fuzzy, qt-format 411 411 msgid "Error parsing file at line: %1 and column %2 . " … … 413 413 414 414 #. +> trunk stable 415 #: src/lib/geodata/parser/GeoParser.cpp:13 1415 #: src/lib/geodata/parser/GeoParser.cpp:132 416 416 #, fuzzy 417 417 msgid "This is an Invalid File" … … 419 419 420 420 #. +> trunk stable 421 #: src/lib/geodata/parser/GeoParser.cpp:19 0421 #: src/lib/geodata/parser/GeoParser.cpp:191 422 422 msgid "File format unrecognized" 423 423 msgstr "" 424 424 425 425 #. +> trunk stable 426 #: src/lib/geodata/parser/GeoSceneParser.cpp:6 4426 #: src/lib/geodata/parser/GeoSceneParser.cpp:65 427 427 msgid "The file is not a valid DGML 2.0 file" 428 428 msgstr "" … … 1132 1132 1133 1133 #. +> trunk stable 1134 #: src/lib/MarbleWidget.cpp:11 591134 #: src/lib/MarbleWidget.cpp:1170 1135 1135 #: src/plugins/render/mapscale/MapScaleFloatItem.cpp:48 1136 1136 #: src/plugins/render/mapscale/MapScaleFloatItem.cpp:244 … … 1140 1140 1141 1141 #. +> trunk stable 1142 #: src/lib/MarbleWidget.cpp:11 631142 #: src/lib/MarbleWidget.cpp:1174 1143 1143 #: src/plugins/render/mapscale/MapScaleFloatItem.cpp:253 1144 1144 #, fuzzy -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdegraphics/gwenview.po ¶
r1032 r1036 9 9 "Project-Id-Version: \n" 10 10 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 11 "POT-Creation-Date: 2011-05-2 3 09:09+0200\n"11 "POT-Creation-Date: 2011-05-25 09:39+0200\n" 12 12 "PO-Revision-Date: 2011-03-12 12:13+0100\n" 13 13 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n" … … 126 126 127 127 #. +> trunk 128 #: app/fileoperations.cpp: 72128 #: app/fileoperations.cpp:57 129 129 #, fuzzy 130 130 #| msgid "Copy To" … … 139 139 140 140 #. +> trunk stable 141 #: app/fileoperations.cpp: 73141 #: app/fileoperations.cpp:58 142 142 msgctxt "@action:button" 143 143 msgid "Copy" … … 145 145 146 146 #. +> trunk 147 #: app/fileoperations.cpp: 76147 #: app/fileoperations.cpp:61 148 148 #, fuzzy 149 149 #| msgid "Move To" … … 158 158 159 159 #. +> trunk stable 160 #: app/fileoperations.cpp: 77160 #: app/fileoperations.cpp:62 161 161 msgctxt "@action:button" 162 162 msgid "Move" … … 164 164 165 165 #. +> trunk 166 #: app/fileoperations.cpp: 80166 #: app/fileoperations.cpp:65 167 167 #, fuzzy 168 168 #| msgid "Link To" … … 177 177 178 178 #. +> trunk stable 179 #: app/fileoperations.cpp: 81179 #: app/fileoperations.cpp:66 180 180 msgctxt "@action:button" 181 181 msgid "Link" 182 182 msgstr "PoveÅŸi" 183 183 184 #. +> trunk 185 #: app/fileoperations.cpp:170 186 #, fuzzy 187 #| msgid "Create Folder" 188 msgctxt "@title:window" 189 msgid "Create Folder" 190 msgstr "Stvori mapu" 184 #. +> trunk stable 185 #: app/fileoperations.cpp:159 186 msgid "Move Here" 187 msgstr "Ovdje premjesti" 188 189 #. +> trunk stable 190 #: app/fileoperations.cpp:162 191 msgid "Copy Here" 192 msgstr "Ovdje kopiraj" 193 194 #. +> trunk stable 195 #: app/fileoperations.cpp:165 196 msgid "Link Here" 197 msgstr "Ovdje poveÅŸi" 198 199 #. +> trunk stable 200 #: app/fileoperations.cpp:169 201 msgid "Cancel" 202 msgstr "Prekini" 191 203 192 204 #. +> stable … … 195 207 msgstr "Stvori mapu" 196 208 197 #. +> trunkstable209 #. +> stable 198 210 #: app/fileoperations.cpp:171 199 211 msgid "Enter the name of the folder to create:" 200 212 msgstr "Unesite naziv mape koju treba stvoriti:" 201 213 202 #. +> trunk stable203 #: app/fileoperations.cpp:201204 msgid "Move Here"205 msgstr "Ovdje premjesti"206 207 #. +> trunk stable208 #: app/fileoperations.cpp:204209 msgid "Copy Here"210 msgstr "Ovdje kopiraj"211 212 #. +> trunk stable213 #: app/fileoperations.cpp:207214 msgid "Link Here"215 msgstr "Ovdje poveÅŸi"216 217 #. +> trunk stable218 #: app/fileoperations.cpp:211219 msgid "Cancel"220 msgstr "Prekini"221 222 214 #. +> trunk 223 #: app/fileoperations.cpp: 227215 #: app/fileoperations.cpp:188 224 216 #, fuzzy 225 217 #| msgid "Rename" … … 234 226 235 227 #. +> trunk stable 236 #: app/fileoperations.cpp: 228228 #: app/fileoperations.cpp:189 237 229 #, kde-format 238 230 msgid "Rename <filename>%1</filename> to:" 239 231 msgstr "Preimenuj <filename>%1</filename> u:" 240 232 241 #. +> trunkstable242 #: app/fileopscontextmanageritem.cpp:8 6233 #. +> stable 234 #: app/fileopscontextmanageritem.cpp:82 243 235 msgctxt "@action:inmenu" 244 236 msgid "Paste One Folder" 245 237 msgstr "Zalijepi jednu mapu" 246 238 247 #. +> trunkstable248 #: app/fileopscontextmanageritem.cpp:8 7239 #. +> stable 240 #: app/fileopscontextmanageritem.cpp:83 249 241 msgctxt "@action:inmenu" 250 242 msgid "Paste One File" 251 243 msgstr "Zalijepi jednu datoteku" 252 244 253 #. +> trunkstable254 #: app/fileopscontextmanageritem.cpp: 90245 #. +> stable 246 #: app/fileopscontextmanageritem.cpp:86 255 247 #, kde-format 256 248 msgctxt "@action:inmenu" … … 261 253 msgstr[2] "Zalijepi %1 stavki" 262 254 263 #. +> trunkstable264 #: app/fileopscontextmanageritem.cpp: 92255 #. +> stable 256 #: app/fileopscontextmanageritem.cpp:88 265 257 msgctxt "@action:inmenu" 266 258 msgid "Paste Clipboard Contents..." 267 259 msgstr "Zalijepi sadrÅŸaj odlagaliÅ¡ta âŠ" 268 260 269 #. +> trunkstable270 #: app/fileopscontextmanageritem.cpp:9 6261 #. +> stable 262 #: app/fileopscontextmanageritem.cpp:92 271 263 msgctxt "@action:inmenu" 272 264 msgid "Paste" … … 274 266 275 267 #. +> trunk stable 276 #: app/fileopscontextmanageritem.cpp: 208268 #: app/fileopscontextmanageritem.cpp:165 277 269 msgid "File Operations" 278 270 msgstr "Postupci nad datotekom" 279 271 280 272 #. +> trunk stable 281 #: app/fileopscontextmanageritem.cpp: 219app/mainwindow.cpp:311273 #: app/fileopscontextmanageritem.cpp:176 app/mainwindow.cpp:311 282 274 #: app/thumbnailviewpanel.cpp:147 283 275 msgctxt "@title actions category" … … 286 278 287 279 #. +> trunk stable 288 #: app/fileopscontextmanageritem.cpp: 220280 #: app/fileopscontextmanageritem.cpp:177 289 281 #: app/semanticinfocontextmanageritem.cpp:161 290 282 msgctxt "@title actions category" … … 293 285 294 286 #. +> trunk stable 295 #: app/fileopscontextmanageritem.cpp: 235287 #: app/fileopscontextmanageritem.cpp:192 296 288 msgctxt "Verb" 297 289 msgid "Copy To..." … … 299 291 300 292 #. +> trunk stable 301 #: app/fileopscontextmanageritem.cpp: 239293 #: app/fileopscontextmanageritem.cpp:196 302 294 msgctxt "Verb" 303 295 msgid "Move To..." … … 305 297 306 298 #. +> trunk stable 307 #: app/fileopscontextmanageritem.cpp:2 43299 #: app/fileopscontextmanageritem.cpp:200 308 300 msgctxt "Verb: create link to the file where user wants" 309 301 msgid "Link To..." … … 311 303 312 304 #. +> trunk stable 313 #: app/fileopscontextmanageritem.cpp:2 47305 #: app/fileopscontextmanageritem.cpp:204 314 306 msgctxt "Verb" 315 307 msgid "Rename..." … … 317 309 318 310 #. +> trunk stable 319 #: app/fileopscontextmanageritem.cpp:2 51311 #: app/fileopscontextmanageritem.cpp:208 320 312 msgctxt "Verb" 321 313 msgid "Trash" … … 323 315 324 316 #. +> trunk stable 325 #: app/fileopscontextmanageritem.cpp:2 56317 #: app/fileopscontextmanageritem.cpp:213 326 318 msgid "Delete" 327 319 msgstr "IzbriÅ¡i" 328 320 329 321 #. +> trunk 330 #: app/fileopscontextmanageritem.cpp:2 61322 #: app/fileopscontextmanageritem.cpp:218 331 323 #, fuzzy 332 324 msgid "Restore" … … 334 326 335 327 #. +> trunk stable 336 #: app/fileopscontextmanageritem.cpp:2 64328 #: app/fileopscontextmanageritem.cpp:221 337 329 msgid "Properties" 338 330 msgstr "Svojstva" 339 331 340 332 #. +> trunk stable 341 #: app/fileopscontextmanageritem.cpp:2 68333 #: app/fileopscontextmanageritem.cpp:225 342 334 msgid "Create Folder..." 343 335 msgstr "Stvori mapu âŠ" 344 336 345 337 #. +> trunk stable 346 #: app/fileopscontextmanageritem.cpp:2 72338 #: app/fileopscontextmanageritem.cpp:229 347 339 msgid "Open With" 348 340 msgstr "Otvori s" 349 341 350 342 #. +> trunk stable 351 #: app/fileopscontextmanageritem.cpp:4 61343 #: app/fileopscontextmanageritem.cpp:419 352 344 msgid "Other Application..." 353 345 msgstr "Druga aplikacija âŠ" … … 753 745 754 746 #. +> trunk stable 755 #: app/infocontextmanageritem.cpp:16 4747 #: app/infocontextmanageritem.cpp:165 756 748 #, kde-format 757 749 msgctxt "@item:intext %1 is a key, we append a colon to it. A value is displayed after" … … 760 752 761 753 #. +> trunk stable 762 #: app/infocontextmanageritem.cpp:23 6754 #: app/infocontextmanageritem.cpp:237 763 755 msgctxt "@action show more image meta info" 764 756 msgid "More..." … … 766 758 767 759 #. +> trunk stable 768 #: app/infocontextmanageritem.cpp:24 7760 #: app/infocontextmanageritem.cpp:248 769 761 msgctxt "@title:group" 770 762 msgid "Meta Information" … … 772 764 773 765 #. +> trunk stable 774 #: app/infocontextmanageritem.cpp:33 6766 #: app/infocontextmanageritem.cpp:337 775 767 #, kde-format 776 768 msgctxt "@label" … … 782 774 783 775 #. +> trunk stable 784 #: app/infocontextmanageritem.cpp:33 8776 #: app/infocontextmanageritem.cpp:339 785 777 #, kde-format 786 778 msgctxt "@label" … … 792 784 793 785 #. +> trunk stable 794 #: app/infocontextmanageritem.cpp:34 1786 #: app/infocontextmanageritem.cpp:342 795 787 #, kde-format 796 788 msgid "%1 folder" … … 801 793 802 794 #. +> trunk stable 803 #: app/infocontextmanageritem.cpp:34 1795 #: app/infocontextmanageritem.cpp:342 804 796 #, kde-format 805 797 msgid "%1 file" … … 810 802 811 803 #. +> trunk stable 812 #: app/infocontextmanageritem.cpp:34 1804 #: app/infocontextmanageritem.cpp:342 813 805 #, kde-format 814 806 msgctxt "@label. The two parameters are strings like '2 folders' and '1 file'." … … 2112 2104 msgstr "P&rikaz" 2113 2105 2106 #, fuzzy 2107 #~| msgid "Create Folder" 2108 #~ msgctxt "@title:window" 2109 #~ msgid "Create Folder" 2110 #~ msgstr "Stvori mapu" 2111 2114 2112 #~ msgid "Enter the new size of the image:" 2115 2113 #~ msgstr "Unesite novu veliÄinu slike:" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdelibs/kdecalendarsystems.po ¶
r1014 r1036 12 12 "Project-Id-Version: kdelibs4\n" 13 13 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 14 "POT-Creation-Date: 2011-05- 09 09:14+0200\n"14 "POT-Creation-Date: 2011-05-25 09:40+0200\n" 15 15 "PO-Revision-Date: 2011-05-05 10:21+0200\n" 16 16 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" … … 30 30 31 31 #. +> trunk stable 32 #: kcalendarsystem.cpp:83 kcalendarsystem.cpp:17 432 #: kcalendarsystem.cpp:83 kcalendarsystem.cpp:175 33 33 msgctxt "@item Calendar system" 34 34 msgid "Invalid Calendar Type" … … 36 36 37 37 #. +> trunk stable 38 #: kcalendarsystem.cpp:1 4938 #: kcalendarsystem.cpp:150 39 39 msgctxt "@item Calendar system" 40 40 msgid "Gregorian" … … 42 42 43 43 #. +> trunk stable 44 #: kcalendarsystem.cpp:15 144 #: kcalendarsystem.cpp:152 45 45 msgctxt "@item Calendar system" 46 46 msgid "Coptic" … … 48 48 49 49 #. +> trunk stable 50 #: kcalendarsystem.cpp:15 350 #: kcalendarsystem.cpp:154 51 51 msgctxt "@item Calendar system" 52 52 msgid "Ethiopian" … … 54 54 55 55 #. +> trunk stable 56 #: kcalendarsystem.cpp:15 556 #: kcalendarsystem.cpp:156 57 57 msgctxt "@item Calendar system" 58 58 msgid "Gregorian (Proleptic)" … … 60 60 61 61 #. +> trunk stable 62 #: kcalendarsystem.cpp:15 762 #: kcalendarsystem.cpp:158 63 63 msgctxt "@item Calendar system" 64 64 msgid "Hebrew" … … 66 66 67 67 #. +> trunk stable 68 #: kcalendarsystem.cpp:1 5968 #: kcalendarsystem.cpp:160 69 69 msgctxt "@item Calendar system" 70 70 msgid "Islamic / Hijri (Civil)" … … 72 72 73 73 #. +> trunk stable 74 #: kcalendarsystem.cpp:16 174 #: kcalendarsystem.cpp:162 75 75 msgctxt "@item Calendar system" 76 76 msgid "Indian National" … … 78 78 79 79 #. +> trunk stable 80 #: kcalendarsystem.cpp:16 380 #: kcalendarsystem.cpp:164 81 81 msgctxt "@item Calendar system" 82 82 msgid "Jalali" … … 84 84 85 85 #. +> trunk stable 86 #: kcalendarsystem.cpp:16 586 #: kcalendarsystem.cpp:166 87 87 msgctxt "@item Calendar system" 88 88 msgid "Japanese" … … 90 90 91 91 #. +> trunk stable 92 #: kcalendarsystem.cpp:16 792 #: kcalendarsystem.cpp:168 93 93 msgctxt "@item Calendar system" 94 94 msgid "Julian" … … 96 96 97 97 #. +> trunk stable 98 #: kcalendarsystem.cpp:1 6998 #: kcalendarsystem.cpp:170 99 99 msgctxt "@item Calendar system" 100 100 msgid "Taiwanese" … … 102 102 103 103 #. +> trunk stable 104 #: kcalendarsystem.cpp:17 1104 #: kcalendarsystem.cpp:172 105 105 msgctxt "@item Calendar system" 106 106 msgid "Thai" … … 108 108 109 109 #. +> trunk stable 110 #: kcalendarsystem.cpp: 1990110 #: kcalendarsystem.cpp:2026 111 111 msgctxt "Negative symbol as used for year numbers, e.g. -5 = 5 BC" 112 112 msgid "-" … … 114 114 115 115 #. +> trunk stable 116 #: kcalendarsystem.cpp:20 27116 #: kcalendarsystem.cpp:2063 117 117 msgid "Today" 118 118 msgstr "Danas" 119 119 120 120 #. +> trunk stable 121 #: kcalendarsystem.cpp:20 29121 #: kcalendarsystem.cpp:2065 122 122 msgid "Yesterday" 123 123 msgstr "JuÄer" … … 1282 1282 1283 1283 #. +> trunk stable 1284 #: kcalendarsystemethiopian.cpp:5 61284 #: kcalendarsystemethiopian.cpp:54 1285 1285 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, LongFormat" 1286 1286 msgid "Amata Mehrat" … … 1288 1288 1289 1289 #. +> trunk stable 1290 #: kcalendarsystemethiopian.cpp:5 71290 #: kcalendarsystemethiopian.cpp:55 1291 1291 msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, ShortFormat" 1292 1292 msgid "AM" … … 1294 1294 1295 1295 #. +> trunk stable 1296 #: kcalendarsystemethiopian.cpp:5 81296 #: kcalendarsystemethiopian.cpp:56 1297 1297 #, c-format 1298 1298 msgctxt "(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM" … … 1301 1301 1302 1302 #. +> trunk 1303 #: kcalendarsystemethiopian.cpp: 701303 #: kcalendarsystemethiopian.cpp:68 1304 1304 #, fuzzy 1305 1305 msgctxt "Ethiopian month 1 - KLocale::NarrowName" … … 1308 1308 1309 1309 #. +> trunk 1310 #: kcalendarsystemethiopian.cpp:7 21310 #: kcalendarsystemethiopian.cpp:70 1311 1311 #, fuzzy 1312 1312 msgctxt "Ethiopian month 2 - KLocale::NarrowName" … … 1315 1315 1316 1316 #. +> trunk 1317 #: kcalendarsystemethiopian.cpp:7 41317 #: kcalendarsystemethiopian.cpp:72 1318 1318 #, fuzzy 1319 1319 msgctxt "Ethiopian month 3 - KLocale::NarrowName" … … 1322 1322 1323 1323 #. +> trunk 1324 #: kcalendarsystemethiopian.cpp:7 61324 #: kcalendarsystemethiopian.cpp:74 1325 1325 #, fuzzy 1326 1326 msgctxt "Ethiopian month 4 - KLocale::NarrowName" … … 1329 1329 1330 1330 #. +> trunk 1331 #: kcalendarsystemethiopian.cpp:7 81331 #: kcalendarsystemethiopian.cpp:76 1332 1332 #, fuzzy 1333 1333 msgctxt "Ethiopian month 5 - KLocale::NarrowName" … … 1336 1336 1337 1337 #. +> trunk 1338 #: kcalendarsystemethiopian.cpp: 801338 #: kcalendarsystemethiopian.cpp:78 1339 1339 #, fuzzy 1340 1340 msgctxt "Ethiopian month 6 - KLocale::NarrowName" … … 1343 1343 1344 1344 #. +> trunk 1345 #: kcalendarsystemethiopian.cpp:8 21345 #: kcalendarsystemethiopian.cpp:80 1346 1346 #, fuzzy 1347 1347 msgctxt "Ethiopian month 7 - KLocale::NarrowName" … … 1350 1350 1351 1351 #. +> trunk 1352 #: kcalendarsystemethiopian.cpp:8 41352 #: kcalendarsystemethiopian.cpp:82 1353 1353 #, fuzzy 1354 1354 msgctxt "Ethiopian month 8 - KLocale::NarrowName" … … 1357 1357 1358 1358 #. +> trunk 1359 #: kcalendarsystemethiopian.cpp:8 61359 #: kcalendarsystemethiopian.cpp:84 1360 1360 #, fuzzy 1361 1361 msgctxt "Ethiopian month 9 - KLocale::NarrowName" … … 1364 1364 1365 1365 #. +> trunk 1366 #: kcalendarsystemethiopian.cpp:8 81366 #: kcalendarsystemethiopian.cpp:86 1367 1367 #, fuzzy 1368 1368 msgctxt "Ethiopian month 10 - KLocale::NarrowName" … … 1371 1371 1372 1372 #. +> trunk 1373 #: kcalendarsystemethiopian.cpp: 901373 #: kcalendarsystemethiopian.cpp:88 1374 1374 #, fuzzy 1375 1375 msgctxt "Ethiopian month 11 - KLocale::NarrowName" … … 1378 1378 1379 1379 #. +> trunk 1380 #: kcalendarsystemethiopian.cpp:9 21380 #: kcalendarsystemethiopian.cpp:90 1381 1381 #, fuzzy 1382 1382 msgctxt "Ethiopian month 12 - KLocale::NarrowName" … … 1385 1385 1386 1386 #. +> trunk 1387 #: kcalendarsystemethiopian.cpp:9 41387 #: kcalendarsystemethiopian.cpp:92 1388 1388 #, fuzzy 1389 1389 #| msgid "PM" … … 1393 1393 1394 1394 #. +> trunk 1395 #: kcalendarsystemethiopian.cpp:10 31395 #: kcalendarsystemethiopian.cpp:101 1396 1396 #, fuzzy 1397 1397 #| msgctxt "Coptic month 6 - ShortNamePossessive" … … 1408 1408 1409 1409 #. +> trunk 1410 #: kcalendarsystemethiopian.cpp:10 51410 #: kcalendarsystemethiopian.cpp:103 1411 1411 #, fuzzy 1412 1412 #| msgctxt "Ethiopian month 2 - ShortNamePossessive" … … 1423 1423 1424 1424 #. +> trunk 1425 #: kcalendarsystemethiopian.cpp:10 71425 #: kcalendarsystemethiopian.cpp:105 1426 1426 #, fuzzy 1427 1427 #| msgctxt "Ethiopian month 3 - ShortNamePossessive" … … 1438 1438 1439 1439 #. +> trunk 1440 #: kcalendarsystemethiopian.cpp:10 91440 #: kcalendarsystemethiopian.cpp:107 1441 1441 #, fuzzy 1442 1442 #| msgctxt "Ethiopian month 4 - ShortNamePossessive" … … 1453 1453 1454 1454 #. +> trunk 1455 #: kcalendarsystemethiopian.cpp:1 111455 #: kcalendarsystemethiopian.cpp:109 1456 1456 #, fuzzy 1457 1457 #| msgctxt "Ethiopian month 5 - ShortNamePossessive" … … 1468 1468 1469 1469 #. +> trunk 1470 #: kcalendarsystemethiopian.cpp:11 31470 #: kcalendarsystemethiopian.cpp:111 1471 1471 #, fuzzy 1472 1472 #| msgctxt "Ethiopian month 6 - ShortNamePossessive" … … 1483 1483 1484 1484 #. +> trunk 1485 #: kcalendarsystemethiopian.cpp:11 51485 #: kcalendarsystemethiopian.cpp:113 1486 1486 #, fuzzy 1487 1487 #| msgctxt "Ethiopian month 7 - ShortNamePossessive" … … 1498 1498 1499 1499 #. +> trunk 1500 #: kcalendarsystemethiopian.cpp:11 71500 #: kcalendarsystemethiopian.cpp:115 1501 1501 #, fuzzy 1502 1502 #| msgctxt "Ethiopian month 8 - ShortNamePossessive" … … 1513 1513 1514 1514 #. +> trunk 1515 #: kcalendarsystemethiopian.cpp:11 91515 #: kcalendarsystemethiopian.cpp:117 1516 1516 #, fuzzy 1517 1517 #| msgctxt "Ethiopian month 9 - ShortNamePossessive" … … 1528 1528 1529 1529 #. +> trunk 1530 #: kcalendarsystemethiopian.cpp:1 211530 #: kcalendarsystemethiopian.cpp:119 1531 1531 #, fuzzy 1532 1532 #| msgctxt "Ethiopian month 10 - ShortNamePossessive" … … 1543 1543 1544 1544 #. +> trunk 1545 #: kcalendarsystemethiopian.cpp:12 31545 #: kcalendarsystemethiopian.cpp:121 1546 1546 #, fuzzy 1547 1547 #| msgctxt "Ethiopian month 11 - ShortNamePossessive" … … 1558 1558 1559 1559 #. +> trunk 1560 #: kcalendarsystemethiopian.cpp:12 51560 #: kcalendarsystemethiopian.cpp:123 1561 1561 #, fuzzy 1562 1562 #| msgctxt "Ethiopian month 12 - ShortNamePossessive" … … 1573 1573 1574 1574 #. +> trunk 1575 #: kcalendarsystemethiopian.cpp:12 71575 #: kcalendarsystemethiopian.cpp:125 1576 1576 #, fuzzy 1577 1577 #| msgctxt "Ethiopian month 13 - ShortNamePossessive" … … 1588 1588 1589 1589 #. +> trunk 1590 #: kcalendarsystemethiopian.cpp:13 61590 #: kcalendarsystemethiopian.cpp:134 1591 1591 #, fuzzy 1592 1592 #| msgctxt "Coptic month 6 - ShortName" … … 1603 1603 1604 1604 #. +> trunk 1605 #: kcalendarsystemethiopian.cpp:13 81605 #: kcalendarsystemethiopian.cpp:136 1606 1606 #, fuzzy 1607 1607 #| msgctxt "Ethiopian month 2 - ShortName" … … 1618 1618 1619 1619 #. +> trunk 1620 #: kcalendarsystemethiopian.cpp:1 401620 #: kcalendarsystemethiopian.cpp:138 1621 1621 #, fuzzy 1622 1622 #| msgctxt "Ethiopian month 3 - ShortName" … … 1633 1633 1634 1634 #. +> trunk 1635 #: kcalendarsystemethiopian.cpp:14 21635 #: kcalendarsystemethiopian.cpp:140 1636 1636 #, fuzzy 1637 1637 #| msgctxt "Ethiopian month 4 - ShortName" … … 1648 1648 1649 1649 #. +> trunk 1650 #: kcalendarsystemethiopian.cpp:14 41650 #: kcalendarsystemethiopian.cpp:142 1651 1651 #, fuzzy 1652 1652 #| msgctxt "Ethiopian month 5 - ShortName" … … 1663 1663 1664 1664 #. +> trunk 1665 #: kcalendarsystemethiopian.cpp:14 61665 #: kcalendarsystemethiopian.cpp:144 1666 1666 #, fuzzy 1667 1667 #| msgctxt "Ethiopian month 6 - ShortName" … … 1678 1678 1679 1679 #. +> trunk 1680 #: kcalendarsystemethiopian.cpp:14 81680 #: kcalendarsystemethiopian.cpp:146 1681 1681 #, fuzzy 1682 1682 #| msgctxt "Ethiopian month 7 - ShortName" … … 1693 1693 1694 1694 #. +> trunk 1695 #: kcalendarsystemethiopian.cpp:1 501695 #: kcalendarsystemethiopian.cpp:148 1696 1696 #, fuzzy 1697 1697 #| msgctxt "Ethiopian month 8 - ShortName" … … 1708 1708 1709 1709 #. +> trunk 1710 #: kcalendarsystemethiopian.cpp:15 21710 #: kcalendarsystemethiopian.cpp:150 1711 1711 #, fuzzy 1712 1712 #| msgctxt "Ethiopian month 9 - ShortName" … … 1723 1723 1724 1724 #. +> trunk 1725 #: kcalendarsystemethiopian.cpp:15 41725 #: kcalendarsystemethiopian.cpp:152 1726 1726 #, fuzzy 1727 1727 #| msgctxt "Ethiopian month 10 - ShortName" … … 1738 1738 1739 1739 #. +> trunk 1740 #: kcalendarsystemethiopian.cpp:15 61740 #: kcalendarsystemethiopian.cpp:154 1741 1741 #, fuzzy 1742 1742 msgctxt "Ethiopian month 11 - KLocale::ShortName" … … 1751 1751 1752 1752 #. +> trunk 1753 #: kcalendarsystemethiopian.cpp:15 81753 #: kcalendarsystemethiopian.cpp:156 1754 1754 #, fuzzy 1755 1755 #| msgctxt "Ethiopian month 12 - ShortName" … … 1766 1766 1767 1767 #. +> trunk 1768 #: kcalendarsystemethiopian.cpp:1 601768 #: kcalendarsystemethiopian.cpp:158 1769 1769 #, fuzzy 1770 1770 #| msgctxt "Ethiopian month 13 - ShortName" … … 1781 1781 1782 1782 #. +> trunk 1783 #: kcalendarsystemethiopian.cpp:16 91783 #: kcalendarsystemethiopian.cpp:167 1784 1784 #, fuzzy 1785 1785 #| msgctxt "Ethiopian month 1 - LongNamePossessive" … … 1796 1796 1797 1797 #. +> trunk 1798 #: kcalendarsystemethiopian.cpp:1 711798 #: kcalendarsystemethiopian.cpp:169 1799 1799 #, fuzzy 1800 1800 #| msgctxt "Ethiopian month 2 - LongNamePossessive" … … 1811 1811 1812 1812 #. +> trunk 1813 #: kcalendarsystemethiopian.cpp:17 31813 #: kcalendarsystemethiopian.cpp:171 1814 1814 #, fuzzy 1815 1815 #| msgctxt "Ethiopian month 3 - LongNamePossessive" … … 1826 1826 1827 1827 #. +> trunk 1828 #: kcalendarsystemethiopian.cpp:17 51828 #: kcalendarsystemethiopian.cpp:173 1829 1829 #, fuzzy 1830 1830 #| msgctxt "Ethiopian month 4 - LongNamePossessive" … … 1841 1841 1842 1842 #. +> trunk 1843 #: kcalendarsystemethiopian.cpp:17 71843 #: kcalendarsystemethiopian.cpp:175 1844 1844 #, fuzzy 1845 1845 #| msgctxt "Ethiopian month 5 - ShortNamePossessive" … … 1856 1856 1857 1857 #. +> trunk 1858 #: kcalendarsystemethiopian.cpp:17 91858 #: kcalendarsystemethiopian.cpp:177 1859 1859 #, fuzzy 1860 1860 #| msgctxt "Ethiopian month 6 - LongNamePossessive" … … 1871 1871 1872 1872 #. +> trunk 1873 #: kcalendarsystemethiopian.cpp:1 811873 #: kcalendarsystemethiopian.cpp:179 1874 1874 #, fuzzy 1875 1875 #| msgctxt "Ethiopian month 7 - LongNamePossessive" … … 1886 1886 1887 1887 #. +> trunk 1888 #: kcalendarsystemethiopian.cpp:18 31888 #: kcalendarsystemethiopian.cpp:181 1889 1889 #, fuzzy 1890 1890 #| msgctxt "Ethiopian month 8 - LongNamePossessive" … … 1901 1901 1902 1902 #. +> trunk 1903 #: kcalendarsystemethiopian.cpp:18 51903 #: kcalendarsystemethiopian.cpp:183 1904 1904 #, fuzzy 1905 1905 #| msgctxt "Ethiopian month 9 - LongNamePossessive" … … 1916 1916 1917 1917 #. +> trunk 1918 #: kcalendarsystemethiopian.cpp:18 71918 #: kcalendarsystemethiopian.cpp:185 1919 1919 #, fuzzy 1920 1920 #| msgctxt "Ethiopian month 10 - LongNamePossessive" … … 1931 1931 1932 1932 #. +> trunk 1933 #: kcalendarsystemethiopian.cpp:18 91933 #: kcalendarsystemethiopian.cpp:187 1934 1934 #, fuzzy 1935 1935 #| msgctxt "Ethiopian month 11 - LongNamePossessive" … … 1946 1946 1947 1947 #. +> trunk 1948 #: kcalendarsystemethiopian.cpp:1 911948 #: kcalendarsystemethiopian.cpp:189 1949 1949 #, fuzzy 1950 1950 #| msgctxt "Ethiopian month 12 - LongNamePossessive" … … 1961 1961 1962 1962 #. +> trunk 1963 #: kcalendarsystemethiopian.cpp:19 31963 #: kcalendarsystemethiopian.cpp:191 1964 1964 #, fuzzy 1965 1965 #| msgctxt "Ethiopian month 13 - LongNamePossessive" … … 1976 1976 1977 1977 #. +> trunk 1978 #: kcalendarsystemethiopian.cpp:20 21978 #: kcalendarsystemethiopian.cpp:200 1979 1979 #, fuzzy 1980 1980 #| msgctxt "Ethiopian month 1 - LongName" … … 1991 1991 1992 1992 #. +> trunk 1993 #: kcalendarsystemethiopian.cpp:20 41993 #: kcalendarsystemethiopian.cpp:202 1994 1994 #, fuzzy 1995 1995 #| msgctxt "Ethiopian month 2 - LongName" … … 2006 2006 2007 2007 #. +> trunk 2008 #: kcalendarsystemethiopian.cpp:20 62008 #: kcalendarsystemethiopian.cpp:204 2009 2009 #, fuzzy 2010 2010 #| msgctxt "Ethiopian month 3 - LongName" … … 2021 2021 2022 2022 #. +> trunk 2023 #: kcalendarsystemethiopian.cpp:20 82023 #: kcalendarsystemethiopian.cpp:206 2024 2024 #, fuzzy 2025 2025 #| msgctxt "Ethiopian month 4 - LongName" … … 2036 2036 2037 2037 #. +> trunk 2038 #: kcalendarsystemethiopian.cpp:2 102038 #: kcalendarsystemethiopian.cpp:208 2039 2039 #, fuzzy 2040 2040 #| msgctxt "Ethiopian month 5 - ShortName" … … 2051 2051 2052 2052 #. +> trunk 2053 #: kcalendarsystemethiopian.cpp:21 22053 #: kcalendarsystemethiopian.cpp:210 2054 2054 #, fuzzy 2055 2055 #| msgctxt "Ethiopian month 6 - LongName" … … 2066 2066 2067 2067 #. +> trunk 2068 #: kcalendarsystemethiopian.cpp:21 42068 #: kcalendarsystemethiopian.cpp:212 2069 2069 #, fuzzy 2070 2070 #| msgctxt "Ethiopian month 7 - LongName" … … 2081 2081 2082 2082 #. +> trunk 2083 #: kcalendarsystemethiopian.cpp:21 62083 #: kcalendarsystemethiopian.cpp:214 2084 2084 #, fuzzy 2085 2085 #| msgctxt "Ethiopian month 8 - LongName" … … 2096 2096 2097 2097 #. +> trunk 2098 #: kcalendarsystemethiopian.cpp:21 82098 #: kcalendarsystemethiopian.cpp:216 2099 2099 #, fuzzy 2100 2100 #| msgctxt "Ethiopian month 9 - LongName" … … 2111 2111 2112 2112 #. +> trunk 2113 #: kcalendarsystemethiopian.cpp:2 202113 #: kcalendarsystemethiopian.cpp:218 2114 2114 #, fuzzy 2115 2115 #| msgctxt "Ethiopian month 10 - LongName" … … 2126 2126 2127 2127 #. +> trunk 2128 #: kcalendarsystemethiopian.cpp:22 22128 #: kcalendarsystemethiopian.cpp:220 2129 2129 #, fuzzy 2130 2130 #| msgctxt "Ethiopian month 11 - LongName" … … 2141 2141 2142 2142 #. +> trunk 2143 #: kcalendarsystemethiopian.cpp:22 42143 #: kcalendarsystemethiopian.cpp:222 2144 2144 #, fuzzy 2145 2145 #| msgctxt "Ethiopian month 12 - LongName" … … 2156 2156 2157 2157 #. +> trunk 2158 #: kcalendarsystemethiopian.cpp:22 62158 #: kcalendarsystemethiopian.cpp:224 2159 2159 #, fuzzy 2160 2160 #| msgctxt "Ethiopian month 13 - LongName" … … 2171 2171 2172 2172 #. +> trunk 2173 #: kcalendarsystemethiopian.cpp:23 82173 #: kcalendarsystemethiopian.cpp:236 2174 2174 #, fuzzy 2175 2175 msgctxt "Ethiopian weekday 1 - KLocale::NarrowName " … … 2178 2178 2179 2179 #. +> trunk 2180 #: kcalendarsystemethiopian.cpp:2 402180 #: kcalendarsystemethiopian.cpp:238 2181 2181 #, fuzzy 2182 2182 msgctxt "Ethiopian weekday 2 - KLocale::NarrowName " … … 2185 2185 2186 2186 #. +> trunk 2187 #: kcalendarsystemethiopian.cpp:24 22187 #: kcalendarsystemethiopian.cpp:240 2188 2188 #, fuzzy 2189 2189 msgctxt "Ethiopian weekday 3 - KLocale::NarrowName " … … 2192 2192 2193 2193 #. +> trunk 2194 #: kcalendarsystemethiopian.cpp:24 42194 #: kcalendarsystemethiopian.cpp:242 2195 2195 #, fuzzy 2196 2196 msgctxt "Ethiopian weekday 4 - KLocale::NarrowName " … … 2199 2199 2200 2200 #. +> trunk 2201 #: kcalendarsystemethiopian.cpp:24 62201 #: kcalendarsystemethiopian.cpp:244 2202 2202 #, fuzzy 2203 2203 msgctxt "Ethiopian weekday 5 - KLocale::NarrowName " … … 2206 2206 2207 2207 #. +> trunk 2208 #: kcalendarsystemethiopian.cpp:24 82208 #: kcalendarsystemethiopian.cpp:246 2209 2209 #, fuzzy 2210 2210 msgctxt "Ethiopian weekday 6 - KLocale::NarrowName " … … 2213 2213 2214 2214 #. +> trunk 2215 #: kcalendarsystemethiopian.cpp:2 502215 #: kcalendarsystemethiopian.cpp:248 2216 2216 #, fuzzy 2217 2217 msgctxt "Ethiopian weekday 7 - KLocale::NarrowName " … … 2220 2220 2221 2221 #. +> trunk 2222 #: kcalendarsystemethiopian.cpp:25 92222 #: kcalendarsystemethiopian.cpp:257 2223 2223 #, fuzzy 2224 2224 #| msgctxt "Ethiopian weekday 1 - ShortDayName" … … 2235 2235 2236 2236 #. +> trunk 2237 #: kcalendarsystemethiopian.cpp:2 612237 #: kcalendarsystemethiopian.cpp:259 2238 2238 #, fuzzy 2239 2239 #| msgctxt "Ethiopian weekday 2 - ShortDayName" … … 2250 2250 2251 2251 #. +> trunk 2252 #: kcalendarsystemethiopian.cpp:26 32252 #: kcalendarsystemethiopian.cpp:261 2253 2253 #, fuzzy 2254 2254 #| msgctxt "Ethiopian weekday 3 - ShortDayName" … … 2265 2265 2266 2266 #. +> trunk 2267 #: kcalendarsystemethiopian.cpp:26 52267 #: kcalendarsystemethiopian.cpp:263 2268 2268 #, fuzzy 2269 2269 msgctxt "Ethiopian weekday 4 - KLocale::ShortName" … … 2278 2278 2279 2279 #. +> trunk 2280 #: kcalendarsystemethiopian.cpp:26 72280 #: kcalendarsystemethiopian.cpp:265 2281 2281 #, fuzzy 2282 2282 #| msgid "Arb" … … 2292 2292 2293 2293 #. +> trunk 2294 #: kcalendarsystemethiopian.cpp:26 92294 #: kcalendarsystemethiopian.cpp:267 2295 2295 #, fuzzy 2296 2296 #| msgctxt "Ethiopian weekday 6 - ShortDayName" … … 2307 2307 2308 2308 #. +> trunk 2309 #: kcalendarsystemethiopian.cpp:2 712309 #: kcalendarsystemethiopian.cpp:269 2310 2310 #, fuzzy 2311 2311 #| msgctxt "Ethiopian weekday 7 - ShortDayName" … … 2322 2322 2323 2323 #. +> trunk 2324 #: kcalendarsystemethiopian.cpp:27 82324 #: kcalendarsystemethiopian.cpp:276 2325 2325 #, fuzzy 2326 2326 #| msgctxt "Ethiopian weekday 1 - LongDayName" … … 2337 2337 2338 2338 #. +> trunk 2339 #: kcalendarsystemethiopian.cpp:2 802339 #: kcalendarsystemethiopian.cpp:278 2340 2340 #, fuzzy 2341 2341 #| msgctxt "Ethiopian weekday 2 - LongDayName" … … 2352 2352 2353 2353 #. +> trunk 2354 #: kcalendarsystemethiopian.cpp:28 22354 #: kcalendarsystemethiopian.cpp:280 2355 2355 #, fuzzy 2356 2356 #| msgctxt "Ethiopian weekday 3 - ShortDayName" … … 2367 2367 2368 2368 #. +> trunk 2369 #: kcalendarsystemethiopian.cpp:28 42369 #: kcalendarsystemethiopian.cpp:282 2370 2370 #, fuzzy 2371 2371 #| msgctxt "Ethiopian weekday 4 - LongDayName" … … 2382 2382 2383 2383 #. +> trunk 2384 #: kcalendarsystemethiopian.cpp:28 62384 #: kcalendarsystemethiopian.cpp:284 2385 2385 #, fuzzy 2386 2386 #| msgid "Arb" … … 2396 2396 2397 2397 #. +> trunk 2398 #: kcalendarsystemethiopian.cpp:28 82398 #: kcalendarsystemethiopian.cpp:286 2399 2399 #, fuzzy 2400 2400 #| msgctxt "Ethiopian weekday 6 - LongDayName" … … 2411 2411 2412 2412 #. +> trunk 2413 #: kcalendarsystemethiopian.cpp:2 902413 #: kcalendarsystemethiopian.cpp:288 2414 2414 #, fuzzy 2415 2415 #| msgctxt "Ethiopian weekday 7 - LongDayName" … … 2426 2426 2427 2427 #. +> trunk stable 2428 #: kcalendarsystemgregorian.cpp: 90 kcalendarsystemgregorianproleptic.cpp:602428 #: kcalendarsystemgregorian.cpp:60 kcalendarsystemqdate.cpp:90 2429 2429 msgctxt "Calendar Era: Gregorian Common Era, years < 0, LongFormat" 2430 2430 msgid "Before Common Era" … … 2432 2432 2433 2433 #. +> trunk stable 2434 #: kcalendarsystemgregorian.cpp: 91 kcalendarsystemgregorianproleptic.cpp:612434 #: kcalendarsystemgregorian.cpp:61 kcalendarsystemqdate.cpp:91 2435 2435 msgctxt "Calendar Era: Gregorian Common Era, years < 0, ShortFormat" 2436 2436 msgid "BCE" … … 2438 2438 2439 2439 #. +> trunk stable 2440 #: kcalendarsystemgregorian.cpp: 93 kcalendarsystemgregorianproleptic.cpp:632440 #: kcalendarsystemgregorian.cpp:63 kcalendarsystemqdate.cpp:93 2441 2441 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, LongFormat" 2442 2442 msgid "Before Christ" … … 2444 2444 2445 2445 #. +> trunk stable 2446 #: kcalendarsystemgregorian.cpp: 94 kcalendarsystemgregorianproleptic.cpp:642446 #: kcalendarsystemgregorian.cpp:64 kcalendarsystemqdate.cpp:94 2447 2447 msgctxt "Calendar Era: Gregorian Christian Era, years < 0, ShortFormat" 2448 2448 msgid "BC" … … 2450 2450 2451 2451 #. +> trunk stable 2452 #: kcalendarsystemgregorian.cpp: 96 kcalendarsystemgregorianproleptic.cpp:662452 #: kcalendarsystemgregorian.cpp:66 kcalendarsystemqdate.cpp:96 2453 2453 #, c-format 2454 2454 msgctxt "(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC" … … 2457 2457 2458 2458 #. +> trunk stable 2459 #: kcalendarsystemgregorian.cpp: 100 kcalendarsystemgregorianproleptic.cpp:702459 #: kcalendarsystemgregorian.cpp:70 kcalendarsystemqdate.cpp:100 2460 2460 msgctxt "Calendar Era: Gregorian Common Era, years > 0, LongFormat" 2461 2461 msgid "Common Era" … … 2463 2463 2464 2464 #. +> trunk stable 2465 #: kcalendarsystemgregorian.cpp: 101 kcalendarsystemgregorianproleptic.cpp:712465 #: kcalendarsystemgregorian.cpp:71 kcalendarsystemqdate.cpp:101 2466 2466 msgctxt "Calendar Era: Gregorian Common Era, years > 0, ShortFormat" 2467 2467 msgid "CE" … … 2469 2469 2470 2470 #. +> trunk stable 2471 #: kcalendarsystemgregorian.cpp: 103 kcalendarsystemgregorianproleptic.cpp:732472 #: kcalendarsystem japanese.cpp:632471 #: kcalendarsystemgregorian.cpp:73 kcalendarsystemjapanese.cpp:63 2472 #: kcalendarsystemqdate.cpp:103 2473 2473 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, LongFormat" 2474 2474 msgid "Anno Domini" … … 2476 2476 2477 2477 #. +> trunk stable 2478 #: kcalendarsystemgregorian.cpp: 104 kcalendarsystemgregorianproleptic.cpp:742479 #: kcalendarsystem japanese.cpp:642478 #: kcalendarsystemgregorian.cpp:74 kcalendarsystemjapanese.cpp:64 2479 #: kcalendarsystemqdate.cpp:104 2480 2480 msgctxt "Calendar Era: Gregorian Christian Era, years > 0, ShortFormat" 2481 2481 msgid "AD" … … 2483 2483 2484 2484 #. +> trunk stable 2485 #: kcalendarsystemgregorian.cpp: 106 kcalendarsystemgregorianproleptic.cpp:762486 #: kcalendarsystem japanese.cpp:652485 #: kcalendarsystemgregorian.cpp:76 kcalendarsystemjapanese.cpp:65 2486 #: kcalendarsystemqdate.cpp:106 2487 2487 #, c-format 2488 2488 msgctxt "(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD" … … 2491 2491 2492 2492 #. +> trunk 2493 #: kcalendarsystemgregorian.cpp:17 5 kcalendarsystemgregorianproleptic.cpp:1712493 #: kcalendarsystemgregorian.cpp:171 kcalendarsystemqdate.cpp:175 2494 2494 #, fuzzy 2495 2495 msgctxt "Gregorian month 1 - KLocale::NarrowName" … … 2498 2498 2499 2499 #. +> trunk 2500 #: kcalendarsystemgregorian.cpp:17 7 kcalendarsystemgregorianproleptic.cpp:1732500 #: kcalendarsystemgregorian.cpp:173 kcalendarsystemqdate.cpp:177 2501 2501 #, fuzzy 2502 2502 msgctxt "Gregorian month 2 - KLocale::NarrowName" … … 2505 2505 2506 2506 #. +> trunk 2507 #: kcalendarsystemgregorian.cpp:17 9 kcalendarsystemgregorianproleptic.cpp:1752507 #: kcalendarsystemgregorian.cpp:175 kcalendarsystemqdate.cpp:179 2508 2508 #, fuzzy 2509 2509 msgctxt "Gregorian month 3 - KLocale::NarrowName" … … 2512 2512 2513 2513 #. +> trunk 2514 #: kcalendarsystemgregorian.cpp:1 81 kcalendarsystemgregorianproleptic.cpp:1772514 #: kcalendarsystemgregorian.cpp:177 kcalendarsystemqdate.cpp:181 2515 2515 #, fuzzy 2516 2516 msgctxt "Gregorian month 4 - KLocale::NarrowName" … … 2519 2519 2520 2520 #. +> trunk 2521 #: kcalendarsystemgregorian.cpp:1 83 kcalendarsystemgregorianproleptic.cpp:1792521 #: kcalendarsystemgregorian.cpp:179 kcalendarsystemqdate.cpp:183 2522 2522 #, fuzzy 2523 2523 msgctxt "Gregorian month 5 - KLocale::NarrowName" … … 2526 2526 2527 2527 #. +> trunk 2528 #: kcalendarsystemgregorian.cpp:18 5 kcalendarsystemgregorianproleptic.cpp:1812528 #: kcalendarsystemgregorian.cpp:181 kcalendarsystemqdate.cpp:185 2529 2529 #, fuzzy 2530 2530 msgctxt "Gregorian month 6 - KLocale::NarrowName" … … 2533 2533 2534 2534 #. +> trunk 2535 #: kcalendarsystemgregorian.cpp:18 7 kcalendarsystemgregorianproleptic.cpp:1832535 #: kcalendarsystemgregorian.cpp:183 kcalendarsystemqdate.cpp:187 2536 2536 #, fuzzy 2537 2537 msgctxt "Gregorian month 7 - KLocale::NarrowName" … … 2540 2540 2541 2541 #. +> trunk 2542 #: kcalendarsystemgregorian.cpp:18 9 kcalendarsystemgregorianproleptic.cpp:1852542 #: kcalendarsystemgregorian.cpp:185 kcalendarsystemqdate.cpp:189 2543 2543 #, fuzzy 2544 2544 msgctxt "Gregorian month 8 - KLocale::NarrowName" … … 2547 2547 2548 2548 #. +> trunk 2549 #: kcalendarsystemgregorian.cpp:1 91 kcalendarsystemgregorianproleptic.cpp:1872549 #: kcalendarsystemgregorian.cpp:187 kcalendarsystemqdate.cpp:191 2550 2550 #, fuzzy 2551 2551 msgctxt "Gregorian month 9 - KLocale::NarrowName" … … 2554 2554 2555 2555 #. +> trunk 2556 #: kcalendarsystemgregorian.cpp:1 93 kcalendarsystemgregorianproleptic.cpp:1892556 #: kcalendarsystemgregorian.cpp:189 kcalendarsystemqdate.cpp:193 2557 2557 #, fuzzy 2558 2558 msgctxt "Gregorian month 10 - KLocale::NarrowName" … … 2561 2561 2562 2562 #. +> trunk 2563 #: kcalendarsystemgregorian.cpp:19 5 kcalendarsystemgregorianproleptic.cpp:1912563 #: kcalendarsystemgregorian.cpp:191 kcalendarsystemqdate.cpp:195 2564 2564 #, fuzzy 2565 2565 msgctxt "Gregorian month 11 - KLocale::NarrowName" … … 2568 2568 2569 2569 #. +> trunk 2570 #: kcalendarsystemgregorian.cpp:19 7 kcalendarsystemgregorianproleptic.cpp:1932570 #: kcalendarsystemgregorian.cpp:193 kcalendarsystemqdate.cpp:197 2571 2571 #, fuzzy 2572 2572 msgctxt "Gregorian month 12 - KLocale::NarrowName" … … 2575 2575 2576 2576 #. +> trunk 2577 #: kcalendarsystemgregorian.cpp:20 6 kcalendarsystemgregorianproleptic.cpp:2022577 #: kcalendarsystemgregorian.cpp:202 kcalendarsystemqdate.cpp:206 2578 2578 #, fuzzy 2579 2579 #| msgctxt "of January" … … 2591 2591 2592 2592 #. +> trunk 2593 #: kcalendarsystemgregorian.cpp:20 8 kcalendarsystemgregorianproleptic.cpp:2042593 #: kcalendarsystemgregorian.cpp:204 kcalendarsystemqdate.cpp:208 2594 2594 #, fuzzy 2595 2595 #| msgctxt "of February" … … 2607 2607 2608 2608 #. +> trunk 2609 #: kcalendarsystemgregorian.cpp:2 10 kcalendarsystemgregorianproleptic.cpp:2062609 #: kcalendarsystemgregorian.cpp:206 kcalendarsystemqdate.cpp:210 2610 2610 #, fuzzy 2611 2611 #| msgctxt "of March" … … 2623 2623 2624 2624 #. +> trunk 2625 #: kcalendarsystemgregorian.cpp:2 12 kcalendarsystemgregorianproleptic.cpp:2082625 #: kcalendarsystemgregorian.cpp:208 kcalendarsystemqdate.cpp:212 2626 2626 #, fuzzy 2627 2627 #| msgctxt "of April" … … 2639 2639 2640 2640 #. +> trunk 2641 #: kcalendarsystemgregorian.cpp:21 4 kcalendarsystemgregorianproleptic.cpp:2102641 #: kcalendarsystemgregorian.cpp:210 kcalendarsystemqdate.cpp:214 2642 2642 #, fuzzy 2643 2643 #| msgctxt "of May short" … … 2648 2648 2649 2649 #. +> trunk 2650 #: kcalendarsystemgregorian.cpp:21 6 kcalendarsystemgregorianproleptic.cpp:2122650 #: kcalendarsystemgregorian.cpp:212 kcalendarsystemqdate.cpp:216 2651 2651 #, fuzzy 2652 2652 #| msgctxt "of June" … … 2664 2664 2665 2665 #. +> trunk 2666 #: kcalendarsystemgregorian.cpp:21 8 kcalendarsystemgregorianproleptic.cpp:2142666 #: kcalendarsystemgregorian.cpp:214 kcalendarsystemqdate.cpp:218 2667 2667 #, fuzzy 2668 2668 #| msgctxt "of July" … … 2680 2680 2681 2681 #. +> trunk 2682 #: kcalendarsystemgregorian.cpp:2 20 kcalendarsystemgregorianproleptic.cpp:2162682 #: kcalendarsystemgregorian.cpp:216 kcalendarsystemqdate.cpp:220 2683 2683 #, fuzzy 2684 2684 #| msgctxt "of August" … … 2696 2696 2697 2697 #. +> trunk 2698 #: kcalendarsystemgregorian.cpp:2 22 kcalendarsystemgregorianproleptic.cpp:2182698 #: kcalendarsystemgregorian.cpp:218 kcalendarsystemqdate.cpp:222 2699 2699 #, fuzzy 2700 2700 #| msgctxt "of September" … … 2712 2712 2713 2713 #. +> trunk 2714 #: kcalendarsystemgregorian.cpp:22 4 kcalendarsystemgregorianproleptic.cpp:2202714 #: kcalendarsystemgregorian.cpp:220 kcalendarsystemqdate.cpp:224 2715 2715 #, fuzzy 2716 2716 #| msgctxt "of October" … … 2728 2728 2729 2729 #. +> trunk 2730 #: kcalendarsystemgregorian.cpp:22 6 kcalendarsystemgregorianproleptic.cpp:2222730 #: kcalendarsystemgregorian.cpp:222 kcalendarsystemqdate.cpp:226 2731 2731 #, fuzzy 2732 2732 #| msgctxt "of November" … … 2744 2744 2745 2745 #. +> trunk 2746 #: kcalendarsystemgregorian.cpp:22 8 kcalendarsystemgregorianproleptic.cpp:2242746 #: kcalendarsystemgregorian.cpp:224 kcalendarsystemqdate.cpp:228 2747 2747 #, fuzzy 2748 2748 #| msgctxt "of December" … … 2760 2760 2761 2761 #. +> trunk 2762 #: kcalendarsystemgregorian.cpp:23 7 kcalendarsystemgregorianproleptic.cpp:2332762 #: kcalendarsystemgregorian.cpp:233 kcalendarsystemqdate.cpp:237 2763 2763 #, fuzzy 2764 2764 msgctxt "Gregorian month 1 - KLocale::ShortName" … … 2774 2774 2775 2775 #. +> trunk 2776 #: kcalendarsystemgregorian.cpp:23 9 kcalendarsystemgregorianproleptic.cpp:2352776 #: kcalendarsystemgregorian.cpp:235 kcalendarsystemqdate.cpp:239 2777 2777 #, fuzzy 2778 2778 msgctxt "Gregorian month 2 - KLocale::ShortName" … … 2788 2788 2789 2789 #. +> trunk 2790 #: kcalendarsystemgregorian.cpp:2 41 kcalendarsystemgregorianproleptic.cpp:2372790 #: kcalendarsystemgregorian.cpp:237 kcalendarsystemqdate.cpp:241 2791 2791 #, fuzzy 2792 2792 msgctxt "Gregorian month 3 - KLocale::ShortName" … … 2802 2802 2803 2803 #. +> trunk 2804 #: kcalendarsystemgregorian.cpp:2 43 kcalendarsystemgregorianproleptic.cpp:2392804 #: kcalendarsystemgregorian.cpp:239 kcalendarsystemqdate.cpp:243 2805 2805 #, fuzzy 2806 2806 msgctxt "Gregorian month 4 - KLocale::ShortName" … … 2816 2816 2817 2817 #. +> trunk 2818 #: kcalendarsystemgregorian.cpp:24 5 kcalendarsystemgregorianproleptic.cpp:2412818 #: kcalendarsystemgregorian.cpp:241 kcalendarsystemqdate.cpp:245 2819 2819 #, fuzzy 2820 2820 msgctxt "Gregorian month 5 - KLocale::ShortName" … … 2823 2823 2824 2824 #. +> trunk 2825 #: kcalendarsystemgregorian.cpp:24 7 kcalendarsystemgregorianproleptic.cpp:2432825 #: kcalendarsystemgregorian.cpp:243 kcalendarsystemqdate.cpp:247 2826 2826 #, fuzzy 2827 2827 msgctxt "Gregorian month 6 - KLocale::ShortName" … … 2837 2837 2838 2838 #. +> trunk 2839 #: kcalendarsystemgregorian.cpp:24 9 kcalendarsystemgregorianproleptic.cpp:2452839 #: kcalendarsystemgregorian.cpp:245 kcalendarsystemqdate.cpp:249 2840 2840 #, fuzzy 2841 2841 msgctxt "Gregorian month 7 - KLocale::ShortName" … … 2851 2851 2852 2852 #. +> trunk 2853 #: kcalendarsystemgregorian.cpp:2 51 kcalendarsystemgregorianproleptic.cpp:2472853 #: kcalendarsystemgregorian.cpp:247 kcalendarsystemqdate.cpp:251 2854 2854 #, fuzzy 2855 2855 msgctxt "Gregorian month 8 - KLocale::ShortName" … … 2865 2865 2866 2866 #. +> trunk 2867 #: kcalendarsystemgregorian.cpp:2 53 kcalendarsystemgregorianproleptic.cpp:2492867 #: kcalendarsystemgregorian.cpp:249 kcalendarsystemqdate.cpp:253 2868 2868 #, fuzzy 2869 2869 msgctxt "Gregorian month 9 - KLocale::ShortName" … … 2879 2879 2880 2880 #. +> trunk 2881 #: kcalendarsystemgregorian.cpp:25 5 kcalendarsystemgregorianproleptic.cpp:2512881 #: kcalendarsystemgregorian.cpp:251 kcalendarsystemqdate.cpp:255 2882 2882 #, fuzzy 2883 2883 msgctxt "Gregorian month 10 - KLocale::ShortName" … … 2893 2893 2894 2894 #. +> trunk 2895 #: kcalendarsystemgregorian.cpp:25 7 kcalendarsystemgregorianproleptic.cpp:2532895 #: kcalendarsystemgregorian.cpp:253 kcalendarsystemqdate.cpp:257 2896 2896 #, fuzzy 2897 2897 msgctxt "Gregorian month 11 - KLocale::ShortName" … … 2907 2907 2908 2908 #. +> trunk 2909 #: kcalendarsystemgregorian.cpp:25 9 kcalendarsystemgregorianproleptic.cpp:2552909 #: kcalendarsystemgregorian.cpp:255 kcalendarsystemqdate.cpp:259 2910 2910 #, fuzzy 2911 2911 msgctxt "Gregorian month 12 - KLocale::ShortName" … … 2921 2921 2922 2922 #. +> trunk 2923 #: kcalendarsystemgregorian.cpp:26 8 kcalendarsystemgregorianproleptic.cpp:2642923 #: kcalendarsystemgregorian.cpp:264 kcalendarsystemqdate.cpp:268 2924 2924 #, fuzzy 2925 2925 #| msgid "of January" … … 2935 2935 2936 2936 #. +> trunk 2937 #: kcalendarsystemgregorian.cpp:2 70 kcalendarsystemgregorianproleptic.cpp:2662937 #: kcalendarsystemgregorian.cpp:266 kcalendarsystemqdate.cpp:270 2938 2938 #, fuzzy 2939 2939 #| msgid "of February" … … 2949 2949 2950 2950 #. +> trunk 2951 #: kcalendarsystemgregorian.cpp:2 72 kcalendarsystemgregorianproleptic.cpp:2682951 #: kcalendarsystemgregorian.cpp:268 kcalendarsystemqdate.cpp:272 2952 2952 #, fuzzy 2953 2953 #| msgid "of March" … … 2963 2963 2964 2964 #. +> trunk 2965 #: kcalendarsystemgregorian.cpp:27 4 kcalendarsystemgregorianproleptic.cpp:2702965 #: kcalendarsystemgregorian.cpp:270 kcalendarsystemqdate.cpp:274 2966 2966 #, fuzzy 2967 2967 #| msgid "of April" … … 2977 2977 2978 2978 #. +> trunk 2979 #: kcalendarsystemgregorian.cpp:27 6 kcalendarsystemgregorianproleptic.cpp:2722979 #: kcalendarsystemgregorian.cpp:272 kcalendarsystemqdate.cpp:276 2980 2980 #, fuzzy 2981 2981 #| msgctxt "of May short" … … 3000 3000 3001 3001 #. +> trunk 3002 #: kcalendarsystemgregorian.cpp:27 8 kcalendarsystemgregorianproleptic.cpp:2743002 #: kcalendarsystemgregorian.cpp:274 kcalendarsystemqdate.cpp:278 3003 3003 #, fuzzy 3004 3004 #| msgid "of June" … … 3014 3014 3015 3015 #. +> trunk 3016 #: kcalendarsystemgregorian.cpp:2 80 kcalendarsystemgregorianproleptic.cpp:2763016 #: kcalendarsystemgregorian.cpp:276 kcalendarsystemqdate.cpp:280 3017 3017 #, fuzzy 3018 3018 #| msgid "of July" … … 3028 3028 3029 3029 #. +> trunk 3030 #: kcalendarsystemgregorian.cpp:2 82 kcalendarsystemgregorianproleptic.cpp:2783030 #: kcalendarsystemgregorian.cpp:278 kcalendarsystemqdate.cpp:282 3031 3031 #, fuzzy 3032 3032 #| msgid "of August" … … 3042 3042 3043 3043 #. +> trunk 3044 #: kcalendarsystemgregorian.cpp:28 4 kcalendarsystemgregorianproleptic.cpp:2803044 #: kcalendarsystemgregorian.cpp:280 kcalendarsystemqdate.cpp:284 3045 3045 #, fuzzy 3046 3046 #| msgid "of September" … … 3056 3056 3057 3057 #. +> trunk 3058 #: kcalendarsystemgregorian.cpp:28 6 kcalendarsystemgregorianproleptic.cpp:2823058 #: kcalendarsystemgregorian.cpp:282 kcalendarsystemqdate.cpp:286 3059 3059 #, fuzzy 3060 3060 #| msgid "of October" … … 3070 3070 3071 3071 #. +> trunk 3072 #: kcalendarsystemgregorian.cpp:28 8 kcalendarsystemgregorianproleptic.cpp:2843072 #: kcalendarsystemgregorian.cpp:284 kcalendarsystemqdate.cpp:288 3073 3073 #, fuzzy 3074 3074 #| msgid "of November" … … 3084 3084 3085 3085 #. +> trunk 3086 #: kcalendarsystemgregorian.cpp:2 90 kcalendarsystemgregorianproleptic.cpp:2863086 #: kcalendarsystemgregorian.cpp:286 kcalendarsystemqdate.cpp:290 3087 3087 #, fuzzy 3088 3088 #| msgid "of December" … … 3098 3098 3099 3099 #. +> trunk 3100 #: kcalendarsystemgregorian.cpp:29 9 kcalendarsystemgregorianproleptic.cpp:2953100 #: kcalendarsystemgregorian.cpp:295 kcalendarsystemqdate.cpp:299 3101 3101 #, fuzzy 3102 3102 #| msgid "January" … … 3112 3112 3113 3113 #. +> trunk 3114 #: kcalendarsystemgregorian.cpp: 301 kcalendarsystemgregorianproleptic.cpp:2973114 #: kcalendarsystemgregorian.cpp:297 kcalendarsystemqdate.cpp:301 3115 3115 #, fuzzy 3116 3116 #| msgid "February" … … 3126 3126 3127 3127 #. +> trunk 3128 #: kcalendarsystemgregorian.cpp: 303 kcalendarsystemgregorianproleptic.cpp:2993128 #: kcalendarsystemgregorian.cpp:299 kcalendarsystemqdate.cpp:303 3129 3129 #, fuzzy 3130 3130 msgctxt "Gregorian month 3 - KLocale::LongName" … … 3140 3140 3141 3141 #. +> trunk 3142 #: kcalendarsystemgregorian.cpp:30 5 kcalendarsystemgregorianproleptic.cpp:3013142 #: kcalendarsystemgregorian.cpp:301 kcalendarsystemqdate.cpp:305 3143 3143 #, fuzzy 3144 3144 #| msgid "April" … … 3154 3154 3155 3155 #. +> trunk 3156 #: kcalendarsystemgregorian.cpp:30 7 kcalendarsystemgregorianproleptic.cpp:3033156 #: kcalendarsystemgregorian.cpp:303 kcalendarsystemqdate.cpp:307 3157 3157 #, fuzzy 3158 3158 msgctxt "Gregorian month 5 - KLocale::LongName" … … 3175 3175 3176 3176 #. +> trunk 3177 #: kcalendarsystemgregorian.cpp:30 9 kcalendarsystemgregorianproleptic.cpp:3053177 #: kcalendarsystemgregorian.cpp:305 kcalendarsystemqdate.cpp:309 3178 3178 #, fuzzy 3179 3179 #| msgid "June" … … 3189 3189 3190 3190 #. +> trunk 3191 #: kcalendarsystemgregorian.cpp:3 11 kcalendarsystemgregorianproleptic.cpp:3073191 #: kcalendarsystemgregorian.cpp:307 kcalendarsystemqdate.cpp:311 3192 3192 #, fuzzy 3193 3193 #| msgid "July" … … 3203 3203 3204 3204 #. +> trunk 3205 #: kcalendarsystemgregorian.cpp:3 13 kcalendarsystemgregorianproleptic.cpp:3093205 #: kcalendarsystemgregorian.cpp:309 kcalendarsystemqdate.cpp:313 3206 3206 #, fuzzy 3207 3207 msgctxt "Gregorian month 8 - KLocale::LongName" … … 3217 3217 3218 3218 #. +> trunk 3219 #: kcalendarsystemgregorian.cpp:31 5 kcalendarsystemgregorianproleptic.cpp:3113219 #: kcalendarsystemgregorian.cpp:311 kcalendarsystemqdate.cpp:315 3220 3220 #, fuzzy 3221 3221 #| msgid "September" … … 3231 3231 3232 3232 #. +> trunk 3233 #: kcalendarsystemgregorian.cpp:31 7 kcalendarsystemgregorianproleptic.cpp:3133233 #: kcalendarsystemgregorian.cpp:313 kcalendarsystemqdate.cpp:317 3234 3234 #, fuzzy 3235 3235 #| msgid "October" … … 3245 3245 3246 3246 #. +> trunk 3247 #: kcalendarsystemgregorian.cpp:31 9 kcalendarsystemgregorianproleptic.cpp:3153247 #: kcalendarsystemgregorian.cpp:315 kcalendarsystemqdate.cpp:319 3248 3248 #, fuzzy 3249 3249 #| msgid "November" … … 3259 3259 3260 3260 #. +> trunk 3261 #: kcalendarsystemgregorian.cpp:3 21 kcalendarsystemgregorianproleptic.cpp:3173261 #: kcalendarsystemgregorian.cpp:317 kcalendarsystemqdate.cpp:321 3262 3262 #, fuzzy 3263 3263 #| msgid "December" … … 3273 3273 3274 3274 #. +> trunk 3275 #: kcalendarsystemgregorian.cpp:3 32 kcalendarsystemgregorianproleptic.cpp:3283276 #: kcalendarsystem hebrew.cpp:8203275 #: kcalendarsystemgregorian.cpp:328 kcalendarsystemhebrew.cpp:820 3276 #: kcalendarsystemqdate.cpp:332 3277 3277 #, fuzzy 3278 3278 msgctxt "Gregorian weekday 1 - KLocale::NarrowName " … … 3281 3281 3282 3282 #. +> trunk 3283 #: kcalendarsystemgregorian.cpp:33 4 kcalendarsystemgregorianproleptic.cpp:3303284 #: kcalendarsystem hebrew.cpp:8223283 #: kcalendarsystemgregorian.cpp:330 kcalendarsystemhebrew.cpp:822 3284 #: kcalendarsystemqdate.cpp:334 3285 3285 #, fuzzy 3286 3286 msgctxt "Gregorian weekday 2 - KLocale::NarrowName " … … 3289 3289 3290 3290 #. +> trunk 3291 #: kcalendarsystemgregorian.cpp:33 6 kcalendarsystemgregorianproleptic.cpp:3323292 #: kcalendarsystem hebrew.cpp:8243291 #: kcalendarsystemgregorian.cpp:332 kcalendarsystemhebrew.cpp:824 3292 #: kcalendarsystemqdate.cpp:336 3293 3293 #, fuzzy 3294 3294 msgctxt "Gregorian weekday 3 - KLocale::NarrowName " … … 3297 3297 3298 3298 #. +> trunk 3299 #: kcalendarsystemgregorian.cpp:33 8 kcalendarsystemgregorianproleptic.cpp:3343300 #: kcalendarsystem hebrew.cpp:8263299 #: kcalendarsystemgregorian.cpp:334 kcalendarsystemhebrew.cpp:826 3300 #: kcalendarsystemqdate.cpp:338 3301 3301 #, fuzzy 3302 3302 msgctxt "Gregorian weekday 4 - KLocale::NarrowName " … … 3305 3305 3306 3306 #. +> trunk 3307 #: kcalendarsystemgregorian.cpp:3 40 kcalendarsystemgregorianproleptic.cpp:3363308 #: kcalendarsystem hebrew.cpp:8283307 #: kcalendarsystemgregorian.cpp:336 kcalendarsystemhebrew.cpp:828 3308 #: kcalendarsystemqdate.cpp:340 3309 3309 #, fuzzy 3310 3310 msgctxt "Gregorian weekday 5 - KLocale::NarrowName " … … 3313 3313 3314 3314 #. +> trunk 3315 #: kcalendarsystemgregorian.cpp:3 42 kcalendarsystemgregorianproleptic.cpp:3383316 #: kcalendarsystem hebrew.cpp:8303315 #: kcalendarsystemgregorian.cpp:338 kcalendarsystemhebrew.cpp:830 3316 #: kcalendarsystemqdate.cpp:342 3317 3317 #, fuzzy 3318 3318 msgctxt "Gregorian weekday 6 - KLocale::NarrowName " … … 3321 3321 3322 3322 #. +> trunk 3323 #: kcalendarsystemgregorian.cpp:34 4 kcalendarsystemgregorianproleptic.cpp:3403324 #: kcalendarsystem hebrew.cpp:8323323 #: kcalendarsystemgregorian.cpp:340 kcalendarsystemhebrew.cpp:832 3324 #: kcalendarsystemqdate.cpp:344 3325 3325 #, fuzzy 3326 3326 msgctxt "Gregorian weekday 7 - KLocale::NarrowName " … … 3329 3329 3330 3330 #. +> trunk 3331 #: kcalendarsystemgregorian.cpp:3 53 kcalendarsystemgregorianproleptic.cpp:3493332 #: kcalendarsystem hebrew.cpp:8413331 #: kcalendarsystemgregorian.cpp:349 kcalendarsystemhebrew.cpp:841 3332 #: kcalendarsystemqdate.cpp:353 3333 3333 #, fuzzy 3334 3334 msgctxt "Gregorian weekday 1 - KLocale::ShortName" … … 3344 3344 3345 3345 #. +> trunk 3346 #: kcalendarsystemgregorian.cpp:35 5 kcalendarsystemgregorianproleptic.cpp:3513347 #: kcalendarsystem hebrew.cpp:8433346 #: kcalendarsystemgregorian.cpp:351 kcalendarsystemhebrew.cpp:843 3347 #: kcalendarsystemqdate.cpp:355 3348 3348 #, fuzzy 3349 3349 msgctxt "Gregorian weekday 2 - KLocale::ShortName" … … 3359 3359 3360 3360 #. +> trunk 3361 #: kcalendarsystemgregorian.cpp:35 7 kcalendarsystemgregorianproleptic.cpp:3533362 #: kcalendarsystem hebrew.cpp:8453361 #: kcalendarsystemgregorian.cpp:353 kcalendarsystemhebrew.cpp:845 3362 #: kcalendarsystemqdate.cpp:357 3363 3363 #, fuzzy 3364 3364 msgctxt "Gregorian weekday 3 - KLocale::ShortName" … … 3374 3374 3375 3375 #. +> trunk 3376 #: kcalendarsystemgregorian.cpp:35 9 kcalendarsystemgregorianproleptic.cpp:3553377 #: kcalendarsystem hebrew.cpp:8473376 #: kcalendarsystemgregorian.cpp:355 kcalendarsystemhebrew.cpp:847 3377 #: kcalendarsystemqdate.cpp:359 3378 3378 #, fuzzy 3379 3379 msgctxt "Gregorian weekday 4 - KLocale::ShortName" … … 3389 3389 3390 3390 #. +> trunk 3391 #: kcalendarsystemgregorian.cpp:3 61 kcalendarsystemgregorianproleptic.cpp:3573392 #: kcalendarsystem hebrew.cpp:8493391 #: kcalendarsystemgregorian.cpp:357 kcalendarsystemhebrew.cpp:849 3392 #: kcalendarsystemqdate.cpp:361 3393 3393 #, fuzzy 3394 3394 msgctxt "Gregorian weekday 5 - KLocale::ShortName" … … 3404 3404 3405 3405 #. +> trunk 3406 #: kcalendarsystemgregorian.cpp:3 63 kcalendarsystemgregorianproleptic.cpp:3593407 #: kcalendarsystem hebrew.cpp:8513406 #: kcalendarsystemgregorian.cpp:359 kcalendarsystemhebrew.cpp:851 3407 #: kcalendarsystemqdate.cpp:363 3408 3408 #, fuzzy 3409 3409 msgctxt "Gregorian weekday 6 - KLocale::ShortName" … … 3419 3419 3420 3420 #. +> trunk 3421 #: kcalendarsystemgregorian.cpp:36 5 kcalendarsystemgregorianproleptic.cpp:3613422 #: kcalendarsystem hebrew.cpp:8533421 #: kcalendarsystemgregorian.cpp:361 kcalendarsystemhebrew.cpp:853 3422 #: kcalendarsystemqdate.cpp:365 3423 3423 #, fuzzy 3424 3424 msgctxt "Gregorian weekday 7 - KLocale::ShortName" … … 3434 3434 3435 3435 #. +> trunk 3436 #: kcalendarsystemgregorian.cpp:3 72 kcalendarsystemgregorianproleptic.cpp:3683437 #: kcalendarsystem hebrew.cpp:8603436 #: kcalendarsystemgregorian.cpp:368 kcalendarsystemhebrew.cpp:860 3437 #: kcalendarsystemqdate.cpp:372 3438 3438 #, fuzzy 3439 3439 #| msgid "Monday" … … 3449 3449 3450 3450 #. +> trunk 3451 #: kcalendarsystemgregorian.cpp:37 4 kcalendarsystemgregorianproleptic.cpp:3703452 #: kcalendarsystem hebrew.cpp:8623451 #: kcalendarsystemgregorian.cpp:370 kcalendarsystemhebrew.cpp:862 3452 #: kcalendarsystemqdate.cpp:374 3453 3453 #, fuzzy 3454 3454 #| msgid "Tuesday" … … 3464 3464 3465 3465 #. +> trunk 3466 #: kcalendarsystemgregorian.cpp:37 6 kcalendarsystemgregorianproleptic.cpp:3723467 #: kcalendarsystem hebrew.cpp:8643466 #: kcalendarsystemgregorian.cpp:372 kcalendarsystemhebrew.cpp:864 3467 #: kcalendarsystemqdate.cpp:376 3468 3468 #, fuzzy 3469 3469 #| msgid "Wednesday" … … 3479 3479 3480 3480 #. +> trunk 3481 #: kcalendarsystemgregorian.cpp:37 8 kcalendarsystemgregorianproleptic.cpp:3743482 #: kcalendarsystem hebrew.cpp:8663481 #: kcalendarsystemgregorian.cpp:374 kcalendarsystemhebrew.cpp:866 3482 #: kcalendarsystemqdate.cpp:378 3483 3483 #, fuzzy 3484 3484 #| msgid "Thursday" … … 3494 3494 3495 3495 #. +> trunk 3496 #: kcalendarsystemgregorian.cpp:3 80 kcalendarsystemgregorianproleptic.cpp:3763497 #: kcalendarsystem hebrew.cpp:8683496 #: kcalendarsystemgregorian.cpp:376 kcalendarsystemhebrew.cpp:868 3497 #: kcalendarsystemqdate.cpp:380 3498 3498 #, fuzzy 3499 3499 #| msgid "Friday" … … 3509 3509 3510 3510 #. +> trunk 3511 #: kcalendarsystemgregorian.cpp:3 82 kcalendarsystemgregorianproleptic.cpp:3783512 #: kcalendarsystem hebrew.cpp:8703511 #: kcalendarsystemgregorian.cpp:378 kcalendarsystemhebrew.cpp:870 3512 #: kcalendarsystemqdate.cpp:382 3513 3513 #, fuzzy 3514 3514 #| msgid "Saturday" … … 3524 3524 3525 3525 #. +> trunk 3526 #: kcalendarsystemgregorian.cpp:38 4 kcalendarsystemgregorianproleptic.cpp:3803527 #: kcalendarsystem hebrew.cpp:8723526 #: kcalendarsystemgregorian.cpp:380 kcalendarsystemhebrew.cpp:872 3527 #: kcalendarsystemqdate.cpp:384 3528 3528 #, fuzzy 3529 3529 #| msgid "Sunday" … … 4242 4242 4243 4243 #. +> trunk stable 4244 #: kcalendarsystemhijri.cpp:724245 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, LongFormat"4246 msgid "Anno Hegirae"4247 msgstr "Anno Hegirae"4248 4249 #. +> trunk stable4250 #: kcalendarsystemhijri.cpp:734251 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat"4252 msgid "AH"4253 msgstr "AH"4254 4255 #. +> trunk stable4256 #: kcalendarsystemhijri.cpp:744257 #, c-format4258 msgctxt "(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH"4259 msgid "%Ey %EC"4260 msgstr "%Ey %EC"4261 4262 #. +> trunk4263 #: kcalendarsystemhijri.cpp:1804264 #, fuzzy4265 msgctxt "Hijri month 1 - KLocale::NarrowName"4266 msgid "M"4267 msgstr "AM"4268 4269 #. +> trunk4270 #: kcalendarsystemhijri.cpp:1824271 #, fuzzy4272 msgctxt "Hijri month 2 - KLocale::NarrowName"4273 msgid "S"4274 msgstr "S"4275 4276 #. +> trunk4277 #: kcalendarsystemhijri.cpp:1844278 #, fuzzy4279 msgctxt "Hijri month 3 - KLocale::NarrowName"4280 msgid "A"4281 msgstr "A"4282 4283 #. +> trunk4284 #: kcalendarsystemhijri.cpp:1864285 #, fuzzy4286 msgctxt "Hijri month 4 - KLocale::NarrowName"4287 msgid "T"4288 msgstr "TGA"4289 4290 #. +> trunk4291 #: kcalendarsystemhijri.cpp:1884292 #, fuzzy4293 msgctxt "Hijri month 5 - KLocale::NarrowName"4294 msgid "A"4295 msgstr "A"4296 4297 #. +> trunk4298 #: kcalendarsystemhijri.cpp:1904299 #, fuzzy4300 msgctxt "Hijri month 6 - KLocale::NarrowName"4301 msgid "T"4302 msgstr "TGA"4303 4304 #. +> trunk4305 #: kcalendarsystemhijri.cpp:1924306 #, fuzzy4307 msgctxt "Hijri month 7 - KLocale::NarrowName"4308 msgid "R"4309 msgstr "R"4310 4311 #. +> trunk4312 #: kcalendarsystemhijri.cpp:1944313 #, fuzzy4314 msgctxt "Hijri month 8 - KLocale::NarrowName"4315 msgid "S"4316 msgstr "S"4317 4318 #. +> trunk4319 #: kcalendarsystemhijri.cpp:1964320 #, fuzzy4321 msgctxt "Hijri month 9 - KLocale::NarrowName"4322 msgid "R"4323 msgstr "R"4324 4325 #. +> trunk4326 #: kcalendarsystemhijri.cpp:1984327 #, fuzzy4328 msgctxt "Hijri month 10 - KLocale::NarrowName"4329 msgid "S"4330 msgstr "S"4331 4332 #. +> trunk4333 #: kcalendarsystemhijri.cpp:2004334 #, fuzzy4335 msgctxt "Hijri month 11 - KLocale::NarrowName"4336 msgid "Q"4337 msgstr "Kv"4338 4339 #. +> trunk4340 #: kcalendarsystemhijri.cpp:2024341 #, fuzzy4342 msgctxt "Hijri month 12 - KLocale::NarrowName"4343 msgid "H"4344 msgstr "H:"4345 4346 #. +> trunk4347 #: kcalendarsystemhijri.cpp:2114348 #, fuzzy4349 #| msgctxt "of Mehr short"4350 #| msgid "of Meh"4351 msgctxt "Hijri month 1 - KLocale::ShortName Possessive"4352 msgid "of Muh"4353 msgstr "od Meh"4354 4355 #. +> trunk4356 #: kcalendarsystemhijri.cpp:2134357 #, fuzzy4358 #| msgid "of Safar"4359 msgctxt "Hijri month 2 - KLocale::ShortName Possessive"4360 msgid "of Saf"4361 msgstr "od Safara"4362 4363 #. +> trunk4364 #: kcalendarsystemhijri.cpp:2154365 #, fuzzy4366 #| msgid "of R. Awal"4367 msgctxt "Hijri month 3 - KLocale::ShortName Possessive"4368 msgid "of R.A"4369 msgstr "od R. Awala"4370 4371 #. +> trunk4372 #: kcalendarsystemhijri.cpp:2174373 #, fuzzy4374 #| msgid "of R. Thaani"4375 msgctxt "Hijri month 4 - KLocale::ShortName Possessive"4376 msgid "of R.T"4377 msgstr "od R. Thaania"4378 4379 #. +> trunk4380 #: kcalendarsystemhijri.cpp:2194381 #, fuzzy4382 #| msgid "of J. Awal"4383 msgctxt "Hijri month 5 - KLocale::ShortName Possessive"4384 msgid "of J.A"4385 msgstr "od J. Awala"4386 4387 #. +> trunk4388 #: kcalendarsystemhijri.cpp:2214389 #, fuzzy4390 #| msgid "of J. Thaani"4391 msgctxt "Hijri month 6 - KLocale::ShortName Possessive"4392 msgid "of J.T"4393 msgstr "od J. Thaania"4394 4395 #. +> trunk4396 #: kcalendarsystemhijri.cpp:2234397 #, fuzzy4398 #| msgid "of Rajab"4399 msgctxt "Hijri month 7 - KLocale::ShortName Possessive"4400 msgid "of Raj"4401 msgstr "od Rajaba"4402 4403 #. +> trunk4404 #: kcalendarsystemhijri.cpp:2254405 #, fuzzy4406 #| msgctxt "of Shahrivar short"4407 #| msgid "of Sha"4408 msgctxt "Hijri month 8 - KLocale::ShortName Possessive"4409 msgid "of Sha"4410 msgstr "od Sha"4411 4412 #. +> trunk4413 #: kcalendarsystemhijri.cpp:2274414 #, fuzzy4415 #| msgctxt "Coptic month 8 - ShortNamePossessive"4416 #| msgid "of Pam"4417 msgctxt "Hijri month 9 - KLocale::ShortName Possessive"4418 msgid "of Ram"4419 msgstr "od Pam"4420 4421 #. +> trunk4422 #: kcalendarsystemhijri.cpp:2294423 #, fuzzy4424 #| msgctxt "Indian National month 5 - ShortNamePossessive"4425 #| msgid "of Shr"4426 msgctxt "Hijri month 10 - KLocale::ShortName Possessive"4427 msgid "of Shw"4428 msgstr "od Shr"4429 4430 #. +> trunk4431 #: kcalendarsystemhijri.cpp:2314432 #, fuzzy4433 #| msgid "of Qi`dah"4434 msgctxt "Hijri month 11 - KLocale::ShortName Possessive"4435 msgid "of Qid"4436 msgstr "od Qi`daha"4437 4438 #. +> trunk4439 #: kcalendarsystemhijri.cpp:2334440 #, fuzzy4441 #| msgid "of Hijjah"4442 msgctxt "Hijri month 12 - KLocale::ShortName Possessive"4443 msgid "of Hij"4444 msgstr "od Hijjaha"4445 4446 #. +> trunk4447 #: kcalendarsystemhijri.cpp:2424448 #, fuzzy4449 #| msgctxt "City name (optional, probably does not need a translation)"4450 #| msgid "Muncy"4451 msgctxt "Hijri month 1 - KLocale::ShortName"4452 msgid "Muh"4453 msgstr "Muncy"4454 4455 #. +> trunk4456 #: kcalendarsystemhijri.cpp:2444457 #, fuzzy4458 #| msgid "Safar"4459 msgctxt "Hijri month 2 - KLocale::ShortName"4460 msgid "Saf"4461 msgstr "Safar"4462 4463 #. +> trunk4464 #: kcalendarsystemhijri.cpp:2464465 #, fuzzy4466 msgctxt "Hijri month 3 - KLocale::ShortName"4467 msgid "R.A"4468 msgstr "DU"4469 4470 #. +> trunk4471 #: kcalendarsystemhijri.cpp:2484472 #, fuzzy4473 msgctxt "Hijri month 4 - KLocale::ShortName"4474 msgid "R.T"4475 msgstr "RT"4476 4477 #. +> trunk4478 #: kcalendarsystemhijri.cpp:2504479 #, fuzzy4480 msgctxt "Hijri month 5 - KLocale::ShortName"4481 msgid "J.A"4482 msgstr "MlaÄi"4483 4484 #. +> trunk4485 #: kcalendarsystemhijri.cpp:2524486 #, fuzzy4487 msgctxt "Hijri month 6 - KLocale::ShortName"4488 msgid "J.T"4489 msgstr "MlaÄi"4490 4491 #. +> trunk4492 #: kcalendarsystemhijri.cpp:2544493 #, fuzzy4494 #| msgid "Rajab"4495 msgctxt "Hijri month 7 - KLocale::ShortName"4496 msgid "Raj"4497 msgstr "Rajab"4498 4499 #. +> trunk4500 #: kcalendarsystemhijri.cpp:2564501 #, fuzzy4502 #| msgctxt "Shahrivar short"4503 #| msgid "Sha"4504 msgctxt "Hijri month 8 - KLocale::ShortName"4505 msgid "Sha"4506 msgstr "Sha"4507 4508 #. +> trunk4509 #: kcalendarsystemhijri.cpp:2584510 #, fuzzy4511 msgctxt "Hijri month 9 - KLocale::ShortName"4512 msgid "Ram"4513 msgstr "Rampa"4514 4515 #. +> trunk4516 #: kcalendarsystemhijri.cpp:2604517 #, fuzzy4518 msgctxt "Hijri month 10 - KLocale::ShortName"4519 msgid "Shw"4520 msgstr "PrikaÅŸi"4521 4522 #. +> trunk4523 #: kcalendarsystemhijri.cpp:2624524 #, fuzzy4525 #| msgid "Qi`dah"4526 msgctxt "Hijri month 11 - KLocale::ShortName"4527 msgid "Qid"4528 msgstr "Qi`dah"4529 4530 #. +> trunk4531 #: kcalendarsystemhijri.cpp:2644532 #, fuzzy4533 #| msgctxt "@item Calendar system"4534 #| msgid "Hijri"4535 msgctxt "Hijri month 12 - KLocale::ShortName"4536 msgid "Hij"4537 msgstr "Hijri"4538 4539 #. +> trunk4540 #: kcalendarsystemhijri.cpp:2734541 #, fuzzy4542 #| msgid "of Muharram"4543 msgctxt "Hijri month 1 - KLocale::LongName Possessive"4544 msgid "of Muharram"4545 msgstr "od Muharrama"4546 4547 #. +> stable4548 #: kcalendarsystemhijri.cpp:335 kcalendarsystemhijri.cpp:3664549 msgid "of Muharram"4550 msgstr "od Muharrama"4551 4552 #. +> trunk4553 #: kcalendarsystemhijri.cpp:2754554 #, fuzzy4555 #| msgid "of Safar"4556 msgctxt "Hijri month 2 - KLocale::LongName Possessive"4557 msgid "of Safar"4558 msgstr "od Safara"4559 4560 #. +> stable4561 #: kcalendarsystemhijri.cpp:337 kcalendarsystemhijri.cpp:3684562 msgid "of Safar"4563 msgstr "od Safara"4564 4565 #. +> trunk4566 #: kcalendarsystemhijri.cpp:2774567 #, fuzzy4568 #| msgid "of Rabi` al-Awal"4569 msgctxt "Hijri month 3 - KLocale::LongName Possessive"4570 msgid "of Rabi` al-Awal"4571 msgstr "od Rabi` al-Awala"4572 4573 #. +> stable4574 #: kcalendarsystemhijri.cpp:3704575 msgid "of Rabi` al-Awal"4576 msgstr "od Rabi` al-Awala"4577 4578 #. +> trunk4579 #: kcalendarsystemhijri.cpp:2794580 #, fuzzy4581 #| msgid "of Rabi` al-Thaani"4582 msgctxt "Hijri month 4 - KLocale::LongName Possessive"4583 msgid "of Rabi` al-Thaani"4584 msgstr "od Rabi` al-Thaania"4585 4586 #. +> stable4587 #: kcalendarsystemhijri.cpp:3724588 msgid "of Rabi` al-Thaani"4589 msgstr "od Rabi` al-Thaania"4590 4591 #. +> trunk4592 #: kcalendarsystemhijri.cpp:2814593 #, fuzzy4594 #| msgid "of Jumaada al-Awal"4595 msgctxt "Hijri month 5 - KLocale::LongName Possessive"4596 msgid "of Jumaada al-Awal"4597 msgstr "od Jumaada al-Awala"4598 4599 #. +> stable4600 #: kcalendarsystemhijri.cpp:3744601 msgid "of Jumaada al-Awal"4602 msgstr "od Jumaada al-Awala"4603 4604 #. +> trunk4605 #: kcalendarsystemhijri.cpp:2834606 #, fuzzy4607 #| msgid "of Jumaada al-Thaani"4608 msgctxt "Hijri month 6 - KLocale::LongName Possessive"4609 msgid "of Jumaada al-Thaani"4610 msgstr "od Jumaada al-Thaania"4611 4612 #. +> stable4613 #: kcalendarsystemhijri.cpp:3764614 msgid "of Jumaada al-Thaani"4615 msgstr "od Jumaada al-Thaania"4616 4617 #. +> trunk4618 #: kcalendarsystemhijri.cpp:2854619 #, fuzzy4620 #| msgid "of Rajab"4621 msgctxt "Hijri month 7 - KLocale::LongName Possessive"4622 msgid "of Rajab"4623 msgstr "od Rajaba"4624 4625 #. +> stable4626 #: kcalendarsystemhijri.cpp:347 kcalendarsystemhijri.cpp:3784627 msgid "of Rajab"4628 msgstr "od Rajaba"4629 4630 #. +> trunk4631 #: kcalendarsystemhijri.cpp:2874632 #, fuzzy4633 #| msgid "of Sha`ban"4634 msgctxt "Hijri month 8 - KLocale::LongName Possessive"4635 msgid "of Sha`ban"4636 msgstr "od Sha`bana"4637 4638 #. +> stable4639 #: kcalendarsystemhijri.cpp:349 kcalendarsystemhijri.cpp:3804640 msgid "of Sha`ban"4641 msgstr "od Sha`bana"4642 4643 #. +> trunk4644 #: kcalendarsystemhijri.cpp:2894645 #, fuzzy4646 #| msgid "of Ramadan"4647 msgctxt "Hijri month 9 - KLocale::LongName Possessive"4648 msgid "of Ramadan"4649 msgstr "od Ramadana"4650 4651 #. +> stable4652 #: kcalendarsystemhijri.cpp:351 kcalendarsystemhijri.cpp:3824653 msgid "of Ramadan"4654 msgstr "od Ramadana"4655 4656 #. +> trunk4657 #: kcalendarsystemhijri.cpp:2914658 #, fuzzy4659 #| msgid "of Shawwal"4660 msgctxt "Hijri month 10 - KLocale::LongName Possessive"4661 msgid "of Shawwal"4662 msgstr "od Shawwala"4663 4664 #. +> stable4665 #: kcalendarsystemhijri.cpp:353 kcalendarsystemhijri.cpp:3844666 msgid "of Shawwal"4667 msgstr "od Shawwala"4668 4669 #. +> trunk4670 #: kcalendarsystemhijri.cpp:2934671 #, fuzzy4672 #| msgid "of Thu al-Qi`dah"4673 msgctxt "Hijri month 11 - KLocale::LongName Possessive"4674 msgid "of Thu al-Qi`dah"4675 msgstr "od Thu al-Qi`daha"4676 4677 #. +> stable4678 #: kcalendarsystemhijri.cpp:3864679 msgid "of Thu al-Qi`dah"4680 msgstr "od Thu al-Qi`daha"4681 4682 #. +> trunk4683 #: kcalendarsystemhijri.cpp:2954684 #, fuzzy4685 #| msgid "of Thu al-Hijjah"4686 msgctxt "Hijri month 12 - KLocale::LongName Possessive"4687 msgid "of Thu al-Hijjah"4688 msgstr "od Thu al-Hijjaha"4689 4690 #. +> stable4691 #: kcalendarsystemhijri.cpp:3884692 msgid "of Thu al-Hijjah"4693 msgstr "od Thu al-Hijjaha"4694 4695 #. +> trunk4696 #: kcalendarsystemhijri.cpp:3044697 #, fuzzy4698 #| msgid "Muharram"4699 msgctxt "Hijri month 1 - KLocale::LongName"4700 msgid "Muharram"4701 msgstr "Muharram"4702 4703 #. +> stable4704 #: kcalendarsystemhijri.cpp:397 kcalendarsystemhijri.cpp:4284705 msgid "Muharram"4706 msgstr "Muharram"4707 4708 #. +> trunk4709 #: kcalendarsystemhijri.cpp:3064710 #, fuzzy4711 #| msgid "Safar"4712 msgctxt "Hijri month 2 - KLocale::LongName"4713 msgid "Safar"4714 msgstr "Safar"4715 4716 #. +> stable4717 #: kcalendarsystemhijri.cpp:399 kcalendarsystemhijri.cpp:4304718 msgid "Safar"4719 msgstr "Safar"4720 4721 #. +> trunk4722 #: kcalendarsystemhijri.cpp:3084723 #, fuzzy4724 #| msgid "Rabi` al-Awal"4725 msgctxt "Hijri month 3 - KLocale::LongName"4726 msgid "Rabi` al-Awal"4727 msgstr "Rabi` al-Awal"4728 4729 #. +> stable4730 #: kcalendarsystemhijri.cpp:4324731 msgid "Rabi` al-Awal"4732 msgstr "Rabi` al-Awal"4733 4734 #. +> trunk4735 #: kcalendarsystemhijri.cpp:3104736 #, fuzzy4737 #| msgid "Rabi` al-Thaani"4738 msgctxt "Hijri month 4 - KLocale::LongName"4739 msgid "Rabi` al-Thaani"4740 msgstr "Rabi` al-Thaani"4741 4742 #. +> stable4743 #: kcalendarsystemhijri.cpp:4344744 msgid "Rabi` al-Thaani"4745 msgstr "Rabi` al-Thaani"4746 4747 #. +> trunk4748 #: kcalendarsystemhijri.cpp:3124749 #, fuzzy4750 #| msgid "Jumaada al-Awal"4751 msgctxt "Hijri month 5 - KLocale::LongName"4752 msgid "Jumaada al-Awal"4753 msgstr "Jumaada al-Awal"4754 4755 #. +> stable4756 #: kcalendarsystemhijri.cpp:4364757 msgid "Jumaada al-Awal"4758 msgstr "Jumaada al-Awal"4759 4760 #. +> trunk4761 #: kcalendarsystemhijri.cpp:3144762 #, fuzzy4763 #| msgid "Jumaada al-Thaani"4764 msgctxt "Hijri month 6 - KLocale::LongName"4765 msgid "Jumaada al-Thaani"4766 msgstr "Jumaada al-Thaani"4767 4768 #. +> stable4769 #: kcalendarsystemhijri.cpp:4384770 msgid "Jumaada al-Thaani"4771 msgstr "Jumaada al-Thaani"4772 4773 #. +> trunk4774 #: kcalendarsystemhijri.cpp:3164775 #, fuzzy4776 #| msgid "Rajab"4777 msgctxt "Hijri month 7 - KLocale::LongName"4778 msgid "Rajab"4779 msgstr "Rajab"4780 4781 #. +> stable4782 #: kcalendarsystemhijri.cpp:409 kcalendarsystemhijri.cpp:4404783 msgid "Rajab"4784 msgstr "Rajab"4785 4786 #. +> trunk4787 #: kcalendarsystemhijri.cpp:3184788 #, fuzzy4789 #| msgid "Sha`ban"4790 msgctxt "Hijri month 8 - KLocale::LongName"4791 msgid "Sha`ban"4792 msgstr "Sha`ban"4793 4794 #. +> stable4795 #: kcalendarsystemhijri.cpp:411 kcalendarsystemhijri.cpp:4424796 msgid "Sha`ban"4797 msgstr "Sha`ban"4798 4799 #. +> trunk4800 #: kcalendarsystemhijri.cpp:3204801 #, fuzzy4802 #| msgid "Ramadan"4803 msgctxt "Hijri month 9 - KLocale::LongName"4804 msgid "Ramadan"4805 msgstr "Ramadan"4806 4807 #. +> stable4808 #: kcalendarsystemhijri.cpp:413 kcalendarsystemhijri.cpp:4444809 msgid "Ramadan"4810 msgstr "Ramadan"4811 4812 #. +> trunk4813 #: kcalendarsystemhijri.cpp:3224814 #, fuzzy4815 #| msgid "Shawwal"4816 msgctxt "Hijri month 10 - KLocale::LongName"4817 msgid "Shawwal"4818 msgstr "Sha`ban"4819 4820 #. +> stable4821 #: kcalendarsystemhijri.cpp:415 kcalendarsystemhijri.cpp:4464822 msgid "Shawwal"4823 msgstr "Sha`ban"4824 4825 #. +> trunk4826 #: kcalendarsystemhijri.cpp:3244827 #, fuzzy4828 #| msgid "Thu al-Qi`dah"4829 msgctxt "Hijri month 11 - KLocale::LongName"4830 msgid "Thu al-Qi`dah"4831 msgstr "Thu al-Qi`dah"4832 4833 #. +> stable4834 #: kcalendarsystemhijri.cpp:4484835 msgid "Thu al-Qi`dah"4836 msgstr "Thu al-Qi`dah"4837 4838 #. +> trunk4839 #: kcalendarsystemhijri.cpp:3264840 #, fuzzy4841 #| msgid "Thu al-Hijjah"4842 msgctxt "Hijri month 12 - KLocale::LongName"4843 msgid "Thu al-Hijjah"4844 msgstr "Thu al-Hijjah"4845 4846 #. +> stable4847 #: kcalendarsystemhijri.cpp:4504848 msgid "Thu al-Hijjah"4849 msgstr "Thu al-Hijjah"4850 4851 #. +> trunk4852 #: kcalendarsystemhijri.cpp:3374853 #, fuzzy4854 msgctxt "Hijri weekday 1 - KLocale::NarrowName "4855 msgid "I"4856 msgstr "I"4857 4858 #. +> trunk4859 #: kcalendarsystemhijri.cpp:3394860 #, fuzzy4861 msgctxt "Hijri weekday 2 - KLocale::NarrowName "4862 msgid "T"4863 msgstr "TGA"4864 4865 #. +> stable4866 #: kcalendarsystemhijri.cpp:3394867 msgid "of R. Awal"4868 msgstr "od R. Awala"4869 4870 #. +> trunk4871 #: kcalendarsystemhijri.cpp:3414872 #, fuzzy4873 msgctxt "Hijri weekday 3 - KLocale::NarrowName "4874 msgid "A"4875 msgstr "A"4876 4877 #. +> stable4878 #: kcalendarsystemhijri.cpp:3414879 msgid "of R. Thaani"4880 msgstr "od R. Thaania"4881 4882 #. +> trunk4883 #: kcalendarsystemhijri.cpp:3434884 #, fuzzy4885 msgctxt "Hijri weekday 4 - KLocale::NarrowName "4886 msgid "K"4887 msgstr "K"4888 4889 #. +> stable4890 #: kcalendarsystemhijri.cpp:3434891 msgid "of J. Awal"4892 msgstr "od J. Awala"4893 4894 #. +> trunk4895 #: kcalendarsystemhijri.cpp:3454896 #, fuzzy4897 msgctxt "Hijri weekday 5 - KLocale::NarrowName "4898 msgid "J"4899 msgstr "J"4900 4901 #. +> stable4902 #: kcalendarsystemhijri.cpp:3454903 msgid "of J. Thaani"4904 msgstr "od J. Thaania"4905 4906 #. +> trunk4907 #: kcalendarsystemhijri.cpp:3474908 #, fuzzy4909 msgctxt "Hijri weekday 6 - KLocale::NarrowName "4910 msgid "S"4911 msgstr "S"4912 4913 #. +> trunk4914 #: kcalendarsystemhijri.cpp:3494915 #, fuzzy4916 msgctxt "Hijri weekday 7 - KLocale::NarrowName "4917 msgid "A"4918 msgstr "A"4919 4920 #. +> stable4921 #: kcalendarsystemhijri.cpp:3554922 msgid "of Qi`dah"4923 msgstr "od Qi`daha"4924 4925 #. +> stable4926 #: kcalendarsystemhijri.cpp:3574927 msgid "of Hijjah"4928 msgstr "od Hijjaha"4929 4930 #. +> trunk4931 #: kcalendarsystemhijri.cpp:3584932 #, fuzzy4933 #| msgid "Ith"4934 msgctxt "Hijri weekday 1 - KLocale::ShortName"4935 msgid "Ith"4936 msgstr "Ith"4937 4938 #. +> stable4939 #: kcalendarsystemhijri.cpp:4664940 msgid "Ith"4941 msgstr "Ith"4942 4943 #. +> trunk4944 #: kcalendarsystemhijri.cpp:3604945 #, fuzzy4946 #| msgid "Thl"4947 msgctxt "Hijri weekday 2 - KLocale::ShortName"4948 msgid "Thl"4949 msgstr "Thl"4950 4951 #. +> stable4952 #: kcalendarsystemhijri.cpp:4684953 msgid "Thl"4954 msgstr "Thl"4955 4956 #. +> trunk4957 #: kcalendarsystemhijri.cpp:3624958 #, fuzzy4959 #| msgid "Arb"4960 msgctxt "Hijri weekday 3 - KLocale::ShortName"4961 msgid "Arb"4962 msgstr "Arb"4963 4964 #. +> stable4965 #: kcalendarsystemhijri.cpp:4704966 msgid "Arb"4967 msgstr "Arb"4968 4969 #. +> trunk4970 #: kcalendarsystemhijri.cpp:3644971 #, fuzzy4972 #| msgid "Kha"4973 msgctxt "Hijri weekday 4 - KLocale::ShortName"4974 msgid "Kha"4975 msgstr "Kha"4976 4977 #. +> stable4978 #: kcalendarsystemhijri.cpp:4724979 msgid "Kha"4980 msgstr "Kha"4981 4982 #. +> trunk4983 #: kcalendarsystemhijri.cpp:3664984 #, fuzzy4985 #| msgid "Jum"4986 msgctxt "Hijri weekday 5 - KLocale::ShortName"4987 msgid "Jum"4988 msgstr "Jum"4989 4990 #. +> stable4991 #: kcalendarsystemhijri.cpp:4744992 msgid "Jum"4993 msgstr "Jum"4994 4995 #. +> trunk4996 #: kcalendarsystemhijri.cpp:3684997 #, fuzzy4998 #| msgid "Sab"4999 msgctxt "Hijri weekday 6 - KLocale::ShortName"5000 msgid "Sab"5001 msgstr "Sab"5002 5003 #. +> stable5004 #: kcalendarsystemhijri.cpp:4765005 msgid "Sab"5006 msgstr "Sab"5007 5008 #. +> trunk5009 #: kcalendarsystemhijri.cpp:3705010 #, fuzzy5011 #| msgid "Ahd"5012 msgctxt "Hijri weekday 7 - KLocale::ShortName"5013 msgid "Ahd"5014 msgstr "Ahd"5015 5016 #. +> stable5017 #: kcalendarsystemhijri.cpp:4785018 msgid "Ahd"5019 msgstr "Ahd"5020 5021 #. +> trunk5022 #: kcalendarsystemhijri.cpp:3775023 #, fuzzy5024 #| msgid "Yaum al-Ithnain"5025 msgctxt "Hijri weekday 1 - KLocale::LongName"5026 msgid "Yaum al-Ithnain"5027 msgstr "Yaum al-Ithnain"5028 5029 #. +> stable5030 #: kcalendarsystemhijri.cpp:4875031 msgid "Yaum al-Ithnain"5032 msgstr "Yaum al-Ithnain"5033 5034 #. +> trunk5035 #: kcalendarsystemhijri.cpp:3795036 #, fuzzy5037 #| msgid "Yau al-Thulatha"5038 msgctxt "Hijri weekday 2 - KLocale::LongName"5039 msgid "Yau al-Thulatha"5040 msgstr "Yau al-Thulatha"5041 5042 #. +> stable5043 #: kcalendarsystemhijri.cpp:4895044 msgid "Yau al-Thulatha"5045 msgstr "Yau al-Thulatha"5046 5047 #. +> trunk5048 #: kcalendarsystemhijri.cpp:3815049 #, fuzzy5050 #| msgid "Yaum al-Arbi'a"5051 msgctxt "Hijri weekday 3 - KLocale::LongName"5052 msgid "Yaum al-Arbi'a"5053 msgstr "Yaum al-Arbi'a"5054 5055 #. +> stable5056 #: kcalendarsystemhijri.cpp:4915057 msgid "Yaum al-Arbi'a"5058 msgstr "Yaum al-Arbi'a"5059 5060 #. +> trunk5061 #: kcalendarsystemhijri.cpp:3835062 #, fuzzy5063 #| msgid "Yaum al-Khamees"5064 msgctxt "Hijri weekday 4 - KLocale::LongName"5065 msgid "Yaum al-Khamees"5066 msgstr "Yaum al-Khamees"5067 5068 #. +> stable5069 #: kcalendarsystemhijri.cpp:4935070 msgid "Yaum al-Khamees"5071 msgstr "Yaum al-Khamees"5072 5073 #. +> trunk5074 #: kcalendarsystemhijri.cpp:3855075 #, fuzzy5076 #| msgid "Yaum al-Jumma"5077 msgctxt "Hijri weekday 5 - KLocale::LongName"5078 msgid "Yaum al-Jumma"5079 msgstr "Yaum al-Jumma"5080 5081 #. +> stable5082 #: kcalendarsystemhijri.cpp:4955083 msgid "Yaum al-Jumma"5084 msgstr "Yaum al-Jumma"5085 5086 #. +> trunk5087 #: kcalendarsystemhijri.cpp:3875088 #, fuzzy5089 #| msgid "Yaum al-Sabt"5090 msgctxt "Hijri weekday 6 - KLocale::LongName"5091 msgid "Yaum al-Sabt"5092 msgstr "Yaum al-Sabt"5093 5094 #. +> stable5095 #: kcalendarsystemhijri.cpp:4975096 msgid "Yaum al-Sabt"5097 msgstr "Yaum al-Sabt"5098 5099 #. +> trunk5100 #: kcalendarsystemhijri.cpp:3895101 #, fuzzy5102 #| msgid "Yaum al-Ahad"5103 msgctxt "Hijri weekday 7 - KLocale::LongName"5104 msgid "Yaum al-Ahad"5105 msgstr "Yaum al-Ahad"5106 5107 #. +> stable5108 #: kcalendarsystemhijri.cpp:4015109 msgid "R. Awal"5110 msgstr "R. Awal"5111 5112 #. +> stable5113 #: kcalendarsystemhijri.cpp:4035114 msgid "R. Thaani"5115 msgstr "R. Thaani"5116 5117 #. +> stable5118 #: kcalendarsystemhijri.cpp:4055119 msgid "J. Awal"5120 msgstr "J. Awal"5121 5122 #. +> stable5123 #: kcalendarsystemhijri.cpp:4075124 msgid "J. Thaani"5125 msgstr "J. Thaani"5126 5127 #. +> stable5128 #: kcalendarsystemhijri.cpp:4175129 msgid "Qi`dah"5130 msgstr "Qi`dah"5131 5132 #. +> stable5133 #: kcalendarsystemhijri.cpp:4195134 msgid "Hijjah"5135 msgstr "Hijjah"5136 5137 #. +> stable5138 #: kcalendarsystemhijri.cpp:4995139 msgid "Yaum al-Ahad"5140 msgstr "Yaum al-Ahad"5141 5142 #. +> trunk stable5143 4244 #: kcalendarsystemindiannational.cpp:74 5144 4245 msgctxt "Calendar Era: Indian National Saka Era, years > 0, LongFormat" … … 6227 5328 6228 5329 #. +> trunk stable 5330 #: kcalendarsystemislamiccivil.cpp:72 5331 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, LongFormat" 5332 msgid "Anno Hegirae" 5333 msgstr "Anno Hegirae" 5334 5335 #. +> trunk stable 5336 #: kcalendarsystemislamiccivil.cpp:73 5337 msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat" 5338 msgid "AH" 5339 msgstr "AH" 5340 5341 #. +> trunk stable 5342 #: kcalendarsystemislamiccivil.cpp:74 5343 #, c-format 5344 msgctxt "(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH" 5345 msgid "%Ey %EC" 5346 msgstr "%Ey %EC" 5347 5348 #. +> trunk 5349 #: kcalendarsystemislamiccivil.cpp:180 5350 #, fuzzy 5351 msgctxt "Hijri month 1 - KLocale::NarrowName" 5352 msgid "M" 5353 msgstr "AM" 5354 5355 #. +> trunk 5356 #: kcalendarsystemislamiccivil.cpp:182 5357 #, fuzzy 5358 msgctxt "Hijri month 2 - KLocale::NarrowName" 5359 msgid "S" 5360 msgstr "S" 5361 5362 #. +> trunk 5363 #: kcalendarsystemislamiccivil.cpp:184 5364 #, fuzzy 5365 msgctxt "Hijri month 3 - KLocale::NarrowName" 5366 msgid "A" 5367 msgstr "A" 5368 5369 #. +> trunk 5370 #: kcalendarsystemislamiccivil.cpp:186 5371 #, fuzzy 5372 msgctxt "Hijri month 4 - KLocale::NarrowName" 5373 msgid "T" 5374 msgstr "TGA" 5375 5376 #. +> trunk 5377 #: kcalendarsystemislamiccivil.cpp:188 5378 #, fuzzy 5379 msgctxt "Hijri month 5 - KLocale::NarrowName" 5380 msgid "A" 5381 msgstr "A" 5382 5383 #. +> trunk 5384 #: kcalendarsystemislamiccivil.cpp:190 5385 #, fuzzy 5386 msgctxt "Hijri month 6 - KLocale::NarrowName" 5387 msgid "T" 5388 msgstr "TGA" 5389 5390 #. +> trunk 5391 #: kcalendarsystemislamiccivil.cpp:192 5392 #, fuzzy 5393 msgctxt "Hijri month 7 - KLocale::NarrowName" 5394 msgid "R" 5395 msgstr "R" 5396 5397 #. +> trunk 5398 #: kcalendarsystemislamiccivil.cpp:194 5399 #, fuzzy 5400 msgctxt "Hijri month 8 - KLocale::NarrowName" 5401 msgid "S" 5402 msgstr "S" 5403 5404 #. +> trunk 5405 #: kcalendarsystemislamiccivil.cpp:196 5406 #, fuzzy 5407 msgctxt "Hijri month 9 - KLocale::NarrowName" 5408 msgid "R" 5409 msgstr "R" 5410 5411 #. +> trunk 5412 #: kcalendarsystemislamiccivil.cpp:198 5413 #, fuzzy 5414 msgctxt "Hijri month 10 - KLocale::NarrowName" 5415 msgid "S" 5416 msgstr "S" 5417 5418 #. +> trunk 5419 #: kcalendarsystemislamiccivil.cpp:200 5420 #, fuzzy 5421 msgctxt "Hijri month 11 - KLocale::NarrowName" 5422 msgid "Q" 5423 msgstr "Kv" 5424 5425 #. +> trunk 5426 #: kcalendarsystemislamiccivil.cpp:202 5427 #, fuzzy 5428 msgctxt "Hijri month 12 - KLocale::NarrowName" 5429 msgid "H" 5430 msgstr "H:" 5431 5432 #. +> trunk 5433 #: kcalendarsystemislamiccivil.cpp:211 5434 #, fuzzy 5435 #| msgctxt "of Mehr short" 5436 #| msgid "of Meh" 5437 msgctxt "Hijri month 1 - KLocale::ShortName Possessive" 5438 msgid "of Muh" 5439 msgstr "od Meh" 5440 5441 #. +> trunk 5442 #: kcalendarsystemislamiccivil.cpp:213 5443 #, fuzzy 5444 #| msgid "of Safar" 5445 msgctxt "Hijri month 2 - KLocale::ShortName Possessive" 5446 msgid "of Saf" 5447 msgstr "od Safara" 5448 5449 #. +> trunk 5450 #: kcalendarsystemislamiccivil.cpp:215 5451 #, fuzzy 5452 #| msgid "of R. Awal" 5453 msgctxt "Hijri month 3 - KLocale::ShortName Possessive" 5454 msgid "of R.A" 5455 msgstr "od R. Awala" 5456 5457 #. +> trunk 5458 #: kcalendarsystemislamiccivil.cpp:217 5459 #, fuzzy 5460 #| msgid "of R. Thaani" 5461 msgctxt "Hijri month 4 - KLocale::ShortName Possessive" 5462 msgid "of R.T" 5463 msgstr "od R. Thaania" 5464 5465 #. +> trunk 5466 #: kcalendarsystemislamiccivil.cpp:219 5467 #, fuzzy 5468 #| msgid "of J. Awal" 5469 msgctxt "Hijri month 5 - KLocale::ShortName Possessive" 5470 msgid "of J.A" 5471 msgstr "od J. Awala" 5472 5473 #. +> trunk 5474 #: kcalendarsystemislamiccivil.cpp:221 5475 #, fuzzy 5476 #| msgid "of J. Thaani" 5477 msgctxt "Hijri month 6 - KLocale::ShortName Possessive" 5478 msgid "of J.T" 5479 msgstr "od J. Thaania" 5480 5481 #. +> trunk 5482 #: kcalendarsystemislamiccivil.cpp:223 5483 #, fuzzy 5484 #| msgid "of Rajab" 5485 msgctxt "Hijri month 7 - KLocale::ShortName Possessive" 5486 msgid "of Raj" 5487 msgstr "od Rajaba" 5488 5489 #. +> trunk 5490 #: kcalendarsystemislamiccivil.cpp:225 5491 #, fuzzy 5492 #| msgctxt "of Shahrivar short" 5493 #| msgid "of Sha" 5494 msgctxt "Hijri month 8 - KLocale::ShortName Possessive" 5495 msgid "of Sha" 5496 msgstr "od Sha" 5497 5498 #. +> trunk 5499 #: kcalendarsystemislamiccivil.cpp:227 5500 #, fuzzy 5501 #| msgctxt "Coptic month 8 - ShortNamePossessive" 5502 #| msgid "of Pam" 5503 msgctxt "Hijri month 9 - KLocale::ShortName Possessive" 5504 msgid "of Ram" 5505 msgstr "od Pam" 5506 5507 #. +> trunk 5508 #: kcalendarsystemislamiccivil.cpp:229 5509 #, fuzzy 5510 #| msgctxt "Indian National month 5 - ShortNamePossessive" 5511 #| msgid "of Shr" 5512 msgctxt "Hijri month 10 - KLocale::ShortName Possessive" 5513 msgid "of Shw" 5514 msgstr "od Shr" 5515 5516 #. +> trunk 5517 #: kcalendarsystemislamiccivil.cpp:231 5518 #, fuzzy 5519 #| msgid "of Qi`dah" 5520 msgctxt "Hijri month 11 - KLocale::ShortName Possessive" 5521 msgid "of Qid" 5522 msgstr "od Qi`daha" 5523 5524 #. +> trunk 5525 #: kcalendarsystemislamiccivil.cpp:233 5526 #, fuzzy 5527 #| msgid "of Hijjah" 5528 msgctxt "Hijri month 12 - KLocale::ShortName Possessive" 5529 msgid "of Hij" 5530 msgstr "od Hijjaha" 5531 5532 #. +> trunk 5533 #: kcalendarsystemislamiccivil.cpp:242 5534 #, fuzzy 5535 #| msgctxt "City name (optional, probably does not need a translation)" 5536 #| msgid "Muncy" 5537 msgctxt "Hijri month 1 - KLocale::ShortName" 5538 msgid "Muh" 5539 msgstr "Muncy" 5540 5541 #. +> trunk 5542 #: kcalendarsystemislamiccivil.cpp:244 5543 #, fuzzy 5544 #| msgid "Safar" 5545 msgctxt "Hijri month 2 - KLocale::ShortName" 5546 msgid "Saf" 5547 msgstr "Safar" 5548 5549 #. +> trunk 5550 #: kcalendarsystemislamiccivil.cpp:246 5551 #, fuzzy 5552 msgctxt "Hijri month 3 - KLocale::ShortName" 5553 msgid "R.A" 5554 msgstr "DU" 5555 5556 #. +> trunk 5557 #: kcalendarsystemislamiccivil.cpp:248 5558 #, fuzzy 5559 msgctxt "Hijri month 4 - KLocale::ShortName" 5560 msgid "R.T" 5561 msgstr "RT" 5562 5563 #. +> trunk 5564 #: kcalendarsystemislamiccivil.cpp:250 5565 #, fuzzy 5566 msgctxt "Hijri month 5 - KLocale::ShortName" 5567 msgid "J.A" 5568 msgstr "MlaÄi" 5569 5570 #. +> trunk 5571 #: kcalendarsystemislamiccivil.cpp:252 5572 #, fuzzy 5573 msgctxt "Hijri month 6 - KLocale::ShortName" 5574 msgid "J.T" 5575 msgstr "MlaÄi" 5576 5577 #. +> trunk 5578 #: kcalendarsystemislamiccivil.cpp:254 5579 #, fuzzy 5580 #| msgid "Rajab" 5581 msgctxt "Hijri month 7 - KLocale::ShortName" 5582 msgid "Raj" 5583 msgstr "Rajab" 5584 5585 #. +> trunk 5586 #: kcalendarsystemislamiccivil.cpp:256 5587 #, fuzzy 5588 #| msgctxt "Shahrivar short" 5589 #| msgid "Sha" 5590 msgctxt "Hijri month 8 - KLocale::ShortName" 5591 msgid "Sha" 5592 msgstr "Sha" 5593 5594 #. +> trunk 5595 #: kcalendarsystemislamiccivil.cpp:258 5596 #, fuzzy 5597 msgctxt "Hijri month 9 - KLocale::ShortName" 5598 msgid "Ram" 5599 msgstr "Rampa" 5600 5601 #. +> trunk 5602 #: kcalendarsystemislamiccivil.cpp:260 5603 #, fuzzy 5604 msgctxt "Hijri month 10 - KLocale::ShortName" 5605 msgid "Shw" 5606 msgstr "PrikaÅŸi" 5607 5608 #. +> trunk 5609 #: kcalendarsystemislamiccivil.cpp:262 5610 #, fuzzy 5611 #| msgid "Qi`dah" 5612 msgctxt "Hijri month 11 - KLocale::ShortName" 5613 msgid "Qid" 5614 msgstr "Qi`dah" 5615 5616 #. +> trunk 5617 #: kcalendarsystemislamiccivil.cpp:264 5618 #, fuzzy 5619 #| msgctxt "@item Calendar system" 5620 #| msgid "Hijri" 5621 msgctxt "Hijri month 12 - KLocale::ShortName" 5622 msgid "Hij" 5623 msgstr "Hijri" 5624 5625 #. +> trunk 5626 #: kcalendarsystemislamiccivil.cpp:273 5627 #, fuzzy 5628 #| msgid "of Muharram" 5629 msgctxt "Hijri month 1 - KLocale::LongName Possessive" 5630 msgid "of Muharram" 5631 msgstr "od Muharrama" 5632 5633 #. +> stable 5634 #: kcalendarsystemhijri.cpp:335 kcalendarsystemhijri.cpp:366 5635 msgid "of Muharram" 5636 msgstr "od Muharrama" 5637 5638 #. +> trunk 5639 #: kcalendarsystemislamiccivil.cpp:275 5640 #, fuzzy 5641 #| msgid "of Safar" 5642 msgctxt "Hijri month 2 - KLocale::LongName Possessive" 5643 msgid "of Safar" 5644 msgstr "od Safara" 5645 5646 #. +> stable 5647 #: kcalendarsystemhijri.cpp:337 kcalendarsystemhijri.cpp:368 5648 msgid "of Safar" 5649 msgstr "od Safara" 5650 5651 #. +> trunk 5652 #: kcalendarsystemislamiccivil.cpp:277 5653 #, fuzzy 5654 #| msgid "of Rabi` al-Awal" 5655 msgctxt "Hijri month 3 - KLocale::LongName Possessive" 5656 msgid "of Rabi` al-Awal" 5657 msgstr "od Rabi` al-Awala" 5658 5659 #. +> stable 5660 #: kcalendarsystemhijri.cpp:370 5661 msgid "of Rabi` al-Awal" 5662 msgstr "od Rabi` al-Awala" 5663 5664 #. +> trunk 5665 #: kcalendarsystemislamiccivil.cpp:279 5666 #, fuzzy 5667 #| msgid "of Rabi` al-Thaani" 5668 msgctxt "Hijri month 4 - KLocale::LongName Possessive" 5669 msgid "of Rabi` al-Thaani" 5670 msgstr "od Rabi` al-Thaania" 5671 5672 #. +> stable 5673 #: kcalendarsystemhijri.cpp:372 5674 msgid "of Rabi` al-Thaani" 5675 msgstr "od Rabi` al-Thaania" 5676 5677 #. +> trunk 5678 #: kcalendarsystemislamiccivil.cpp:281 5679 #, fuzzy 5680 #| msgid "of Jumaada al-Awal" 5681 msgctxt "Hijri month 5 - KLocale::LongName Possessive" 5682 msgid "of Jumaada al-Awal" 5683 msgstr "od Jumaada al-Awala" 5684 5685 #. +> stable 5686 #: kcalendarsystemhijri.cpp:374 5687 msgid "of Jumaada al-Awal" 5688 msgstr "od Jumaada al-Awala" 5689 5690 #. +> trunk 5691 #: kcalendarsystemislamiccivil.cpp:283 5692 #, fuzzy 5693 #| msgid "of Jumaada al-Thaani" 5694 msgctxt "Hijri month 6 - KLocale::LongName Possessive" 5695 msgid "of Jumaada al-Thaani" 5696 msgstr "od Jumaada al-Thaania" 5697 5698 #. +> stable 5699 #: kcalendarsystemhijri.cpp:376 5700 msgid "of Jumaada al-Thaani" 5701 msgstr "od Jumaada al-Thaania" 5702 5703 #. +> trunk 5704 #: kcalendarsystemislamiccivil.cpp:285 5705 #, fuzzy 5706 #| msgid "of Rajab" 5707 msgctxt "Hijri month 7 - KLocale::LongName Possessive" 5708 msgid "of Rajab" 5709 msgstr "od Rajaba" 5710 5711 #. +> stable 5712 #: kcalendarsystemhijri.cpp:347 kcalendarsystemhijri.cpp:378 5713 msgid "of Rajab" 5714 msgstr "od Rajaba" 5715 5716 #. +> trunk 5717 #: kcalendarsystemislamiccivil.cpp:287 5718 #, fuzzy 5719 #| msgid "of Sha`ban" 5720 msgctxt "Hijri month 8 - KLocale::LongName Possessive" 5721 msgid "of Sha`ban" 5722 msgstr "od Sha`bana" 5723 5724 #. +> stable 5725 #: kcalendarsystemhijri.cpp:349 kcalendarsystemhijri.cpp:380 5726 msgid "of Sha`ban" 5727 msgstr "od Sha`bana" 5728 5729 #. +> trunk 5730 #: kcalendarsystemislamiccivil.cpp:289 5731 #, fuzzy 5732 #| msgid "of Ramadan" 5733 msgctxt "Hijri month 9 - KLocale::LongName Possessive" 5734 msgid "of Ramadan" 5735 msgstr "od Ramadana" 5736 5737 #. +> stable 5738 #: kcalendarsystemhijri.cpp:351 kcalendarsystemhijri.cpp:382 5739 msgid "of Ramadan" 5740 msgstr "od Ramadana" 5741 5742 #. +> trunk 5743 #: kcalendarsystemislamiccivil.cpp:291 5744 #, fuzzy 5745 #| msgid "of Shawwal" 5746 msgctxt "Hijri month 10 - KLocale::LongName Possessive" 5747 msgid "of Shawwal" 5748 msgstr "od Shawwala" 5749 5750 #. +> stable 5751 #: kcalendarsystemhijri.cpp:353 kcalendarsystemhijri.cpp:384 5752 msgid "of Shawwal" 5753 msgstr "od Shawwala" 5754 5755 #. +> trunk 5756 #: kcalendarsystemislamiccivil.cpp:293 5757 #, fuzzy 5758 #| msgid "of Thu al-Qi`dah" 5759 msgctxt "Hijri month 11 - KLocale::LongName Possessive" 5760 msgid "of Thu al-Qi`dah" 5761 msgstr "od Thu al-Qi`daha" 5762 5763 #. +> stable 5764 #: kcalendarsystemhijri.cpp:386 5765 msgid "of Thu al-Qi`dah" 5766 msgstr "od Thu al-Qi`daha" 5767 5768 #. +> trunk 5769 #: kcalendarsystemislamiccivil.cpp:295 5770 #, fuzzy 5771 #| msgid "of Thu al-Hijjah" 5772 msgctxt "Hijri month 12 - KLocale::LongName Possessive" 5773 msgid "of Thu al-Hijjah" 5774 msgstr "od Thu al-Hijjaha" 5775 5776 #. +> stable 5777 #: kcalendarsystemhijri.cpp:388 5778 msgid "of Thu al-Hijjah" 5779 msgstr "od Thu al-Hijjaha" 5780 5781 #. +> trunk 5782 #: kcalendarsystemislamiccivil.cpp:304 5783 #, fuzzy 5784 #| msgid "Muharram" 5785 msgctxt "Hijri month 1 - KLocale::LongName" 5786 msgid "Muharram" 5787 msgstr "Muharram" 5788 5789 #. +> stable 5790 #: kcalendarsystemhijri.cpp:397 kcalendarsystemhijri.cpp:428 5791 msgid "Muharram" 5792 msgstr "Muharram" 5793 5794 #. +> trunk 5795 #: kcalendarsystemislamiccivil.cpp:306 5796 #, fuzzy 5797 #| msgid "Safar" 5798 msgctxt "Hijri month 2 - KLocale::LongName" 5799 msgid "Safar" 5800 msgstr "Safar" 5801 5802 #. +> stable 5803 #: kcalendarsystemhijri.cpp:399 kcalendarsystemhijri.cpp:430 5804 msgid "Safar" 5805 msgstr "Safar" 5806 5807 #. +> trunk 5808 #: kcalendarsystemislamiccivil.cpp:308 5809 #, fuzzy 5810 #| msgid "Rabi` al-Awal" 5811 msgctxt "Hijri month 3 - KLocale::LongName" 5812 msgid "Rabi` al-Awal" 5813 msgstr "Rabi` al-Awal" 5814 5815 #. +> stable 5816 #: kcalendarsystemhijri.cpp:432 5817 msgid "Rabi` al-Awal" 5818 msgstr "Rabi` al-Awal" 5819 5820 #. +> trunk 5821 #: kcalendarsystemislamiccivil.cpp:310 5822 #, fuzzy 5823 #| msgid "Rabi` al-Thaani" 5824 msgctxt "Hijri month 4 - KLocale::LongName" 5825 msgid "Rabi` al-Thaani" 5826 msgstr "Rabi` al-Thaani" 5827 5828 #. +> stable 5829 #: kcalendarsystemhijri.cpp:434 5830 msgid "Rabi` al-Thaani" 5831 msgstr "Rabi` al-Thaani" 5832 5833 #. +> trunk 5834 #: kcalendarsystemislamiccivil.cpp:312 5835 #, fuzzy 5836 #| msgid "Jumaada al-Awal" 5837 msgctxt "Hijri month 5 - KLocale::LongName" 5838 msgid "Jumaada al-Awal" 5839 msgstr "Jumaada al-Awal" 5840 5841 #. +> stable 5842 #: kcalendarsystemhijri.cpp:436 5843 msgid "Jumaada al-Awal" 5844 msgstr "Jumaada al-Awal" 5845 5846 #. +> trunk 5847 #: kcalendarsystemislamiccivil.cpp:314 5848 #, fuzzy 5849 #| msgid "Jumaada al-Thaani" 5850 msgctxt "Hijri month 6 - KLocale::LongName" 5851 msgid "Jumaada al-Thaani" 5852 msgstr "Jumaada al-Thaani" 5853 5854 #. +> stable 5855 #: kcalendarsystemhijri.cpp:438 5856 msgid "Jumaada al-Thaani" 5857 msgstr "Jumaada al-Thaani" 5858 5859 #. +> trunk 5860 #: kcalendarsystemislamiccivil.cpp:316 5861 #, fuzzy 5862 #| msgid "Rajab" 5863 msgctxt "Hijri month 7 - KLocale::LongName" 5864 msgid "Rajab" 5865 msgstr "Rajab" 5866 5867 #. +> stable 5868 #: kcalendarsystemhijri.cpp:409 kcalendarsystemhijri.cpp:440 5869 msgid "Rajab" 5870 msgstr "Rajab" 5871 5872 #. +> trunk 5873 #: kcalendarsystemislamiccivil.cpp:318 5874 #, fuzzy 5875 #| msgid "Sha`ban" 5876 msgctxt "Hijri month 8 - KLocale::LongName" 5877 msgid "Sha`ban" 5878 msgstr "Sha`ban" 5879 5880 #. +> stable 5881 #: kcalendarsystemhijri.cpp:411 kcalendarsystemhijri.cpp:442 5882 msgid "Sha`ban" 5883 msgstr "Sha`ban" 5884 5885 #. +> trunk 5886 #: kcalendarsystemislamiccivil.cpp:320 5887 #, fuzzy 5888 #| msgid "Ramadan" 5889 msgctxt "Hijri month 9 - KLocale::LongName" 5890 msgid "Ramadan" 5891 msgstr "Ramadan" 5892 5893 #. +> stable 5894 #: kcalendarsystemhijri.cpp:413 kcalendarsystemhijri.cpp:444 5895 msgid "Ramadan" 5896 msgstr "Ramadan" 5897 5898 #. +> trunk 5899 #: kcalendarsystemislamiccivil.cpp:322 5900 #, fuzzy 5901 #| msgid "Shawwal" 5902 msgctxt "Hijri month 10 - KLocale::LongName" 5903 msgid "Shawwal" 5904 msgstr "Sha`ban" 5905 5906 #. +> stable 5907 #: kcalendarsystemhijri.cpp:415 kcalendarsystemhijri.cpp:446 5908 msgid "Shawwal" 5909 msgstr "Sha`ban" 5910 5911 #. +> trunk 5912 #: kcalendarsystemislamiccivil.cpp:324 5913 #, fuzzy 5914 #| msgid "Thu al-Qi`dah" 5915 msgctxt "Hijri month 11 - KLocale::LongName" 5916 msgid "Thu al-Qi`dah" 5917 msgstr "Thu al-Qi`dah" 5918 5919 #. +> stable 5920 #: kcalendarsystemhijri.cpp:448 5921 msgid "Thu al-Qi`dah" 5922 msgstr "Thu al-Qi`dah" 5923 5924 #. +> trunk 5925 #: kcalendarsystemislamiccivil.cpp:326 5926 #, fuzzy 5927 #| msgid "Thu al-Hijjah" 5928 msgctxt "Hijri month 12 - KLocale::LongName" 5929 msgid "Thu al-Hijjah" 5930 msgstr "Thu al-Hijjah" 5931 5932 #. +> stable 5933 #: kcalendarsystemhijri.cpp:450 5934 msgid "Thu al-Hijjah" 5935 msgstr "Thu al-Hijjah" 5936 5937 #. +> trunk 5938 #: kcalendarsystemislamiccivil.cpp:337 5939 #, fuzzy 5940 msgctxt "Hijri weekday 1 - KLocale::NarrowName " 5941 msgid "I" 5942 msgstr "I" 5943 5944 #. +> trunk 5945 #: kcalendarsystemislamiccivil.cpp:339 5946 #, fuzzy 5947 msgctxt "Hijri weekday 2 - KLocale::NarrowName " 5948 msgid "T" 5949 msgstr "TGA" 5950 5951 #. +> stable 5952 #: kcalendarsystemhijri.cpp:339 5953 msgid "of R. Awal" 5954 msgstr "od R. Awala" 5955 5956 #. +> trunk 5957 #: kcalendarsystemislamiccivil.cpp:341 5958 #, fuzzy 5959 msgctxt "Hijri weekday 3 - KLocale::NarrowName " 5960 msgid "A" 5961 msgstr "A" 5962 5963 #. +> stable 5964 #: kcalendarsystemhijri.cpp:341 5965 msgid "of R. Thaani" 5966 msgstr "od R. Thaania" 5967 5968 #. +> trunk 5969 #: kcalendarsystemislamiccivil.cpp:343 5970 #, fuzzy 5971 msgctxt "Hijri weekday 4 - KLocale::NarrowName " 5972 msgid "K" 5973 msgstr "K" 5974 5975 #. +> stable 5976 #: kcalendarsystemhijri.cpp:343 5977 msgid "of J. Awal" 5978 msgstr "od J. Awala" 5979 5980 #. +> trunk 5981 #: kcalendarsystemislamiccivil.cpp:345 5982 #, fuzzy 5983 msgctxt "Hijri weekday 5 - KLocale::NarrowName " 5984 msgid "J" 5985 msgstr "J" 5986 5987 #. +> stable 5988 #: kcalendarsystemhijri.cpp:345 5989 msgid "of J. Thaani" 5990 msgstr "od J. Thaania" 5991 5992 #. +> trunk 5993 #: kcalendarsystemislamiccivil.cpp:347 5994 #, fuzzy 5995 msgctxt "Hijri weekday 6 - KLocale::NarrowName " 5996 msgid "S" 5997 msgstr "S" 5998 5999 #. +> trunk 6000 #: kcalendarsystemislamiccivil.cpp:349 6001 #, fuzzy 6002 msgctxt "Hijri weekday 7 - KLocale::NarrowName " 6003 msgid "A" 6004 msgstr "A" 6005 6006 #. +> stable 6007 #: kcalendarsystemhijri.cpp:355 6008 msgid "of Qi`dah" 6009 msgstr "od Qi`daha" 6010 6011 #. +> stable 6012 #: kcalendarsystemhijri.cpp:357 6013 msgid "of Hijjah" 6014 msgstr "od Hijjaha" 6015 6016 #. +> trunk 6017 #: kcalendarsystemislamiccivil.cpp:358 6018 #, fuzzy 6019 #| msgid "Ith" 6020 msgctxt "Hijri weekday 1 - KLocale::ShortName" 6021 msgid "Ith" 6022 msgstr "Ith" 6023 6024 #. +> stable 6025 #: kcalendarsystemhijri.cpp:466 6026 msgid "Ith" 6027 msgstr "Ith" 6028 6029 #. +> trunk 6030 #: kcalendarsystemislamiccivil.cpp:360 6031 #, fuzzy 6032 #| msgid "Thl" 6033 msgctxt "Hijri weekday 2 - KLocale::ShortName" 6034 msgid "Thl" 6035 msgstr "Thl" 6036 6037 #. +> stable 6038 #: kcalendarsystemhijri.cpp:468 6039 msgid "Thl" 6040 msgstr "Thl" 6041 6042 #. +> trunk 6043 #: kcalendarsystemislamiccivil.cpp:362 6044 #, fuzzy 6045 #| msgid "Arb" 6046 msgctxt "Hijri weekday 3 - KLocale::ShortName" 6047 msgid "Arb" 6048 msgstr "Arb" 6049 6050 #. +> stable 6051 #: kcalendarsystemhijri.cpp:470 6052 msgid "Arb" 6053 msgstr "Arb" 6054 6055 #. +> trunk 6056 #: kcalendarsystemislamiccivil.cpp:364 6057 #, fuzzy 6058 #| msgid "Kha" 6059 msgctxt "Hijri weekday 4 - KLocale::ShortName" 6060 msgid "Kha" 6061 msgstr "Kha" 6062 6063 #. +> stable 6064 #: kcalendarsystemhijri.cpp:472 6065 msgid "Kha" 6066 msgstr "Kha" 6067 6068 #. +> trunk 6069 #: kcalendarsystemislamiccivil.cpp:366 6070 #, fuzzy 6071 #| msgid "Jum" 6072 msgctxt "Hijri weekday 5 - KLocale::ShortName" 6073 msgid "Jum" 6074 msgstr "Jum" 6075 6076 #. +> stable 6077 #: kcalendarsystemhijri.cpp:474 6078 msgid "Jum" 6079 msgstr "Jum" 6080 6081 #. +> trunk 6082 #: kcalendarsystemislamiccivil.cpp:368 6083 #, fuzzy 6084 #| msgid "Sab" 6085 msgctxt "Hijri weekday 6 - KLocale::ShortName" 6086 msgid "Sab" 6087 msgstr "Sab" 6088 6089 #. +> stable 6090 #: kcalendarsystemhijri.cpp:476 6091 msgid "Sab" 6092 msgstr "Sab" 6093 6094 #. +> trunk 6095 #: kcalendarsystemislamiccivil.cpp:370 6096 #, fuzzy 6097 #| msgid "Ahd" 6098 msgctxt "Hijri weekday 7 - KLocale::ShortName" 6099 msgid "Ahd" 6100 msgstr "Ahd" 6101 6102 #. +> stable 6103 #: kcalendarsystemhijri.cpp:478 6104 msgid "Ahd" 6105 msgstr "Ahd" 6106 6107 #. +> trunk 6108 #: kcalendarsystemislamiccivil.cpp:377 6109 #, fuzzy 6110 #| msgid "Yaum al-Ithnain" 6111 msgctxt "Hijri weekday 1 - KLocale::LongName" 6112 msgid "Yaum al-Ithnain" 6113 msgstr "Yaum al-Ithnain" 6114 6115 #. +> stable 6116 #: kcalendarsystemhijri.cpp:487 6117 msgid "Yaum al-Ithnain" 6118 msgstr "Yaum al-Ithnain" 6119 6120 #. +> trunk 6121 #: kcalendarsystemislamiccivil.cpp:379 6122 #, fuzzy 6123 #| msgid "Yau al-Thulatha" 6124 msgctxt "Hijri weekday 2 - KLocale::LongName" 6125 msgid "Yau al-Thulatha" 6126 msgstr "Yau al-Thulatha" 6127 6128 #. +> stable 6129 #: kcalendarsystemhijri.cpp:489 6130 msgid "Yau al-Thulatha" 6131 msgstr "Yau al-Thulatha" 6132 6133 #. +> trunk 6134 #: kcalendarsystemislamiccivil.cpp:381 6135 #, fuzzy 6136 #| msgid "Yaum al-Arbi'a" 6137 msgctxt "Hijri weekday 3 - KLocale::LongName" 6138 msgid "Yaum al-Arbi'a" 6139 msgstr "Yaum al-Arbi'a" 6140 6141 #. +> stable 6142 #: kcalendarsystemhijri.cpp:491 6143 msgid "Yaum al-Arbi'a" 6144 msgstr "Yaum al-Arbi'a" 6145 6146 #. +> trunk 6147 #: kcalendarsystemislamiccivil.cpp:383 6148 #, fuzzy 6149 #| msgid "Yaum al-Khamees" 6150 msgctxt "Hijri weekday 4 - KLocale::LongName" 6151 msgid "Yaum al-Khamees" 6152 msgstr "Yaum al-Khamees" 6153 6154 #. +> stable 6155 #: kcalendarsystemhijri.cpp:493 6156 msgid "Yaum al-Khamees" 6157 msgstr "Yaum al-Khamees" 6158 6159 #. +> trunk 6160 #: kcalendarsystemislamiccivil.cpp:385 6161 #, fuzzy 6162 #| msgid "Yaum al-Jumma" 6163 msgctxt "Hijri weekday 5 - KLocale::LongName" 6164 msgid "Yaum al-Jumma" 6165 msgstr "Yaum al-Jumma" 6166 6167 #. +> stable 6168 #: kcalendarsystemhijri.cpp:495 6169 msgid "Yaum al-Jumma" 6170 msgstr "Yaum al-Jumma" 6171 6172 #. +> trunk 6173 #: kcalendarsystemislamiccivil.cpp:387 6174 #, fuzzy 6175 #| msgid "Yaum al-Sabt" 6176 msgctxt "Hijri weekday 6 - KLocale::LongName" 6177 msgid "Yaum al-Sabt" 6178 msgstr "Yaum al-Sabt" 6179 6180 #. +> stable 6181 #: kcalendarsystemhijri.cpp:497 6182 msgid "Yaum al-Sabt" 6183 msgstr "Yaum al-Sabt" 6184 6185 #. +> trunk 6186 #: kcalendarsystemislamiccivil.cpp:389 6187 #, fuzzy 6188 #| msgid "Yaum al-Ahad" 6189 msgctxt "Hijri weekday 7 - KLocale::LongName" 6190 msgid "Yaum al-Ahad" 6191 msgstr "Yaum al-Ahad" 6192 6193 #. +> stable 6194 #: kcalendarsystemhijri.cpp:401 6195 msgid "R. Awal" 6196 msgstr "R. Awal" 6197 6198 #. +> stable 6199 #: kcalendarsystemhijri.cpp:403 6200 msgid "R. Thaani" 6201 msgstr "R. Thaani" 6202 6203 #. +> stable 6204 #: kcalendarsystemhijri.cpp:405 6205 msgid "J. Awal" 6206 msgstr "J. Awal" 6207 6208 #. +> stable 6209 #: kcalendarsystemhijri.cpp:407 6210 msgid "J. Thaani" 6211 msgstr "J. Thaani" 6212 6213 #. +> stable 6214 #: kcalendarsystemhijri.cpp:417 6215 msgid "Qi`dah" 6216 msgstr "Qi`dah" 6217 6218 #. +> stable 6219 #: kcalendarsystemhijri.cpp:419 6220 msgid "Hijjah" 6221 msgstr "Hijjah" 6222 6223 #. +> stable 6224 #: kcalendarsystemhijri.cpp:499 6225 msgid "Yaum al-Ahad" 6226 msgstr "Yaum al-Ahad" 6227 6228 #. +> trunk stable 6229 6229 #: kcalendarsystemjalali.cpp:80 6230 6230 msgctxt "Calendar Era: Jalali Islamic Era, years > 0, LongFormat" … … 7333 7333 7334 7334 #. +> trunk stable 7335 #: kcalendarsystemjapanese.cpp: 2937335 #: kcalendarsystemjapanese.cpp:192 7336 7336 msgctxt "Japanese year 1 of era" 7337 7337 msgid "Gannen" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdelibs/kio4.po ¶
r1031 r1036 11 11 "Project-Id-Version: kio4 0\n" 12 12 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 13 "POT-Creation-Date: 2011-05-2 2 08:38+0200\n"13 "POT-Creation-Date: 2011-05-25 09:40+0200\n" 14 14 "PO-Revision-Date: 2011-05-05 10:23+0200\n" 15 15 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" … … 6983 6983 6984 6984 #. +> trunk stable 6985 #: misc/kpac/proxyscout.cpp:20 16985 #: misc/kpac/proxyscout.cpp:203 6986 6986 #, kde-format 6987 6987 msgid "" … … 6993 6993 6994 6994 #. +> trunk stable 6995 #: misc/kpac/proxyscout.cpp:31 56995 #: misc/kpac/proxyscout.cpp:317 6996 6996 #, kde-format 6997 6997 msgid "" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdemultimedia/juk.po ¶
r1026 r1036 6 6 "Project-Id-Version: juk 0\n" 7 7 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 8 "POT-Creation-Date: 2011-05- 19 07:16+0200\n"8 "POT-Creation-Date: 2011-05-25 09:40+0200\n" 9 9 "PO-Revision-Date: 2004-04-20 13:21+CEST\n" 10 10 "Last-Translator: auto\n" … … 114 114 #. i18n: ectx: property (windowTitle), widget (QWidget, CoverDialogBase) 115 115 #. +> trunk stable 116 #: coverdialogbase.ui:13 playlistcollection.cpp:89 7116 #: coverdialogbase.ui:13 playlistcollection.cpp:899 117 117 #, fuzzy 118 118 msgid "Cover Manager" … … 1320 1320 1321 1321 #. +> trunk stable 1322 #: playlistbox.cpp:214 playlistcollection.cpp:40 01322 #: playlistbox.cpp:214 playlistcollection.cpp:402 1323 1323 #, fuzzy 1324 1324 msgctxt "verb, copy the playlist" … … 1369 1369 1370 1370 #. +> trunk stable 1371 #: playlistbox.cpp:671 playlistcollection.cpp:8 891371 #: playlistbox.cpp:671 playlistcollection.cpp:891 1372 1372 msgid "R&emove" 1373 1373 msgstr "U&kloni" … … 1380 1380 1381 1381 #. +> trunk stable 1382 #: playlistcollection.cpp:2 291382 #: playlistcollection.cpp:231 1383 1383 #, fuzzy 1384 1384 msgid "Now Playing" … … 1386 1386 1387 1387 #. +> trunk stable 1388 #: playlistcollection.cpp:33 11388 #: playlistcollection.cpp:333 1389 1389 #, fuzzy 1390 1390 msgid "Do you want to add these items to the current list or to the collection list?" … … 1392 1392 1393 1393 #. +> trunk stable 1394 #: playlistcollection.cpp:33 31394 #: playlistcollection.cpp:335 1395 1395 #, fuzzy 1396 1396 #| msgid "Current" … … 1400 1400 1401 1401 #. +> trunk stable 1402 #: playlistcollection.cpp:33 41402 #: playlistcollection.cpp:336 1403 1403 msgid "Collection" 1404 1404 msgstr "Kolekcija" 1405 1405 1406 1406 #. +> trunk stable 1407 #: playlistcollection.cpp:3 881407 #: playlistcollection.cpp:390 1408 1408 msgid "Rename" 1409 1409 msgstr "Preimenuj" 1410 1410 1411 1411 #. +> trunk stable 1412 #: playlistcollection.cpp:50 21412 #: playlistcollection.cpp:504 1413 1413 #, fuzzy 1414 1414 msgid "Search Playlist" … … 1416 1416 1417 1417 #. +> trunk stable 1418 #: playlistcollection.cpp:5 191418 #: playlistcollection.cpp:521 1419 1419 #, fuzzy 1420 1420 msgid "Create Folder Playlist" … … 1422 1422 1423 1423 #. +> trunk stable 1424 #: playlistcollection.cpp:5 581424 #: playlistcollection.cpp:560 1425 1425 msgid "History" 1426 1426 msgstr "Povijest" 1427 1427 1428 1428 #. +> trunk stable 1429 #: playlistcollection.cpp:74 01429 #: playlistcollection.cpp:742 1430 1430 #, fuzzy 1431 1431 msgid "Please enter a name for this playlist:" … … 1433 1433 1434 1434 #. +> trunk stable 1435 #: playlistcollection.cpp:85 01435 #: playlistcollection.cpp:852 1436 1436 #, fuzzy 1437 1437 #| msgid "&New" … … 1441 1441 1442 1442 #. +> trunk stable 1443 #: playlistcollection.cpp:85 31443 #: playlistcollection.cpp:855 1444 1444 #, fuzzy 1445 1445 msgid "&Empty Playlist..." … … 1447 1447 1448 1448 #. +> trunk stable 1449 #: playlistcollection.cpp:85 51449 #: playlistcollection.cpp:857 1450 1450 #, fuzzy 1451 1451 msgid "&Search Playlist..." … … 1453 1453 1454 1454 #. +> trunk stable 1455 #: playlistcollection.cpp:85 71455 #: playlistcollection.cpp:859 1456 1456 #, fuzzy 1457 1457 msgid "Playlist From &Folder..." … … 1459 1459 1460 1460 #. +> trunk stable 1461 #: playlistcollection.cpp:86 31461 #: playlistcollection.cpp:865 1462 1462 #, fuzzy 1463 1463 msgid "&Guess Tag Information" … … 1465 1465 1466 1466 #. +> trunk stable 1467 #: playlistcollection.cpp:8 681467 #: playlistcollection.cpp:870 1468 1468 #, fuzzy 1469 1469 msgid "From &File Name" … … 1471 1471 1472 1472 #. +> trunk stable 1473 #: playlistcollection.cpp:87 01473 #: playlistcollection.cpp:872 1474 1474 #, fuzzy 1475 1475 msgid "From &Internet" … … 1477 1477 1478 1478 #. +> trunk stable 1479 #: playlistcollection.cpp:87 31479 #: playlistcollection.cpp:875 1480 1480 #, fuzzy 1481 1481 msgid "Guess Tag Information From &File Name" … … 1483 1483 1484 1484 #. +> trunk stable 1485 #: playlistcollection.cpp:8 781485 #: playlistcollection.cpp:880 1486 1486 #, fuzzy 1487 1487 msgid "Play First Track" … … 1489 1489 1490 1490 #. +> trunk stable 1491 #: playlistcollection.cpp:8 791491 #: playlistcollection.cpp:881 1492 1492 msgid "Play Next Album" 1493 1493 msgstr "" 1494 1494 1495 1495 #. +> trunk stable 1496 #: playlistcollection.cpp:88 51496 #: playlistcollection.cpp:887 1497 1497 msgid "Add &Folder..." 1498 1498 msgstr "" 1499 1499 1500 1500 #. +> trunk stable 1501 #: playlistcollection.cpp:88 61501 #: playlistcollection.cpp:888 1502 1502 msgid "&Rename..." 1503 1503 msgstr "&Promijeni ime âŠ" 1504 1504 1505 1505 #. +> trunk stable 1506 #: playlistcollection.cpp:88 71506 #: playlistcollection.cpp:889 1507 1507 #, fuzzy 1508 1508 #| msgid "D&uplicate..." … … 1512 1512 1513 1513 #. +> trunk stable 1514 #: playlistcollection.cpp:89 01514 #: playlistcollection.cpp:892 1515 1515 #, fuzzy 1516 1516 msgid "Reload" … … 1518 1518 1519 1519 #. +> trunk stable 1520 #: playlistcollection.cpp:89 11520 #: playlistcollection.cpp:893 1521 1521 msgid "Edit Search..." 1522 1522 msgstr "" 1523 1523 1524 1524 #. +> trunk stable 1525 #: playlistcollection.cpp:89 31525 #: playlistcollection.cpp:895 1526 1526 #, fuzzy 1527 1527 msgid "&Delete" … … 1529 1529 1530 1530 #. +> trunk stable 1531 #: playlistcollection.cpp:89 41531 #: playlistcollection.cpp:896 1532 1532 #, fuzzy 1533 1533 msgid "Refresh" … … 1535 1535 1536 1536 #. +> trunk stable 1537 #: playlistcollection.cpp:89 51537 #: playlistcollection.cpp:897 1538 1538 msgid "&Rename File" 1539 1539 msgstr "&Promijeni ime datoteci" 1540 1540 1541 1541 #. +> trunk stable 1542 #: playlistcollection.cpp:90 01542 #: playlistcollection.cpp:902 1543 1543 #, fuzzy 1544 1544 msgid "&View Cover" … … 1546 1546 1547 1547 #. +> trunk stable 1548 #: playlistcollection.cpp:90 21548 #: playlistcollection.cpp:904 1549 1549 msgid "Get Cover From &File..." 1550 1550 msgstr "" 1551 1551 1552 1552 #. +> trunk stable 1553 #: playlistcollection.cpp:90 41553 #: playlistcollection.cpp:906 1554 1554 #, fuzzy 1555 1555 msgid "Get Cover From &Internet..." … … 1557 1557 1558 1558 #. +> trunk stable 1559 #: playlistcollection.cpp:90 61559 #: playlistcollection.cpp:908 1560 1560 msgid "&Delete Cover" 1561 1561 msgstr "" 1562 1562 1563 1563 #. +> trunk stable 1564 #: playlistcollection.cpp:9 081564 #: playlistcollection.cpp:910 1565 1565 #, fuzzy 1566 1566 msgid "Show Cover &Manager" … … 1568 1568 1569 1569 #. +> trunk stable 1570 #: playlistcollection.cpp:91 21570 #: playlistcollection.cpp:914 1571 1571 #, fuzzy 1572 1572 msgid "Show &Play Queue" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdenetwork/desktop_kdenetwork.po ¶
r1027 r1036 8 8 "Project-Id-Version: desktop_kdenetwork 0\n" 9 9 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 10 "POT-Creation-Date: 2011-05-2 0 07:34+0200\n"10 "POT-Creation-Date: 2011-05-25 09:40+0200\n" 11 11 "PO-Revision-Date: 2010-05-26 11:57+0200\n" 12 12 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n" … … 841 841 842 842 #. +> trunk 843 #: kopete/kopete/kopete.notifyrc:314 0843 #: kopete/kopete/kopete.notifyrc:3141 844 844 #, fuzzy 845 845 msgctxt "Name" … … 848 848 849 849 #. +> trunk 850 #: kopete/kopete/kopete.notifyrc:316 1850 #: kopete/kopete/kopete.notifyrc:3162 851 851 #, fuzzy 852 852 #| msgctxt "Comment" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdepim/desktop_kdepim.po ¶
r1032 r1036 7 7 "Project-Id-Version: desktop_kdepim 0\n" 8 8 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 9 "POT-Creation-Date: 2011-05-2 3 09:09+0200\n"9 "POT-Creation-Date: 2011-05-25 09:40+0200\n" 10 10 "PO-Revision-Date: 2011-02-27 12:29+0100\n" 11 11 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n" … … 305 305 306 306 #. +> trunk 307 #: examples/coisceim/kontact-plugin/coisceim_plugin.desktop:3 0307 #: examples/coisceim/kontact-plugin/coisceim_plugin.desktop:32 308 308 #, fuzzy 309 309 msgctxt "Name" … … 344 344 345 345 #. +> trunk stable 346 #: examples/mailreader/mailreader.desktop:4 2346 #: examples/mailreader/mailreader.desktop:43 347 347 #, fuzzy 348 348 msgctxt "GenericName" … … 358 358 359 359 #. +> trunk stable 360 #: kaddressbook/grantlee/tests/themes/air/theme-air.desktop:3 2360 #: kaddressbook/grantlee/tests/themes/air/theme-air.desktop:33 361 361 #, fuzzy 362 362 msgctxt "Description" … … 372 372 373 373 #. +> trunk stable 374 #: kaddressbook/grantlee/tests/themes/simple/theme-simple.desktop:3 2374 #: kaddressbook/grantlee/tests/themes/simple/theme-simple.desktop:33 375 375 #, fuzzy 376 376 msgctxt "Description" … … 386 386 387 387 #. +> trunk stable 388 #: kaddressbook/grantlee/tests/themes/test/theme-test.desktop:3 2388 #: kaddressbook/grantlee/tests/themes/test/theme-test.desktop:33 389 389 #, fuzzy 390 390 msgctxt "Description" … … 565 565 566 566 #. +> trunk 567 #: kalarm/rtcwakeaction.actions: 78567 #: kalarm/rtcwakeaction.actions:80 568 568 msgctxt "Description" 569 569 msgid "Set RTC wake-from-suspend time" … … 1469 1469 1470 1470 #. +> trunk stable 1471 #: kontact/src/kontactconfig.desktop:2 31471 #: kontact/src/kontactconfig.desktop:26 1472 1472 #, fuzzy 1473 1473 msgctxt "Comment" … … 1877 1877 1878 1878 #. +> trunk stable 1879 #: libkleo/libkleopatrarc-win32.desktop:8 71879 #: libkleo/libkleopatrarc-win32.desktop:88 1880 1880 msgctxt "Name" 1881 1881 msgid "sha256sum" … … 1883 1883 1884 1884 #. +> trunk stable 1885 #: libkleo/libkleopatrarc-win32.desktop:12 3 libkleo/libkleopatrarc.desktop:1661885 #: libkleo/libkleopatrarc-win32.desktop:124 libkleo/libkleopatrarc.desktop:167 1886 1886 msgctxt "Name" 1887 1887 msgid "md5sum" … … 1889 1889 1890 1890 #. +> trunk stable 1891 #: libkleo/libkleopatrarc-win32.desktop:16 0 libkleo/libkleopatrarc.desktop:2031891 #: libkleo/libkleopatrarc-win32.desktop:162 libkleo/libkleopatrarc.desktop:205 1892 1892 #, fuzzy 1893 1893 msgctxt "Name" … … 1896 1896 1897 1897 #. +> trunk stable 1898 #: libkleo/libkleopatrarc-win32.desktop:2 19 libkleo/libkleopatrarc.desktop:2621898 #: libkleo/libkleopatrarc-win32.desktop:221 libkleo/libkleopatrarc.desktop:264 1899 1899 #, fuzzy 1900 1900 msgctxt "Name" … … 1903 1903 1904 1904 #. +> trunk stable 1905 #: libkleo/libkleopatrarc-win32.desktop:2 79 libkleo/libkleopatrarc.desktop:3221905 #: libkleo/libkleopatrarc-win32.desktop:281 libkleo/libkleopatrarc.desktop:324 1906 1906 #, fuzzy 1907 1907 msgctxt "Name" … … 1910 1910 1911 1911 #. +> trunk stable 1912 #: libkleo/libkleopatrarc-win32.desktop:3 39 libkleo/libkleopatrarc.desktop:3821912 #: libkleo/libkleopatrarc-win32.desktop:341 libkleo/libkleopatrarc.desktop:384 1913 1913 msgctxt "Name" 1914 1914 msgid "Trusted Root Certificate" … … 1916 1916 1917 1917 #. +> trunk stable 1918 #: libkleo/libkleopatrarc-win32.desktop:40 1 libkleo/libkleopatrarc.desktop:4441918 #: libkleo/libkleopatrarc-win32.desktop:403 libkleo/libkleopatrarc.desktop:446 1919 1919 msgctxt "Name" 1920 1920 msgid "Not Trusted Root Certificate" … … 1922 1922 1923 1923 #. +> trunk stable 1924 #: libkleo/libkleopatrarc-win32.desktop:4 59 libkleo/libkleopatrarc.desktop:5021924 #: libkleo/libkleopatrarc-win32.desktop:461 libkleo/libkleopatrarc.desktop:504 1925 1925 msgctxt "Name" 1926 1926 msgid "Keys for Qualified Signatures" … … 1928 1928 1929 1929 #. +> trunk stable 1930 #: libkleo/libkleopatrarc-win32.desktop:50 2 libkleo/libkleopatrarc.desktop:5451930 #: libkleo/libkleopatrarc-win32.desktop:504 libkleo/libkleopatrarc.desktop:547 1931 1931 #, fuzzy 1932 1932 msgctxt "Name" … … 1935 1935 1936 1936 #. +> trunk stable 1937 #: libkleo/libkleopatrarc-win32.desktop:5 48 libkleo/libkleopatrarc.desktop:5911937 #: libkleo/libkleopatrarc-win32.desktop:550 libkleo/libkleopatrarc.desktop:593 1938 1938 msgctxt "Name" 1939 1939 msgid "Smartcard Key" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdeutils/ark.po ¶
r1021 r1036 9 9 "Project-Id-Version: ark 0\n" 10 10 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 11 "POT-Creation-Date: 2011-05- 16 09:01+0200\n"11 "POT-Creation-Date: 2011-05-25 09:41+0200\n" 12 12 "PO-Revision-Date: 2011-03-03 21:22+0100\n" 13 13 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n" … … 40 40 41 41 #. +> trunk stable 42 #: app/batchextract.cpp:13 5 app/batchextract.cpp:18842 #: app/batchextract.cpp:136 app/batchextract.cpp:192 43 43 msgid "Extracting file..." 44 44 msgstr "Otpakiravam datotekuâŠ" 45 45 46 46 #. +> trunk stable 47 #: app/batchextract.cpp:13 6 app/batchextract.cpp:18947 #: app/batchextract.cpp:137 app/batchextract.cpp:193 48 48 msgid "Source archive" 49 49 msgstr "Izvorna arhiva" 50 50 51 51 #. +> trunk stable 52 #: app/batchextract.cpp:13 7 app/batchextract.cpp:19052 #: app/batchextract.cpp:138 app/batchextract.cpp:194 53 53 msgid "Destination" 54 54 msgstr "OdrediÅ¡te" 55 55 56 56 #. +> trunk stable 57 #: app/batchextract.cpp:15 057 #: app/batchextract.cpp:151 58 58 msgid "The following files could not be extracted:" 59 59 msgstr "SljedeÄe datoteke ne mogu biti otpakirane:" 60 60 61 61 #. +> trunk stable 62 #: app/batchextract.cpp:1 6662 #: app/batchextract.cpp:170 63 63 msgid "There was an error during extraction." 64 64 msgstr "Dogodila se greÅ¡ka prilikom otpakiravanja." … … 341 341 342 342 #. +> trunk stable 343 #: kerfuffle/cliinterface.cpp:494 kerfuffle/cliinterface.cpp:53 5343 #: kerfuffle/cliinterface.cpp:494 kerfuffle/cliinterface.cpp:534 344 344 msgid "Incorrect password." 345 345 msgstr "NetoÄna zaporka." 346 346 347 347 #. +> trunk stable 348 #: kerfuffle/cliinterface.cpp:50 2 kerfuffle/cliinterface.cpp:543348 #: kerfuffle/cliinterface.cpp:501 kerfuffle/cliinterface.cpp:541 349 349 msgid "Extraction failed because of an unexpected error." 350 350 msgstr "Otpakiravanje nije uspjelo zbog neoÄekivane greÅ¡ke." -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/kdeutils/desktop_kdeutils.po ¶
r1027 r1036 7 7 "Project-Id-Version: desktop_kdeutils 0\n" 8 8 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 9 "POT-Creation-Date: 2011-05-2 0 07:35+0200\n"9 "POT-Creation-Date: 2011-05-25 09:41+0200\n" 10 10 "PO-Revision-Date: 2010-02-14 12:30+0100\n" 11 11 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n" … … 28 28 29 29 #. +> trunk stable 30 #: ark/app/ark.desktop:7 430 #: ark/app/ark.desktop:75 31 31 msgctxt "Name" 32 32 msgid "Ark" … … 46 46 47 47 #. +> trunk stable 48 #: ark/app/ark_addtoservicemenu.desktop:12 448 #: ark/app/ark_addtoservicemenu.desktop:125 49 49 msgctxt "Name" 50 50 msgid "As ZIP Archive" … … 52 52 53 53 #. +> trunk stable 54 #: ark/app/ark_addtoservicemenu.desktop:18 154 #: ark/app/ark_addtoservicemenu.desktop:183 55 55 msgctxt "Name" 56 56 msgid "As RAR Archive" … … 58 58 59 59 #. +> trunk stable 60 #: ark/app/ark_addtoservicemenu.desktop:2 3860 #: ark/app/ark_addtoservicemenu.desktop:241 61 61 msgctxt "Name" 62 62 msgid "As ZIP/TAR Archive" … … 64 64 65 65 #. +> trunk stable 66 #: ark/app/ark_addtoservicemenu.desktop:29 466 #: ark/app/ark_addtoservicemenu.desktop:298 67 67 msgctxt "Name" 68 68 msgid "Compress To..." -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/koffice/karbon.po ¶
r945 r1036 5 5 "Project-Id-Version: karbon 0\n" 6 6 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 7 "POT-Creation-Date: 2011-0 4-07 08:11+0200\n"7 "POT-Creation-Date: 2011-05-25 09:41+0200\n" 8 8 "PO-Revision-Date: 2007-01-08 01:49+0100\n" 9 9 "Last-Translator: Renato Pavicic <renato@translator-shop.org>\n" … … 55 55 #. i18n: ectx: Menu (object_order) 56 56 #. +> trunk stable 57 #: data/karbon.rc:16 data/karbon.rc:7 657 #: data/karbon.rc:16 data/karbon.rc:78 58 58 msgid "&Order" 59 59 msgstr "&Redoslijed" … … 61 61 #. i18n: ectx: Menu (object_align) 62 62 #. +> trunk stable 63 #: data/karbon.rc:23 data/karbon.rc:8 363 #: data/karbon.rc:23 data/karbon.rc:85 64 64 msgid "&Align" 65 65 msgstr "&Poravnanje" … … 81 81 #. i18n: ectx: Menu (view) 82 82 #. +> trunk stable 83 #: data/karbon.rc:5 0data/karbon_readonly.rc:1783 #: data/karbon.rc:52 data/karbon_readonly.rc:17 84 84 #, fuzzy 85 85 msgid "&View" … … 88 88 #. i18n: ectx: Menu (object) 89 89 #. +> trunk stable 90 #: data/karbon.rc:7 390 #: data/karbon.rc:75 91 91 msgid "&Object" 92 92 msgstr "&Objekt âŠ" … … 94 94 #. i18n: ectx: Menu (object_distribute) 95 95 #. +> trunk stable 96 #: data/karbon.rc:9 396 #: data/karbon.rc:95 97 97 msgid "&Distribute" 98 98 msgstr "" … … 100 100 #. i18n: ectx: Menu (path) 101 101 #. +> trunk stable 102 #: data/karbon.rc:11 2102 #: data/karbon.rc:114 103 103 #, fuzzy 104 104 msgid "&Path" … … 107 107 #. i18n: ectx: Menu (effects) 108 108 #. +> trunk stable 109 #: data/karbon.rc:12 6109 #: data/karbon.rc:128 110 110 #, fuzzy 111 111 msgid "Effe&cts" … … 114 114 #. i18n: ectx: Menu (settings) 115 115 #. +> trunk stable 116 #: data/karbon.rc:1 28116 #: data/karbon.rc:130 117 117 #, fuzzy 118 118 msgid "&Settings" … … 121 121 #. i18n: ectx: ToolBar (edit_toolbar) 122 122 #. +> trunk stable 123 #: data/karbon.rc:13 6123 #: data/karbon.rc:138 124 124 #, fuzzy 125 125 msgid "Edit" … … 128 128 #. i18n: ectx: ToolBar (object_toolbar) 129 129 #. +> trunk stable 130 #: data/karbon.rc:14 6130 #: data/karbon.rc:148 131 131 msgid "Object" 132 132 msgstr "Objekt" … … 134 134 #. i18n: ectx: ToolBar (align_toolbar) 135 135 #. +> trunk stable 136 #: data/karbon.rc:15 5136 #: data/karbon.rc:157 137 137 #, fuzzy 138 138 msgid "Align" … … 141 141 #. i18n: ectx: ToolBar (Effects) 142 142 #. +> trunk stable 143 #: data/karbon.rc:16 4143 #: data/karbon.rc:166 144 144 msgid "Effects" 145 145 msgstr "Efekti" … … 988 988 989 989 #. +> trunk 990 #: ui/KarbonView.cpp:703 ui/KarbonView.cpp:10 29990 #: ui/KarbonView.cpp:703 ui/KarbonView.cpp:1033 991 991 #, fuzzy 992 992 msgid "Mirror Horizontally" … … 994 994 995 995 #. +> trunk 996 #: ui/KarbonView.cpp:705 ui/KarbonView.cpp:102 5996 #: ui/KarbonView.cpp:705 ui/KarbonView.cpp:1029 997 997 #, fuzzy 998 998 msgid "Mirror Vertically" … … 1032 1032 msgstr "O&briÅ¡i" 1033 1033 1034 #. +> trunk stable 1035 #: ui/KarbonView.cpp:952 1034 #. +> trunk 1035 #: ui/KarbonView.cpp:950 1036 #, fuzzy 1037 #| msgid "End Time" 1038 msgid "Edit Guides" 1039 msgstr "ZavrÅ¡no vrijeme:" 1040 1041 #. +> trunk stable 1042 #: ui/KarbonView.cpp:956 1036 1043 #, fuzzy 1037 1044 #| msgid "&Duplicate" … … 1041 1048 1042 1049 #. +> trunk stable 1043 #: ui/KarbonView.cpp:9 571050 #: ui/KarbonView.cpp:961 1044 1051 msgid "Distribute Center (Horizontal)" 1045 1052 msgstr "" 1046 1053 1047 1054 #. +> trunk stable 1048 #: ui/KarbonView.cpp:96 11055 #: ui/KarbonView.cpp:965 1049 1056 msgid "Distribute Gaps (Horizontal)" 1050 1057 msgstr "" 1051 1058 1052 1059 #. +> trunk stable 1053 #: ui/KarbonView.cpp:96 51060 #: ui/KarbonView.cpp:969 1054 1061 #, fuzzy 1055 1062 msgid "Distribute Left Borders" … … 1057 1064 1058 1065 #. +> trunk stable 1059 #: ui/KarbonView.cpp:9 691066 #: ui/KarbonView.cpp:973 1060 1067 #, fuzzy 1061 1068 msgid "Distribute Right Borders" … … 1063 1070 1064 1071 #. +> trunk stable 1065 #: ui/KarbonView.cpp:97 31072 #: ui/KarbonView.cpp:977 1066 1073 msgid "Distribute Center (Vertical)" 1067 1074 msgstr "" 1068 1075 1069 1076 #. +> trunk stable 1070 #: ui/KarbonView.cpp:9 771077 #: ui/KarbonView.cpp:981 1071 1078 msgid "Distribute Gaps (Vertical)" 1072 1079 msgstr "" 1073 1080 1074 1081 #. +> trunk stable 1075 #: ui/KarbonView.cpp:98 11082 #: ui/KarbonView.cpp:985 1076 1083 #, fuzzy 1077 1084 msgid "Distribute Bottom Borders" … … 1079 1086 1080 1087 #. +> trunk stable 1081 #: ui/KarbonView.cpp:98 51088 #: ui/KarbonView.cpp:989 1082 1089 #, fuzzy 1083 1090 msgid "Distribute Top Borders" … … 1085 1092 1086 1093 #. +> trunk stable 1087 #: ui/KarbonView.cpp:9 891094 #: ui/KarbonView.cpp:993 1088 1095 msgid "Show Rulers" 1089 1096 msgstr "P&odnoÅŸje" 1090 1097 1091 1098 #. +> trunk stable 1092 #: ui/KarbonView.cpp:99 11099 #: ui/KarbonView.cpp:995 1093 1100 #, fuzzy 1094 1101 msgid "Hide Rulers" … … 1096 1103 1097 1104 #. +> trunk stable 1098 #: ui/KarbonView.cpp:99 21105 #: ui/KarbonView.cpp:996 1099 1106 #, fuzzy 1100 1107 msgid "Shows or hides rulers" … … 1102 1109 1103 1110 #. +> trunk stable 1104 #: ui/KarbonView.cpp:100 31111 #: ui/KarbonView.cpp:1007 1105 1112 msgid "Snap to Grid" 1106 1113 msgstr "Poravnaj s reÅ¡etkom" 1107 1114 1108 1115 #. +> trunk stable 1109 #: ui/KarbonView.cpp:100 51116 #: ui/KarbonView.cpp:1009 1110 1117 #, fuzzy 1111 1118 msgid "Snaps to grid" … … 1113 1120 1114 1121 #. +> trunk 1115 #: ui/KarbonView.cpp:10 171122 #: ui/KarbonView.cpp:1021 1116 1123 #, fuzzy 1117 1124 msgid "&Clip Object" … … 1119 1126 1120 1127 #. +> trunk 1121 #: ui/KarbonView.cpp:102 11128 #: ui/KarbonView.cpp:1025 1122 1129 #, fuzzy 1123 1130 #| msgid "&Group Objects" … … 1126 1133 1127 1134 #. +> trunk stable 1128 #: ui/KarbonView.cpp:10 361135 #: ui/KarbonView.cpp:1040 1129 1136 #, fuzzy 1130 1137 msgid "&Close Path" … … 1132 1139 1133 1140 #. +> trunk stable 1134 #: ui/KarbonView.cpp:104 21141 #: ui/KarbonView.cpp:1046 1135 1142 msgid "Com&bine Path" 1136 1143 msgstr "" 1137 1144 1138 1145 #. +> trunk stable 1139 #: ui/KarbonView.cpp:10 481146 #: ui/KarbonView.cpp:1052 1140 1147 msgid "Se¶te Path" 1141 1148 msgstr "" 1142 1149 1143 1150 #. +> trunk stable 1144 #: ui/KarbonView.cpp:105 41151 #: ui/KarbonView.cpp:1058 1145 1152 msgid "Re&verse Path" 1146 1153 msgstr "" 1147 1154 1148 1155 #. +> trunk stable 1149 #: ui/KarbonView.cpp:106 01156 #: ui/KarbonView.cpp:1064 1150 1157 msgid "Intersect Paths" 1151 1158 msgstr "" 1152 1159 1153 1160 #. +> trunk stable 1154 #: ui/KarbonView.cpp:10 661161 #: ui/KarbonView.cpp:1070 1155 1162 #, fuzzy 1156 1163 msgid "Subtract Paths" … … 1158 1165 1159 1166 #. +> trunk stable 1160 #: ui/KarbonView.cpp:107 21167 #: ui/KarbonView.cpp:1076 1161 1168 msgid "Unite Paths" 1162 1169 msgstr "" 1163 1170 1164 1171 #. +> trunk stable 1165 #: ui/KarbonView.cpp:10 781172 #: ui/KarbonView.cpp:1082 1166 1173 msgid "Exclude Paths" 1167 1174 msgstr "" 1168 1175 1169 1176 #. +> trunk stable 1170 #: ui/KarbonView.cpp:108 41177 #: ui/KarbonView.cpp:1088 1171 1178 #, fuzzy 1172 1179 #| msgid "Snap to Grid" … … 1175 1182 1176 1183 #. +> trunk stable 1177 #: ui/KarbonView.cpp:109 11184 #: ui/KarbonView.cpp:1095 1178 1185 msgid "Configure Karbon..." 1179 1186 msgstr "" 1180 1187 1181 1188 #. +> trunk stable 1182 #: ui/KarbonView.cpp:109 51189 #: ui/KarbonView.cpp:1099 1183 1190 msgid "Page &Layout..." 1184 1191 msgstr "" 1185 1192 1186 1193 #. +> trunk stable 1187 #: ui/KarbonView.cpp:110 01194 #: ui/KarbonView.cpp:1104 1188 1195 #, fuzzy 1189 1196 #| msgid "Selection" … … 1192 1199 1193 1200 #. +> trunk stable 1194 #: ui/KarbonView.cpp:110 41201 #: ui/KarbonView.cpp:1108 1195 1202 msgid "Zoom to Drawing" 1196 1203 msgstr "" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/koffice/koffice.po ¶
r1031 r1036 6 6 "Project-Id-Version: koffice 0\n" 7 7 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 8 "POT-Creation-Date: 2011-05-2 2 08:40+0200\n"8 "POT-Creation-Date: 2011-05-25 09:41+0200\n" 9 9 "PO-Revision-Date: 2009-09-29 20:45+0200\n" 10 10 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n" … … 4213 4213 msgstr "Informacije o dokumentu" 4214 4214 4215 #. +> trunk 4216 #: pigment/compositeops/KoCompositeOpInversedSubtract.h:37 4217 #, fuzzy 4218 msgid "Inverse Subtract" 4219 msgstr "Informacije o dokumentu" 4220 4215 4221 #. +> trunk stable 4216 4222 #: pigment/compositeops/KoCompositeOpOver.h:61 … … 5782 5788 5783 5789 #. +> trunk 5784 #: main/KoFindText.cpp:10 05790 #: main/KoFindText.cpp:101 5785 5791 #, fuzzy 5786 5792 msgid "Case Sensitive" … … 5788 5794 5789 5795 #. +> trunk 5790 #: main/KoFindText.cpp:10 05796 #: main/KoFindText.cpp:101 5791 5797 #, fuzzy 5792 5798 msgid "Match cases when searching" … … 5794 5800 5795 5801 #. +> trunk 5796 #: main/KoFindText.cpp:10 15802 #: main/KoFindText.cpp:102 5797 5803 #, fuzzy 5798 5804 msgid "Whole Words Only" … … 5800 5806 5801 5807 #. +> trunk 5802 #: main/KoFindText.cpp:10 15808 #: main/KoFindText.cpp:102 5803 5809 #, fuzzy 5804 5810 msgid "Match only whole words" … … 6000 6006 6001 6007 #. +> trunk 6002 #: pigment/compositeops/KoCompositeOps.h:105 6008 #: pigment/compositeops/KoCompositeOps.h:102 6009 #, fuzzy 6010 msgid "Inversed-Subtract" 6011 msgstr "Informacije o dokumentu" 6012 6013 #. +> trunk 6014 #: pigment/compositeops/KoCompositeOps.h:106 6003 6015 #, fuzzy 6004 6016 msgid "Arcus Tangent" … … 6006 6018 6007 6019 #. +> trunk 6008 #: pigment/compositeops/KoCompositeOps.h:10 66020 #: pigment/compositeops/KoCompositeOps.h:107 6009 6021 #, fuzzy 6010 6022 msgid "Difference" … … 6012 6024 6013 6025 #. +> trunk 6014 #: pigment/compositeops/KoCompositeOps.h:10 76026 #: pigment/compositeops/KoCompositeOps.h:108 6015 6027 #, fuzzy 6016 6028 msgid "Exclusion" … … 6018 6030 6019 6031 #. +> trunk 6020 #: pigment/compositeops/KoCompositeOps.h:10 86032 #: pigment/compositeops/KoCompositeOps.h:109 6021 6033 #, fuzzy 6022 6034 msgid "Equivalence" … … 6024 6036 6025 6037 #. +> trunk 6026 #: pigment/compositeops/KoCompositeOps.h:1 096038 #: pigment/compositeops/KoCompositeOps.h:110 6027 6039 #, fuzzy 6028 6040 msgid "Additive-Substractive" … … 6030 6042 6031 6043 #. +> trunk 6032 #: pigment/compositeops/KoCompositeOps.h:114 6033 #, fuzzy 6034 msgid "Copy Alpha" 6035 msgstr "Postavi sve" 6036 6037 #. +> trunk 6038 #: pigment/compositeops/KoCompositeOps.h:139 6044 #: pigment/compositeops/KoCompositeOps.h:137 6039 6045 #, fuzzy 6040 6046 msgid "Copy Red" … … 6042 6048 6043 6049 #. +> trunk 6044 #: pigment/compositeops/KoCompositeOps.h:1 406050 #: pigment/compositeops/KoCompositeOps.h:138 6045 6051 #, fuzzy 6046 6052 msgid "Copy Green" … … 6048 6054 6049 6055 #. +> trunk 6050 #: pigment/compositeops/KoCompositeOps.h:1 416056 #: pigment/compositeops/KoCompositeOps.h:139 6051 6057 #, fuzzy 6052 6058 msgid "Copy Blue" … … 6054 6060 6055 6061 #. +> trunk 6056 #: pigment/compositeops/KoCompositeOps.h:14 66062 #: pigment/compositeops/KoCompositeOps.h:144 6057 6063 #, fuzzy 6058 6064 msgid "Increase Saturation" … … 6060 6066 6061 6067 #. +> trunk 6062 #: pigment/compositeops/KoCompositeOps.h:14 76068 #: pigment/compositeops/KoCompositeOps.h:145 6063 6069 #, fuzzy 6064 6070 msgid "Decrease Saturation" … … 6066 6072 6067 6073 #. +> trunk 6068 #: pigment/compositeops/KoCompositeOps.h:14 86074 #: pigment/compositeops/KoCompositeOps.h:146 6069 6075 #, fuzzy 6070 6076 msgid "Luminosity" … … 6072 6078 6073 6079 #. +> trunk 6074 #: pigment/compositeops/KoCompositeOps.h:14 96080 #: pigment/compositeops/KoCompositeOps.h:147 6075 6081 #, fuzzy 6076 6082 msgid "Increase Luminosity" … … 6078 6084 6079 6085 #. +> trunk 6080 #: pigment/compositeops/KoCompositeOps.h:1 506086 #: pigment/compositeops/KoCompositeOps.h:148 6081 6087 #, fuzzy 6082 6088 msgid "Decrease Luminosity" … … 6084 6090 6085 6091 #. +> trunk 6086 #: pigment/compositeops/KoCompositeOps.h:15 26092 #: pigment/compositeops/KoCompositeOps.h:150 6087 6093 #, fuzzy 6088 6094 msgid "Color HSI" … … 6090 6096 6091 6097 #. +> trunk 6092 #: pigment/compositeops/KoCompositeOps.h:15 36098 #: pigment/compositeops/KoCompositeOps.h:151 6093 6099 #, fuzzy 6094 6100 msgid "Hue HSI" … … 6096 6102 6097 6103 #. +> trunk 6098 #: pigment/compositeops/KoCompositeOps.h:15 46104 #: pigment/compositeops/KoCompositeOps.h:152 6099 6105 #, fuzzy 6100 6106 msgid "Saturation HSI" … … 6102 6108 6103 6109 #. +> trunk 6104 #: pigment/compositeops/KoCompositeOps.h:15 56110 #: pigment/compositeops/KoCompositeOps.h:153 6105 6111 #, fuzzy 6106 6112 msgid "Increase Saturation HSI" … … 6108 6114 6109 6115 #. +> trunk 6110 #: pigment/compositeops/KoCompositeOps.h:15 66116 #: pigment/compositeops/KoCompositeOps.h:154 6111 6117 #, fuzzy 6112 6118 msgid "Decrease Saturation HSI" … … 6114 6120 6115 6121 #. +> trunk 6116 #: pigment/compositeops/KoCompositeOps.h:15 76122 #: pigment/compositeops/KoCompositeOps.h:155 6117 6123 #, fuzzy 6118 6124 msgid "Intensity" … … 6120 6126 6121 6127 #. +> trunk 6122 #: pigment/compositeops/KoCompositeOps.h:15 86128 #: pigment/compositeops/KoCompositeOps.h:156 6123 6129 #, fuzzy 6124 6130 #| msgid "Change Indent" … … 6127 6133 6128 6134 #. +> trunk 6129 #: pigment/compositeops/KoCompositeOps.h:15 96135 #: pigment/compositeops/KoCompositeOps.h:157 6130 6136 #, fuzzy 6131 6137 #| msgid "Change Indent" … … 6134 6140 6135 6141 #. +> trunk 6136 #: pigment/compositeops/KoCompositeOps.h:1 616142 #: pigment/compositeops/KoCompositeOps.h:159 6137 6143 #, fuzzy 6138 6144 msgid "Color HSL" … … 6140 6146 6141 6147 #. +> trunk 6142 #: pigment/compositeops/KoCompositeOps.h:16 26148 #: pigment/compositeops/KoCompositeOps.h:160 6143 6149 #, fuzzy 6144 6150 msgid "Hue HSL" … … 6146 6152 6147 6153 #. +> trunk 6148 #: pigment/compositeops/KoCompositeOps.h:16 36154 #: pigment/compositeops/KoCompositeOps.h:161 6149 6155 #, fuzzy 6150 6156 msgid "Saturation HSL" … … 6152 6158 6153 6159 #. +> trunk 6154 #: pigment/compositeops/KoCompositeOps.h:16 46160 #: pigment/compositeops/KoCompositeOps.h:162 6155 6161 #, fuzzy 6156 6162 msgid "Increase Saturation HSL" … … 6158 6164 6159 6165 #. +> trunk 6160 #: pigment/compositeops/KoCompositeOps.h:16 56166 #: pigment/compositeops/KoCompositeOps.h:163 6161 6167 #, fuzzy 6162 6168 msgid "Decrease Saturation HSL" … … 6164 6170 6165 6171 #. +> trunk 6166 #: pigment/compositeops/KoCompositeOps.h:16 76172 #: pigment/compositeops/KoCompositeOps.h:165 6167 6173 #, fuzzy 6168 6174 msgid "Increase Lightness" … … 6170 6176 6171 6177 #. +> trunk 6172 #: pigment/compositeops/KoCompositeOps.h:16 86178 #: pigment/compositeops/KoCompositeOps.h:166 6173 6179 #, fuzzy 6174 6180 msgid "Decrease Lightness" … … 6176 6182 6177 6183 #. +> trunk 6178 #: pigment/compositeops/KoCompositeOps.h:1 706184 #: pigment/compositeops/KoCompositeOps.h:168 6179 6185 #, fuzzy 6180 6186 msgid "Color HSV" … … 6182 6188 6183 6189 #. +> trunk 6184 #: pigment/compositeops/KoCompositeOps.h:1 716190 #: pigment/compositeops/KoCompositeOps.h:169 6185 6191 #, fuzzy 6186 6192 msgid "Hue HSV" … … 6188 6194 6189 6195 #. +> trunk 6190 #: pigment/compositeops/KoCompositeOps.h:17 26196 #: pigment/compositeops/KoCompositeOps.h:170 6191 6197 #, fuzzy 6192 6198 msgid "Saturation HSV" … … 6194 6200 6195 6201 #. +> trunk 6196 #: pigment/compositeops/KoCompositeOps.h:17 36202 #: pigment/compositeops/KoCompositeOps.h:171 6197 6203 #, fuzzy 6198 6204 msgid "Increase Saturation HSV" … … 6200 6206 6201 6207 #. +> trunk 6202 #: pigment/compositeops/KoCompositeOps.h:17 46208 #: pigment/compositeops/KoCompositeOps.h:172 6203 6209 #, fuzzy 6204 6210 msgid "Decrease Saturation HSV" … … 6206 6212 6207 6213 #. +> trunk 6208 #: pigment/compositeops/KoCompositeOps.h:17 56214 #: pigment/compositeops/KoCompositeOps.h:173 6209 6215 msgid "Value" 6210 6216 msgstr "Vrijednost" 6211 6217 6212 6218 #. +> trunk 6213 #: pigment/compositeops/KoCompositeOps.h:17 66219 #: pigment/compositeops/KoCompositeOps.h:174 6214 6220 #, fuzzy 6215 6221 msgid "Increase Value" … … 6217 6223 6218 6224 #. +> trunk 6219 #: pigment/compositeops/KoCompositeOps.h:17 76225 #: pigment/compositeops/KoCompositeOps.h:175 6220 6226 #, fuzzy 6221 6227 msgid "Decrease Value" … … 6465 6471 msgid "Set miter limit" 6466 6472 msgstr "doÅ¡ao do internog ograniÄenja" 6473 6474 #, fuzzy 6475 #~ msgid "Copy Alpha" 6476 #~ msgstr "Postavi sve" 6467 6477 6468 6478 #, fuzzy -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/koffice/krita.po ¶
r1032 r1036 7 7 "Project-Id-Version: krita 0\n" 8 8 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 9 "POT-Creation-Date: 2011-05-2 3 09:11+0200\n"9 "POT-Creation-Date: 2011-05-25 09:41+0200\n" 10 10 "PO-Revision-Date: 2011-03-18 18:21+0100\n" 11 11 "Last-Translator: Marko DimjaÅ¡eviÄ <marko@dimjasevic.net>\n" … … 1655 1655 #. i18n: ectx: Menu (view_fast_grid_config) 1656 1656 #. +> trunk stable 1657 #: krita.rc:5 31657 #: krita.rc:52 1658 1658 #, fuzzy 1659 1659 msgid "Grid Spacing" … … 1662 1662 #. i18n: ectx: Menu (Image) 1663 1663 #. +> trunk stable 1664 #: krita.rc:7 3plugins/colorspaces/lms_f32/lms_f32_plugin.rc:31664 #: krita.rc:72 plugins/colorspaces/lms_f32/lms_f32_plugin.rc:3 1665 1665 #: plugins/extensions/colorspaceconversion/colorspaceconversion.rc:4 1666 1666 #: plugins/extensions/dockers/trianglecolorselector/trianglecolorselector.rc:4 … … 1673 1673 #. i18n: ectx: Menu (Layer) 1674 1674 #. +> trunk stable 1675 #: krita.rc:8 4plugins/extensions/bracketing2hdr/bracketing2hdr.rc:41675 #: krita.rc:83 plugins/extensions/bracketing2hdr/bracketing2hdr.rc:4 1676 1676 #: plugins/extensions/dockers/defaultdockers/kis_layer_box.cpp:310 1677 1677 #: plugins/extensions/histogram/histogram.rc:4 … … 1682 1682 #. i18n: ectx: Menu (LayerNew) 1683 1683 #. +> trunk stable 1684 #: krita.rc:8 5plugins/extensions/bracketing2hdr/bracketing2hdr.rc:51684 #: krita.rc:84 plugins/extensions/bracketing2hdr/bracketing2hdr.rc:5 1685 1685 #, fuzzy 1686 1686 msgid "New" … … 1690 1690 #. i18n: ectx: Menu (Select) 1691 1691 #. +> trunk stable 1692 #: krita.rc:1 10plugins/extensions/colorrange/wdg_colorrange.ui:1331692 #: krita.rc:109 plugins/extensions/colorrange/wdg_colorrange.ui:133 1693 1693 #: plugins/extensions/imagesize/imagesize.rc:12 1694 1694 #: plugins/extensions/modify_selection/modify_selection.rc:4 … … 1699 1699 #. i18n: ectx: Menu (Filter) 1700 1700 #. +> trunk stable 1701 #: krita.rc:12 41701 #: krita.rc:123 1702 1702 #, fuzzy 1703 1703 msgid "Filte&r" … … 1706 1706 #. i18n: ectx: Menu (Tools) 1707 1707 #. +> trunk stable 1708 #: krita.rc:14 1plugins/extensions/extensionsmanager/extensionsmanager.rc:41708 #: krita.rc:140 plugins/extensions/extensionsmanager/extensionsmanager.rc:4 1709 1709 #, fuzzy 1710 1710 msgid "&Tools" … … 1714 1714 #. i18n: ectx: Menu (settings) 1715 1715 #. +> trunk stable 1716 #: krita.rc:14 4plugins/filters/bumpmap/wdgbumpmap.ui:1151716 #: krita.rc:143 plugins/filters/bumpmap/wdgbumpmap.ui:115 1717 1717 msgid "Settings" 1718 1718 msgstr "Postavke" … … 1720 1720 #. i18n: ectx: Menu (help) 1721 1721 #. +> trunk stable 1722 #: krita.rc:15 01722 #: krita.rc:151 1723 1723 #, fuzzy 1724 1724 msgid "&Help" … … 1727 1727 #. i18n: ectx: ToolBar (BrushesAndStuff) 1728 1728 #. +> trunk stable 1729 #: krita.rc:15 81729 #: krita.rc:159 1730 1730 msgid "Brushes and Stuff" 1731 1731 msgstr "" … … 2305 2305 #: plugins/extensions/bracketing2hdr/wdgbracketing2hdr.ui:162 2306 2306 #: plugins/extensions/tonemapping/wdgtonemappingdialog.ui:93 2307 #: ui/forms/wdgfilterdialog.ui:70 ui/kis_view2.cpp: 3982307 #: ui/forms/wdgfilterdialog.ui:70 ui/kis_view2.cpp:412 2308 2308 #, fuzzy 2309 2309 msgid "Cancel" … … 2764 2764 2765 2765 #. +> trunk stable 2766 #: plugins/extensions/dockers/advancedcolorselector/kis_shade_selector_line.cpp:15 52766 #: plugins/extensions/dockers/advancedcolorselector/kis_shade_selector_line.cpp:154 2767 2767 #, kde-format 2768 2768 msgid "delta h=%1 s=%2 v=%3 shift h=%4 s=%5 v=%6" … … 13978 13978 13979 13979 #. +> trunk stable 13980 #: ui/kis_view2.cpp:20 613980 #: ui/kis_view2.cpp:207 13981 13981 msgid "Total Refresh" 13982 13982 msgstr "" 13983 13983 13984 13984 #. +> trunk stable 13985 #: ui/kis_view2.cpp:21 113985 #: ui/kis_view2.cpp:212 13986 13986 #, fuzzy 13987 13987 msgid "&Create Template From Image..." … … 13989 13989 13990 13990 #. +> trunk stable 13991 #: ui/kis_view2.cpp:21 513991 #: ui/kis_view2.cpp:216 13992 13992 #, fuzzy 13993 13993 msgid "Load Tutorial" … … 13995 13995 13996 13996 #. +> trunk stable 13997 #: ui/kis_view2.cpp:26 413997 #: ui/kis_view2.cpp:265 13998 13998 #, fuzzy 13999 13999 msgid "Mirror Image" … … 14018 14018 msgstr "&Bijela" 14019 14019 14020 #. +> trunk 14021 #: ui/kis_view2.cpp:286 14022 #, fuzzy 14023 msgid "Show Status Bar" 14024 msgstr "PrikaÅŸi podnoÅŸje" 14025 14026 #. +> trunk 14027 #: ui/kis_view2.cpp:287 14028 #, fuzzy 14029 #| msgid "Show &status bar" 14030 msgid "Hide Status Bar" 14031 msgstr "&PrikaÅŸi traku stanja" 14032 14020 14033 #. +> stable 14021 14034 #: ui/kis_view2.cpp:287 … … 14024 14037 msgstr "&Alat za linije" 14025 14038 14026 #. +> trunk stable 14027 #: ui/kis_view2.cpp:392 14039 #. +> trunk 14040 #: ui/kis_view2.cpp:289 14041 #, fuzzy 14042 #| msgid "Show &status bar" 14043 msgid "Shows or hides the status bar" 14044 msgstr "&PrikaÅŸi traku stanja" 14045 14046 #. +> trunk 14047 #: ui/kis_view2.cpp:293 14048 #, fuzzy 14049 msgid "Show Canvas Only" 14050 msgstr "Danas" 14051 14052 #. +> trunk 14053 #: ui/kis_view2.cpp:294 14054 #, fuzzy 14055 msgid "Return to Window" 14056 msgstr "Podprozor" 14057 14058 #. +> trunk 14059 #: ui/kis_view2.cpp:295 14060 #, fuzzy 14061 msgid "Shows just the canvas or the whole window" 14062 msgstr "PokaÅŸi ili sakrij traku izbornika u prozoru terminala" 14063 14064 #. +> trunk stable 14065 #: ui/kis_view2.cpp:406 14028 14066 #, fuzzy 14029 14067 msgid "Insert as New Layer" … … 14031 14069 14032 14070 #. +> trunk stable 14033 #: ui/kis_view2.cpp: 39314071 #: ui/kis_view2.cpp:407 14034 14072 #, fuzzy 14035 14073 msgid "Insert as New Layers" … … 14037 14075 14038 14076 #. +> trunk stable 14039 #: ui/kis_view2.cpp: 39514077 #: ui/kis_view2.cpp:409 14040 14078 msgid "Open in New Document" 14041 14079 msgstr "" 14042 14080 14043 14081 #. +> trunk stable 14044 #: ui/kis_view2.cpp: 39614082 #: ui/kis_view2.cpp:410 14045 14083 msgid "Open in New Documents" 14046 14084 msgstr "" 14047 14085 14048 14086 #. +> trunk stable 14049 #: ui/kis_view2.cpp:6 0614087 #: ui/kis_view2.cpp:620 14050 14088 #, fuzzy 14051 14089 msgid "Edit Palette..." … … 14053 14091 14054 14092 #. +> trunk stable 14055 #: ui/kis_view2.cpp:7 21 ui/kis_view2.cpp:72414093 #: ui/kis_view2.cpp:735 ui/kis_view2.cpp:738 14056 14094 #, fuzzy 14057 14095 msgid "Edit Palette" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/koffice/kword.po ¶
r1030 r1036 6 6 "Project-Id-Version: kword 0\n" 7 7 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 8 "POT-Creation-Date: 2011-05-2 1 08:10+0200\n"8 "POT-Creation-Date: 2011-05-25 09:42+0200\n" 9 9 "PO-Revision-Date: 2009-09-29 21:20+0200\n" 10 10 "Last-Translator: Marko Dimjasevic <marko@dimjasevic.net>\n" … … 648 648 #. i18n: ectx: property (text), widget (QPushButton, createButton) 649 649 #. +> trunk stable 650 #: part/dialogs/KWStartupWidget.ui:102 part/KWView.cpp:33 0650 #: part/dialogs/KWStartupWidget.ui:102 part/KWView.cpp:334 651 651 msgid "Create" 652 652 msgstr "Napravi" … … 753 753 #. +> trunk stable 754 754 #: part/dialogs/KWStatisticsDialog.cpp:29 755 #: part/dockers/KWStatisticsDocker.cpp:36 part/KWView.cpp:40 4755 #: part/dockers/KWStatisticsDocker.cpp:36 part/KWView.cpp:408 756 756 msgid "Statistics" 757 757 msgstr "Statistike" … … 1567 1567 1568 1568 #. +> trunk stable 1569 #: part/KWView.cpp:2 561569 #: part/KWView.cpp:260 1570 1570 #, fuzzy 1571 1571 msgid "Frame/Frameset Properties" … … 1573 1573 1574 1574 #. +> trunk stable 1575 #: part/KWView.cpp:2 581575 #: part/KWView.cpp:262 1576 1576 #, fuzzy 1577 1577 msgid "Alter frameset properties" … … 1585 1585 1586 1586 #. +> trunk stable 1587 #: part/KWView.cpp:2 661587 #: part/KWView.cpp:270 1588 1588 msgid "Page Break" 1589 1589 msgstr "Prijelom stranice" 1590 1590 1591 1591 #. +> trunk stable 1592 #: part/KWView.cpp:2 671592 #: part/KWView.cpp:271 1593 1593 msgid "Force the remainder of the text into the next page" 1594 1594 msgstr "" 1595 1595 1596 1596 #. +> trunk stable 1597 #: part/KWView.cpp:2 681597 #: part/KWView.cpp:272 1598 1598 msgid "All text after this point will be moved into the next page." 1599 1599 msgstr "" 1600 1600 1601 1601 #. +> trunk stable 1602 #: part/KWView.cpp:27 01602 #: part/KWView.cpp:274 1603 1603 msgid "Enable Document Headers" 1604 1604 msgstr "OmoguÄi zaglavlja dokumenta" 1605 1605 1606 1606 #. +> trunk stable 1607 #: part/KWView.cpp:27 21607 #: part/KWView.cpp:276 1608 1608 msgid "Disable Document Headers" 1609 1609 msgstr "OnemoguÄi zaglavlja dokumenta" 1610 1610 1611 1611 #. +> trunk stable 1612 #: part/KWView.cpp:27 31612 #: part/KWView.cpp:277 1613 1613 #, fuzzy 1614 1614 msgid "Shows and hides header display" … … 1616 1616 1617 1617 #. +> trunk 1618 #: part/KWView.cpp:27 41618 #: part/KWView.cpp:278 1619 1619 msgid "Selecting this option toggles the display of headers in Words.<br/><br/>Headers are special frames at the top of each page which can contain page numbers or other information." 1620 1620 msgstr "" … … 1631 1631 1632 1632 #. +> trunk stable 1633 #: part/KWView.cpp:2 791633 #: part/KWView.cpp:283 1634 1634 msgid "Enable Document Footers" 1635 1635 msgstr "OmoguÄi podnoÅŸja dokumenta" 1636 1636 1637 1637 #. +> trunk stable 1638 #: part/KWView.cpp:28 11638 #: part/KWView.cpp:285 1639 1639 msgid "Disable Document Footers" 1640 1640 msgstr "OmoguÄi podnoÅŸja dokumenta" 1641 1641 1642 1642 #. +> trunk stable 1643 #: part/KWView.cpp:28 21643 #: part/KWView.cpp:286 1644 1644 #, fuzzy 1645 1645 msgid "Shows and hides footer display" … … 1647 1647 1648 1648 #. +> trunk 1649 #: part/KWView.cpp:28 31649 #: part/KWView.cpp:287 1650 1650 msgid "Selecting this option toggles the display of footers in Words. <br/><br/>Footers are special frames at the bottom of each page which can contain page numbers or other information." 1651 1651 msgstr "" … … 1662 1662 1663 1663 #. +> trunk stable 1664 #: part/KWView.cpp:2 881664 #: part/KWView.cpp:292 1665 1665 #, fuzzy 1666 1666 msgid "Snap to Grid" … … 1668 1668 1669 1669 #. +> trunk stable 1670 #: part/KWView.cpp:29 31670 #: part/KWView.cpp:297 1671 1671 #, fuzzy 1672 1672 msgid "Raise Frame" … … 1680 1680 1681 1681 #. +> trunk stable 1682 #: part/KWView.cpp: 2961682 #: part/KWView.cpp:300 1683 1683 #, fuzzy 1684 1684 msgid "Raise the currently selected frame so that it appears above all the other frames" … … 1692 1692 1693 1693 #. +> trunk stable 1694 #: part/KWView.cpp: 2981694 #: part/KWView.cpp:302 1695 1695 msgid "Raise the currently selected frame so that it appears above all the other frames. This is only useful if frames overlap each other. If multiple frames are selected they are all raised in turn." 1696 1696 msgstr "" … … 1702 1702 1703 1703 #. +> trunk stable 1704 #: part/KWView.cpp:30 31704 #: part/KWView.cpp:307 1705 1705 #, fuzzy 1706 1706 msgid "Lower Frame" … … 1714 1714 1715 1715 #. +> trunk stable 1716 #: part/KWView.cpp:3 061716 #: part/KWView.cpp:310 1717 1717 msgid "Lower the currently selected frame so that it disappears under any frame that overlaps it" 1718 1718 msgstr "" … … 1725 1725 1726 1726 #. +> trunk stable 1727 #: part/KWView.cpp:3 081727 #: part/KWView.cpp:312 1728 1728 msgid "Lower the currently selected frame so that it disappears under any frame that overlaps it. If multiple frames are selected they are all lowered in turn." 1729 1729 msgstr "" … … 1735 1735 1736 1736 #. +> trunk stable 1737 #: part/KWView.cpp:31 21737 #: part/KWView.cpp:316 1738 1738 msgid "Bring to Front" 1739 1739 msgstr "Stavi ispred" 1740 1740 1741 1741 #. +> trunk stable 1742 #: part/KWView.cpp:3 161742 #: part/KWView.cpp:320 1743 1743 msgid "Send to Back" 1744 1744 msgstr "PoÅ¡alji unazad" 1745 1745 1746 1746 #. +> trunk stable 1747 #: part/KWView.cpp:32 01747 #: part/KWView.cpp:324 1748 1748 msgid "Variable" 1749 1749 msgstr "Varijabla" 1750 1750 1751 1751 #. +> trunk stable 1752 #: part/KWView.cpp:3 381752 #: part/KWView.cpp:342 1753 1753 msgid "Bookmark..." 1754 1754 msgstr "Oznaka âŠ" 1755 1755 1756 1756 #. +> trunk stable 1757 #: part/KWView.cpp:34 31757 #: part/KWView.cpp:347 1758 1758 #, fuzzy 1759 1759 msgid "Select Bookmark..." … … 1761 1761 1762 1762 #. +> trunk 1763 #: part/KWView.cpp:34 41763 #: part/KWView.cpp:348 1764 1764 #, fuzzy 1765 1765 msgid "Bookmark" … … 1767 1767 1768 1768 #. +> trunk 1769 #: part/KWView.cpp:35 01769 #: part/KWView.cpp:354 1770 1770 #, fuzzy 1771 1771 msgid "Picture..." … … 1778 1778 1779 1779 #. +> trunk stable 1780 #: part/KWView.cpp:35 11780 #: part/KWView.cpp:355 1781 1781 msgid "Insert a picture into document" 1782 1782 msgstr "" … … 1789 1789 1790 1790 #. +> trunk 1791 #: part/KWView.cpp:35 51791 #: part/KWView.cpp:359 1792 1792 msgid "Footnote/Endnote..." 1793 1793 msgstr "" 1794 1794 1795 1795 #. +> trunk 1796 #: part/KWView.cpp:3 561796 #: part/KWView.cpp:360 1797 1797 #, fuzzy 1798 1798 msgid "Insert a footnote referencing the selected text" … … 1800 1800 1801 1801 #. +> trunk 1802 #: part/KWView.cpp:360 1802 #: part/KWView.cpp:363 1803 #, fuzzy 1804 msgid "Anchor to Text" 1805 msgstr "Tekst objave" 1806 1807 #. +> trunk 1808 #: part/KWView.cpp:364 1803 1809 #, fuzzy 1804 1810 msgid "Page Borders" … … 1817 1823 1818 1824 #. +> trunk stable 1819 #: part/KWView.cpp:36 11825 #: part/KWView.cpp:365 1820 1826 msgid "Turns the border display on and off" 1821 1827 msgstr "" … … 1826 1832 msgstr "" 1827 1833 1828 #. +> trunk 1829 #: part/KWView.cpp:363 1830 #, fuzzy 1831 msgid "Anchor to Text" 1832 msgstr "Tekst objave" 1833 1834 #. +> trunk stable 1835 #: part/KWView.cpp:366 1834 #. +> trunk stable 1835 #: part/KWView.cpp:370 1836 1836 msgid "Turns the border display on and off.<br/><br/>The borders are never printed. This option is useful to see how the document will appear on the printed page." 1837 1837 msgstr "" 1838 1838 1839 1839 #. +> trunk stable 1840 #: part/KWView.cpp:3 681840 #: part/KWView.cpp:372 1841 1841 #, fuzzy 1842 1842 #| msgid "Page &Layout..." … … 1845 1845 1846 1846 #. +> trunk stable 1847 #: part/KWView.cpp:37 01847 #: part/KWView.cpp:374 1848 1848 msgid "Change properties of entire page" 1849 1849 msgstr "Promijeni svojstva cijele stranice" 1850 1850 1851 1851 #. +> trunk stable 1852 #: part/KWView.cpp:37 11852 #: part/KWView.cpp:375 1853 1853 msgid "Change properties of the entire page.<p>Currently you can change paper size, paper orientation, header and footer sizes, and column settings.</p>" 1854 1854 msgstr "" 1855 1855 1856 1856 #. +> trunk stable 1857 #: part/KWView.cpp:37 51857 #: part/KWView.cpp:379 1858 1858 #, fuzzy 1859 1859 msgid "Semantic Stylesheets..." … … 1861 1861 1862 1862 #. +> trunk stable 1863 #: part/KWView.cpp:3 771863 #: part/KWView.cpp:381 1864 1864 msgid "Modify and add semantic stylesheets" 1865 1865 msgstr "" 1866 1866 1867 1867 #. +> trunk stable 1868 #: part/KWView.cpp:3 781868 #: part/KWView.cpp:382 1869 1869 msgid "Stylesheets are used to format contact, event, and location information which is stored in Rdf" 1870 1870 msgstr "" 1871 1871 1872 1872 #. +> trunk stable 1873 #: part/KWView.cpp:38 21873 #: part/KWView.cpp:386 1874 1874 #, fuzzy 1875 1875 msgid "Make inline" … … 1877 1877 1878 1878 #. +> trunk stable 1879 #: part/KWView.cpp:38 31879 #: part/KWView.cpp:387 1880 1880 #, fuzzy 1881 1881 msgid "Convert current frame to an inline frame" … … 1889 1889 1890 1890 #. +> trunk stable 1891 #: part/KWView.cpp:38 41891 #: part/KWView.cpp:388 1892 1892 msgid "Convert the current frame to an inline frame.<br><br>Place the inline frame within the text at the point nearest to the frames current position." 1893 1893 msgstr "" … … 1899 1899 1900 1900 #. +> trunk stable 1901 #: part/KWView.cpp:3 881901 #: part/KWView.cpp:392 1902 1902 #, fuzzy 1903 1903 msgid "Previous Page" … … 1905 1905 1906 1906 #. +> trunk stable 1907 #: part/KWView.cpp:39 21907 #: part/KWView.cpp:396 1908 1908 #, fuzzy 1909 1909 msgid "Next Page" … … 1917 1917 1918 1918 #. +> trunk stable 1919 #: part/KWView.cpp:4 061919 #: part/KWView.cpp:410 1920 1920 msgid "Sentence, word and letter counts for this document" 1921 1921 msgstr "" 1922 1922 1923 1923 #. +> trunk stable 1924 #: part/KWView.cpp:4 071924 #: part/KWView.cpp:411 1925 1925 msgid "Information on the number of letters, words, syllables and sentences for this document.<p>Evaluates readability using the Flesch reading score.</p>" 1926 1926 msgstr "" 1927 1927 1928 1928 #. +> trunk stable 1929 #: part/KWView.cpp:41 01929 #: part/KWView.cpp:414 1930 1930 msgid "Show Rulers" 1931 1931 msgstr "P&odnoÅŸje" 1932 1932 1933 1933 #. +> trunk stable 1934 #: part/KWView.cpp:41 21934 #: part/KWView.cpp:416 1935 1935 #, fuzzy 1936 1936 msgid "Shows or hides rulers" … … 1938 1938 1939 1939 #. +> trunk stable 1940 #: part/KWView.cpp:41 31940 #: part/KWView.cpp:417 1941 1941 msgid "The rulers are the white measuring spaces top and left of the document. The rulers show the position and width of pages and of frames and can be used to position tabulators among others.<p>Uncheck this to disable the rulers from being displayed.</p>" 1942 1942 msgstr "" … … 1948 1948 1949 1949 #. +> trunk stable 1950 #: part/KWView.cpp:42 11950 #: part/KWView.cpp:425 1951 1951 #, fuzzy 1952 1952 msgid "Page..." … … 1954 1954 1955 1955 #. +> trunk stable 1956 #: part/KWView.cpp:42 51956 #: part/KWView.cpp:429 1957 1957 msgid "Delete Page" 1958 1958 msgstr "IzbriÅ¡i tabelu" 1959 1959 1960 1960 #. +> trunk stable 1961 #: part/KWView.cpp:43 21961 #: part/KWView.cpp:436 1962 1962 #, fuzzy 1963 1963 #| msgid "&Formatting Characters" … … 1966 1966 1967 1967 #. +> trunk stable 1968 #: part/KWView.cpp:4 361968 #: part/KWView.cpp:440 1969 1969 msgid "Toggle the display of non-printing characters" 1970 1970 msgstr "" 1971 1971 1972 1972 #. +> trunk 1973 #: part/KWView.cpp:4 371973 #: part/KWView.cpp:441 1974 1974 msgid "Toggle the display of non-printing characters.<br/><br/>When this is enabled, Words shows you tabs, spaces, carriage returns and other non-printing characters." 1975 1975 msgstr "" … … 1981 1981 1982 1982 #. +> trunk stable 1983 #: part/KWView.cpp:44 01983 #: part/KWView.cpp:444 1984 1984 #, fuzzy 1985 1985 msgid "Select All Frames" … … 1995 1995 #: part/KWView.cpp:445 1996 1996 #, fuzzy 1997 msgid "Create Custom Outline" 1998 msgstr "Napravi &tabelu" 1999 2000 #. +> trunk stable 2001 #: part/KWView.cpp:447 2002 msgid "Create a custom vector outline that text will run around" 2003 msgstr "" 2004 2005 #. +> trunk stable 2006 #: part/KWView.cpp:448 2007 msgid "Text normally runs around the content of a shape, when you want a custom outline that is independent of the content you can create one and alter it with the vector tools" 2008 msgstr "" 2009 2010 #. +> trunk stable 2011 #: part/KWView.cpp:449 2012 #, fuzzy 1997 2013 msgid "Delete" 1998 2014 msgstr "IzbriÅ¡i Red" 1999 2015 2000 2016 #. +> trunk stable 2001 #: part/KWView.cpp:445 2002 #, fuzzy 2003 msgid "Create Custom Outline" 2004 msgstr "Napravi &tabelu" 2005 2006 #. +> trunk stable 2007 #: part/KWView.cpp:447 2008 msgid "Create a custom vector outline that text will run around" 2009 msgstr "" 2010 2011 #. +> trunk stable 2012 #: part/KWView.cpp:448 2013 msgid "Text normally runs around the content of a shape, when you want a custom outline that is independent of the content you can create one and alter it with the vector tools" 2014 msgstr "" 2015 2016 #. +> trunk stable 2017 #: part/KWView.cpp:458 part/KWView.cpp:1226 2017 #: part/KWView.cpp:459 2018 #, fuzzy 2019 msgid "Add Text on Shape" 2020 msgstr "Dodaj tekst&ualnu oznaku" 2021 2022 #. +> trunk stable 2023 #: part/KWView.cpp:462 part/KWView.cpp:1230 2018 2024 #, fuzzy 2019 2025 msgid "Create Linked Copy" … … 2021 2027 2022 2028 #. +> trunk stable 2023 #: part/KWView.cpp:4592024 #, fuzzy2025 msgid "Add Text on Shape"2026 msgstr "Dodaj tekst&ualnu oznaku"2027 2028 #. +> trunk stable2029 2029 #: part/KWView.cpp:1224 2030 2030 #, fuzzy … … 2033 2033 2034 2034 #. +> trunk stable 2035 #: part/KWView.cpp:46 02035 #: part/KWView.cpp:464 2036 2036 msgid "Create a copy of the current frame, always showing the same contents" 2037 2037 msgstr "" … … 2043 2043 2044 2044 #. +> trunk stable 2045 #: part/KWView.cpp:46 12045 #: part/KWView.cpp:465 2046 2046 msgid "Create a copy of the current frame, that remains linked to it. This means they always show the same contents: modifying the contents in such a frame will update all its linked copies." 2047 2047 msgstr "" … … 2053 2053 2054 2054 #. +> trunk stable 2055 #: part/KWView.cpp:46 42055 #: part/KWView.cpp:468 2056 2056 #, fuzzy 2057 2057 msgid "Create Frame-clip" … … 2065 2065 2066 2066 #. +> trunk stable 2067 #: part/KWView.cpp:4 682067 #: part/KWView.cpp:472 2068 2068 #, fuzzy 2069 2069 msgid "Remove Frame-clip" … … 2077 2077 2078 2078 #. +> trunk stable 2079 #: part/KWView.cpp:47 22079 #: part/KWView.cpp:476 2080 2080 #, fuzzy 2081 2081 msgid "Show Status Bar" … … 2083 2083 2084 2084 #. +> trunk stable 2085 #: part/KWView.cpp:47 32085 #: part/KWView.cpp:477 2086 2086 #, fuzzy 2087 2087 #| msgid "Show &status bar" … … 2090 2090 2091 2091 #. +> trunk stable 2092 #: part/KWView.cpp:47 42092 #: part/KWView.cpp:478 2093 2093 #, fuzzy 2094 2094 #| msgid "Show &status bar" … … 2097 2097 2098 2098 #. +> trunk stable 2099 #: part/KWView.cpp:116 52099 #: part/KWView.cpp:1169 2100 2100 msgid "Please select at least one non-locked shape and try again" 2101 2101 msgstr "" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/playground-base/desktop_playground-base.po ¶
r1021 r1036 9 9 "Project-Id-Version: desktop files\n" 10 10 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 11 "POT-Creation-Date: 2011-05- 16 09:02+0200\n"11 "POT-Creation-Date: 2011-05-25 09:42+0200\n" 12 12 "PO-Revision-Date: 2010-04-30 19:05+0200\n" 13 13 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n" … … 1092 1092 1093 1093 #. +> trunk 1094 #: plasma/applets/dataengines_tasks/plasma-applet-dataengines_tasks.desktop: 81094 #: plasma/applets/dataengines_tasks/plasma-applet-dataengines_tasks.desktop:9 1095 1095 msgctxt "Comment" 1096 1096 msgid "Applet displaying tasks using dataengines" -
TabularUnified kde-croatia/kde4/summit/hr/summit/messages/playground-multimedia/desktop_playground-multimedia_plasma-mediacenter.po ¶
r1032 r1036 9 9 "Project-Id-Version: desktop files\n" 10 10 "Report-Msgid-Bugs-To: http://bugs.kde.org\n" 11 "POT-Creation-Date: 2011-05-2 3 09:11+0200\n"11 "POT-Creation-Date: 2011-05-25 09:42+0200\n" 12 12 "PO-Revision-Date: 2010-04-30 19:05+0200\n" 13 13 "Last-Translator: Andrej Dundovic <adundovi@gmail.com>\n" … … 259 259 260 260 #. +> trunk 261 #: dataengines/mediacentercontrol/plasma-engine-mediacentercontrol.desktop:2 262 #, fuzzy 263 msgctxt "Name" 264 msgid "MediaCenterControl" 265 msgstr "MultiMedijaUpravitelj" 266 267 #. +> trunk 268 #: dataengines/mediacentercontrol/plasma-engine-mediacentercontrol.desktop:3 269 #, fuzzy 270 msgctxt "Comment" 271 msgid " controlling the MediaCenter" 272 msgstr "Upravljanje sjednicama." 273 274 #. +> trunk 261 275 #: dataengines/picasa/plasma-engine-picasa.desktop:2 262 276 #, fuzzy
Note: See TracChangeset
for help on using the changeset viewer.